Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL060W (YBP2)64163032490.0
Scas_563.1066664313351e-177
Scas_686.1966363410501e-134
Kwal_14.181268465410131e-129
YBR216C (YBP1)6746239411e-118
KLLA0C05698g7026417752e-93
CAGL0K06743g6556267634e-92
AAR159C6136326513e-76
CAGL0F06985g6306516313e-73
YGL192W (IME4)60066721.2
Kwal_23.5962552118693.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL060W
         (630 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL060W (YBP2) [1919] chr7 (390068..391993) Protein involved in ...  1256   0.0  
Scas_563.10                                                           518   e-177
Scas_686.19                                                           409   e-134
Kwal_14.1812                                                          394   e-129
YBR216C (YBP1) [397] chr2 complement(655533..657557) Protein wit...   367   e-118
KLLA0C05698g complement(508204..510312) weakly similar to sp|P38...   303   2e-93
CAGL0K06743g complement(656238..658205) similar to sp|P38315 Sac...   298   4e-92
AAR159C [347] [Homologous to ScYBR216C - SH; ScYGL060W - SH] (63...   255   3e-76
CAGL0F06985g 684832..686724 similar to sp|P53169 Saccharomyces c...   247   3e-73
YGL192W (IME4) [1801] chr7 (142250..144052) Positive transcripti...    32   1.2  
Kwal_23.5962                                                           31   3.1  

>YGL060W (YBP2) [1919] chr7 (390068..391993) Protein involved in
           stress resistance [1926 bp, 641 aa]
          Length = 641

 Score = 1256 bits (3249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/630 (97%), Positives = 614/630 (97%)

Query: 1   MYNEQVNSGKSIKEKERYLDALLKILKDNPVTLKEIGWDLPKGLLQFFSRKNINVNIHLV 60
           MYNEQVNSGKSIKEKERYLDALLKILKDNPVTLKEIGWDLPKGLLQFFSRKNINVNIHLV
Sbjct: 1   MYNEQVNSGKSIKEKERYLDALLKILKDNPVTLKEIGWDLPKGLLQFFSRKNINVNIHLV 60

Query: 61  FSPLVSSVMECFNELAINGNPKECLLTACELVSTLHIVLTETGXXXXXXXXXXXXXXXXA 120
           FSPLVSSVMECFNELAINGNPKECLLTACELVSTLHIVLTETG                A
Sbjct: 61  FSPLVSSVMECFNELAINGNPKECLLTACELVSTLHIVLTETGDSDEENEDLNDSNRNDA 120

Query: 121 SNITDELSVITPEIGHYMAKNTVEFIPNLKIYVLFEFMSLLLKRVDTLYPSKFLAMVTSA 180
           SNITDELSVITPEIGHYMAKNTVEFIPNLKIYVLFEFMSLLLKRVDTLYPSKFLAMVTSA
Sbjct: 121 SNITDELSVITPEIGHYMAKNTVEFIPNLKIYVLFEFMSLLLKRVDTLYPSKFLAMVTSA 180

Query: 181 IIKYVTTNVQAMDDPHFILRIVYNFCTNYSPAQPSASLTDGISTNDLEKIHDDESALQKK 240
           IIKYVTTNVQAMDDPHFILRIVYNFCTNYSPAQPSASLTDGISTNDLEKIHDDESALQKK
Sbjct: 181 IIKYVTTNVQAMDDPHFILRIVYNFCTNYSPAQPSASLTDGISTNDLEKIHDDESALQKK 240

Query: 241 LLANLSVFVISNCLKNHPGNIDKIYFKTLMHKKTDENEIDASVLQICHQYYEYVTSLDVH 300
           LLANLSVFVISNCLKNHPGNIDKIYFKTLMHKKTDENEIDASVLQICHQYYEYVTSLDVH
Sbjct: 241 LLANLSVFVISNCLKNHPGNIDKIYFKTLMHKKTDENEIDASVLQICHQYYEYVTSLDVH 300

Query: 301 MKELLEKCLVESRSIYNSLLMNPAASTPEFKEEINQLVYEVSYAYQIKKLADEKNLELDQ 360
           MKELLEKCLVESRSIYNSLLMNPAASTPEFKEEINQLVYEVSYAYQIKKLADEKNLELDQ
Sbjct: 301 MKELLEKCLVESRSIYNSLLMNPAASTPEFKEEINQLVYEVSYAYQIKKLADEKNLELDQ 360

Query: 361 YGVVILSAIHYSKNGTHLLPQIDIQSAIYLYLRCTTASLFSEIYENKFLESSVRYWLWVS 420
           YGVVILSAIHYSKNGTHLLPQIDIQSAIYLYLRCTTASLFSEIYENKFLESSVRYWLWVS
Sbjct: 361 YGVVILSAIHYSKNGTHLLPQIDIQSAIYLYLRCTTASLFSEIYENKFLESSVRYWLWVS 420

Query: 421 TTETSTEKIKCALQELPGHITTAFLQMLLMKTCNESNNDTKLTEITLLRRLLYLMPESTS 480
           TTETSTEKIKCALQELPGHITTAFLQMLLMKTCNESNNDTKLTEITLLRRLLYLMPESTS
Sbjct: 421 TTETSTEKIKCALQELPGHITTAFLQMLLMKTCNESNNDTKLTEITLLRRLLYLMPESTS 480

Query: 481 FTFIFETLLHCPYITAKIAVLDILRDMMIRSPEAANRDETVGLIEQQNPGNTANSVPIMP 540
           FTFIFETLLHCPYITAKIAVLDILRDMMIRSPEAANRDETVGLIEQQNPGNTANSVPIMP
Sbjct: 481 FTFIFETLLHCPYITAKIAVLDILRDMMIRSPEAANRDETVGLIEQQNPGNTANSVPIMP 540

Query: 541 TLPPRPYITINEDRMASIHSIALICFSAAKQKKRTQGDLLLVLTYMKFFVSLRNKWDLGL 600
           TLPPRPYITINEDRMASIHSIALICFSAAKQKKRTQGDLLLVLTYMKFFVSLRNKWDLGL
Sbjct: 541 TLPPRPYITINEDRMASIHSIALICFSAAKQKKRTQGDLLLVLTYMKFFVSLRNKWDLGL 600

Query: 601 LTLINKEISESFQGEGEPELAFINISNNTL 630
           LTLINKEISESFQGEGEPELAFINISNNTL
Sbjct: 601 LTLINKEISESFQGEGEPELAFINISNNTL 630

>Scas_563.10
          Length = 666

 Score =  518 bits (1335), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 280/643 (43%), Positives = 395/643 (61%), Gaps = 33/643 (5%)

Query: 1   MYNEQVNSGKSIKEKERYLDALLKILKDNPVTLKEIGWDLPKGLLQFFSRKNINVNIHLV 60
           MY +++N   SI EK +YL+ L  +L DNP  L+EI WDLPKGLL+F S +NI+V+  L 
Sbjct: 36  MYGQEINEDGSIDEKNKYLEHLCSLLNDNPHILREISWDLPKGLLEFLSLENIDVHKRLA 95

Query: 61  FSPLVSSVMECFNELAINGNPKECLLTACELVSTLHIVLTETGXXXXXXXXXXXXXXXXA 120
            S +VS+VM+CFNE+AINGNPKECLL ACEL+S L +                       
Sbjct: 96  DSSIVSNVMKCFNEIAINGNPKECLLAACELLSELTVEPVMENETEEEEGGKDNKKTDGD 155

Query: 121 SNITDELSVITPEIGHYMAKNTVEFIPNLKIYVLFEFMSLLLKRVDTLYPSKFLAMVTSA 180
              TD  S        Y+ ++  EFIP+LK+Y +F+ ++  L R+ TLYPSKFL M  SA
Sbjct: 156 ETPTDLNS------SDYIERDLTEFIPSLKVYAIFQLLNSTLGRIITLYPSKFLNMAISA 209

Query: 181 IIKYVTTNVQAMDDPHFILRIVYNFCTNYSPAQPSASLTDGISTND--LEKIHDDESALQ 238
           I+K++ TN+  + D  F+LR ++ FC NY    P   L DG   ND  ++K+ DDE  LQ
Sbjct: 210 IMKFMATNINDIADVTFLLRRIHEFCNNYDVHAPDRKLIDGSDLNDEEIKKLTDDEFDLQ 269

Query: 239 KKLLANLSVFVISNCLKNHPGNIDKIYFKTLMHKKTDENEIDASVLQICHQYYEYVTSLD 298
            KL+  L    +S CLKN P   D  YF++L H+K +E+E  A +     QY   V    
Sbjct: 270 NKLIKELFCSALSICLKNQPTTFDVKYFESLTHQKFEESEHYAVIRT---QYLGLVNKYK 326

Query: 299 VHMKELLEKCLVESRSIYNSLLMNPAASTPEFKEEINQLVYEVSYAYQIKKLADEKNLEL 358
           + +KE   +CL ESR IY SL  +   S  + K  +NQ++Y++SY YQ++K++++  LE+
Sbjct: 327 IDIKEEFLQCLQESRQIYESLPSDIDESDEKKKSALNQVIYQLSYRYQMQKISNQDTLEI 386

Query: 359 DQYGVVILSAIHYSKNGTHLLPQIDIQSAIYLYLRCTTASLFSEIYENKFLESSVRYWLW 418
           D   +++LS  +Y++ G HLLPQI IQ A+YLYLRC+T SL+S+ + N+ ++   RYWLW
Sbjct: 387 DFNSIILLSGSYYAETGLHLLPQISIQDAVYLYLRCSTISLYSDTFSNEAVKGVTRYWLW 446

Query: 419 VSTTETSTEKIKCALQELPGHITTAFLQMLLMKTCNESNNDTKLTEITLLRRLLYLMPES 478
           V+ T++  ++I+  L ++P H  T FLQMLL+  CNE +   ++   TLL R+L LMPE 
Sbjct: 447 VAITQSPIKEIEQNLLKIPSHFNTVFLQMLLLNNCNEKDGKIRMATFTLLTRILCLMPED 506

Query: 479 TSFTFIFETLLHCPYITAKIAVLDILRDMMIRSPEAANRDE----TVGLIEQQNPGNTAN 534
            SF FI +TLL CPY +AK +VL IL+D+M++  + +   E    T+ +  ++N G    
Sbjct: 507 LSFQFILDTLLTCPYNSAKSSVLAILKDLMLKDNQISKPLEEELSTLDISSEKNKG---- 562

Query: 535 SVPIMPTLPPRPYITINEDRMASIHSIALICFSAAK----QKKRTQGDLLLVLTYMKFFV 590
                PTLPPRPYI INEDRMAS+HS+A +C S  K      KRT+  L L+L YM FF+
Sbjct: 563 -----PTLPPRPYILINEDRMASLHSVASMCISNLKLLDNPNKRTE--LSLLLNYMNFFI 615

Query: 591 SLRNKWDLGLLTLINKEISESFQG---EGEPELAFINISNNTL 630
           SLR KW++ LL +I+ E+     G   E  PEL FI I+N TL
Sbjct: 616 SLRYKWNVNLLQIIHDEVDAKLAGVEDEAAPELGFIKIANETL 658

>Scas_686.19
          Length = 663

 Score =  409 bits (1050), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 221/634 (34%), Positives = 359/634 (56%), Gaps = 31/634 (4%)

Query: 1   MYNEQVNSGKSIKEKERYLDALLKILKDNPVTLKEIGWDLPKGLLQFFSRKNINVNIHLV 60
           MY +Q+N    I +KE++L ALL ++KD+P  +  I WD PK +L+F +  N++V   L 
Sbjct: 31  MYIDQINMDGEIDDKEQFLTALLGLMKDHPDVVARISWDFPKEILKFLTTANVDVTKRLG 90

Query: 61  FSPLVSSVMECFNELAINGNPKECLLTACELVSTLHIVLTETGXXXXXXXXXXXXXXXXA 120
           +S ++S VM+CFNE+A +  PKECLLT CEL+S L +                       
Sbjct: 91  YSVIISLVMKCFNEIAFSAEPKECLLTGCELLSNLSL---------ENENIELEMEQGDH 141

Query: 121 SNITDELSVITPEIGHYMAKNT-VEFIPNLKIYVLFEFMSLLLKRVDTLYPSKFLAMVTS 179
           +N   +    + EIG Y A+ T  +F  ++K+Y+LFE +   L+R+ TL PSK+L + TS
Sbjct: 142 TNSKGQTHYSSAEIGKYHAERTPADFFVSVKMYILFELIGTTLQRIPTLNPSKYLGLATS 201

Query: 180 AIIKYVTTNVQAMDDPHFILRIVYNFCTNYSPAQPSASLT----DGISTNDLEKIHDDES 235
           A+I+++  N   ++D   ++R +++FC NY P  P  SL       ++  DL +I + E 
Sbjct: 202 AMIRFIKANCDGINDVRIVMRRIFSFCRNYVP--PDTSLCVIKDRSLTKEDLIRIEEREL 259

Query: 236 ALQKKLLANLSVFVISNCLKNHPGNIDKIYFKTLMHKKTDENEIDASVLQICHQYYEYVT 295
           A Q+++L NL    +  CLK   G  D  YF  L + +         + ++  +++    
Sbjct: 260 ASQRRILRNLCTIGLETCLKAINGRTDVKYFYFLSNTEFTLAGFYKDISEVNSRFFNLAL 319

Query: 296 SLDVHMKELLEKCLVESRSIYNSLLMNPAASTPEFKEEINQLVYEVSYAYQIKKLADEKN 355
           S D+ +K+   +C+  S  IY  L  + +  + E K+ I Q VY+++Y+Y+++++A  KN
Sbjct: 320 SFDIDIKKEFLECVKTSHDIYKGLPKDSSIGSEEAKKLIQQTVYKLAYSYELQRIAKHKN 379

Query: 356 LELDQYGVVILSAIHYSKNGTHLLPQIDIQSAIYLYLRCTTASLFSEIYENKFLESSVRY 415
           ++LD  G+VILS ++Y +   HL PQI ++ AIYLYLRCTT SLFS+ YEN  +ES VRY
Sbjct: 380 VQLDPLGIVILSGVYYMETDKHLYPQITVKDAIYLYLRCTTPSLFSKFYENFSVESVVRY 439

Query: 416 WLWVSTTETSTEKIKCALQELPGHITTAFLQMLLMKTCNESNNDTKLTEITLLRRLLYLM 475
           WLWVS T  S+  ++  L+ELP ++ T FLQ  L K C + N + ++   TL  R+L L+
Sbjct: 440 WLWVSITNHSSAVLRKELEELPSYLLTTFLQTFLSKNCKQPNEEIRMVSFTLFTRILCLI 499

Query: 476 PESTSFTFIFETLLHCPYITAKIAVLDILRDMMIRSPEAANRDETVGLIEQQNPGNTANS 535
           PE+ +F FI ETL    Y   K +VL IL+D+M      + R     L    N    +NS
Sbjct: 500 PEAVTFKFILETLTASSYPHVKSSVLGILKDLM------SKRRSCQDLCANDNDEALSNS 553

Query: 536 VPIM---------PTLPPRPYITINEDRMASIHSIALICFSAAKQKKRTQGDLLLVLTYM 586
           +  +           +  + Y+ ++E+RM  IH +AL   ++ +++K T+ +++L+L Y+
Sbjct: 554 LAKLKINSKKNEGAGVESQVYVEVSEERMNEIHHLALRAINSLEEEKTTRANIILILNYL 613

Query: 587 KFFVSLRNKWDLGLLTLINKEISESFQGEGEPEL 620
           +FF  L ++WD  LL  I+ EI +  +   + +L
Sbjct: 614 EFFNGLHSEWDKSLLQSIHDEIEDKVENCSDEDL 647

>Kwal_14.1812
          Length = 684

 Score =  394 bits (1013), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 234/654 (35%), Positives = 369/654 (56%), Gaps = 37/654 (5%)

Query: 1   MYNEQVNSGKSIKEKERYLDALLKILKDNPVTLKEIGWDLPKGLLQFFSRKNINVNIHLV 60
           +Y  +VN  +  +EK ++L+ LLK ++D+   ++++GWDLPK L++F + +N+++N  L+
Sbjct: 31  LYASEVNKKEGGEEKAQFLEILLKRIQDDHHLIQQVGWDLPKVLIRFINTRNVDLNTRLL 90

Query: 61  FSPLVSSVMECFNELAINGNPKECLLTACELVSTLHIVLTETGXXXXXXXXXXXXXXXXA 120
           ++ +V++ ++CFNE+A++GN KEC LT CEL+  L +  +E                   
Sbjct: 91  YNGVVATSLKCFNEIALHGNAKECFLTGCELLGELELHPSEKVQEEHEEDATEAVEVEAQ 150

Query: 121 SNITDELSVITPEIGHYMAKNTV---------EFIPNLKIYVLFEFMSLLLKRVDTLYPS 171
           +  +       P++    +  TV         E +  +K+++L E ++  L+R+ T YPS
Sbjct: 151 AIKSTPEEANGPKMNAQTSSRTVVRPLSRDPEELVLEVKLHMLLELINSTLRRIRTCYPS 210

Query: 172 KFLAMVTSAIIKYVTTNVQAMDDPHFILRIVYNFCTNYSPAQPSASLTDGISTNDLEKIH 231
           +FLAM  S+I  +V +N   +DD  F+LR VY F  N+ P Q +A     +ST ++ K+ 
Sbjct: 211 RFLAMAVSSIFSFVRSNSIDIDDTTFVLRRVYTFARNFIPPQSNAEAYKDMSTEEILKVR 270

Query: 232 DDESALQKKLLANLSVFVISNCLKNHPGNIDKIYFKTLMHKKTD--ENEIDASVLQICHQ 289
           DDE ALQ+KLL  L  F I   ++    NI   YF  L +K T   E E+  ++  I  +
Sbjct: 271 DDEEALQRKLLRCLLTFSIGQLVRPRVLNIATEYFFRLKNKYTTDFEYEMRVNLKHILSR 330

Query: 290 YYEYVTSLDVHMKE-LLEKCLVESRSIYNSL-----LMNPAASTPEFKEEINQLVYEVSY 343
           YY+   S D+ +KE  L++C+ +S +IY SL     L+N AA     +  I QLVY++SY
Sbjct: 331 YYQLAYSFDIDVKEEFLKQCVKDSSAIYQSLPNDSELINDAA-----RNGITQLVYQLSY 385

Query: 344 AYQIKKLADEKNLELDQYGVVILSAIHYSKNGTHLLPQIDIQSAIYLYLRCTTASLFSEI 403
           +Y +++  +EKNL LD  G+++L+  HY + G  L   I    AIY+YLR  T  +++  
Sbjct: 386 SYGLQRSINEKNLSLDPAGLLVLATQHYLETGQILDSTIRADCAIYMYLRFVTPEMYNPA 445

Query: 404 YENKFLESSVRYWLWVSTTETSTEKIKCALQELPGHITTAFLQMLLMKTCNESNNDTKLT 463
            +N +      +WLWV+ T++S +  K ALQ +P +++  FLQ+LL+K+ NE+    ++ 
Sbjct: 446 MKNTYACDCCNFWLWVAVTKSSCKDSKEALQNIPSYLSLTFLQILLLKSFNETLEHARMV 505

Query: 464 EITLLRRLLYLMPESTSFTFIFETLLHCPYITAKIAVLDILRDMMIRS----PEAANRDE 519
             TLL RLL LMPE T+F F  +TLL CP+I  K  +L IL+D+M+ S       A    
Sbjct: 506 SFTLLTRLLCLMPEETTFEFAKDTLLSCPFIDLKCCMLGILKDLMLNSKIPVSNLATELS 565

Query: 520 TVGLIEQQNPGNTANSVPIMPTLPPRPYITINEDRMASIHSIALICFSAAKQKKRTQGDL 579
            + L E +   +        P LP RP+I INEDRMA+IHS+AL+ F    +    +G+L
Sbjct: 566 ELKLSEDEKSHSK-------PPLPSRPFIMINEDRMATIHSLALLSFEDTIENA-DKGNL 617

Query: 580 LLVLTYMKFFVSLRNKWDLGLLTLIN---KEISESFQGEGEPELAFINISNNTL 630
            L LTY+ FFV LR KWD  LL  +     +I  S   +   EL FI I+ + L
Sbjct: 618 RLSLTYINFFVGLRLKWDKHLLAEVEGAASKIVNSVTKDNSTELGFIEIALDNL 671

>YBR216C (YBP1) [397] chr2 complement(655533..657557) Protein with
           moderate similarity to S. cerevisiae Ygl060p, which is
           involved in stress resistance [2025 bp, 674 aa]
          Length = 674

 Score =  367 bits (941), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 215/623 (34%), Positives = 333/623 (53%), Gaps = 15/623 (2%)

Query: 1   MYNEQVNSGKSIKEKERYLDALLKILKDNPVTLKEIGWDLPKGLLQFFSRKNINVNIHLV 60
           +Y EQVN   S +EK R+++ L  +L+DNP T  EIGWDLPKGLL+F S+ N++VN  L 
Sbjct: 31  IYGEQVNQEGSYEEKTRFIETLNTLLEDNPSTTGEIGWDLPKGLLKFLSKDNVDVNGRLG 90

Query: 61  FSPLVSSVMECFNELAINGNPKECLLTACELVSTL-HIVLTETGXXXXXXXXXXXXXXXX 119
            + +V  VM+CF  ++I G PK+CL+T  EL+S+L     +++                 
Sbjct: 91  TNMIVQGVMKCFYAISIQGEPKKCLITGLELLSSLCSKDFSKSDQQNKEDFVDKKANTLP 150

Query: 120 ASNITDELSVITPEIGHYMAKNTVEFIPNLKIYVLFEFMSLLLKRVDTLYPSKFLAMVTS 179
              + +  S       +  +K++ EF   LK Y+LFEF+   LKR+ TL+PSK+L    S
Sbjct: 151 PEGVIENSSNRKDFPSYGESKSSNEFFLKLKSYILFEFIGASLKRISTLFPSKYLGAAVS 210

Query: 180 AIIKYVTTNVQAMDDPHFILRIVYNFCTNYSPAQP--SASLTDGISTNDLEKIHDDESAL 237
            I K+V ++    +D  F+LR VY FC NY P  P     L +  +    +K+ ++ES L
Sbjct: 211 TIEKFVYSHADTFEDALFLLRRVYTFCRNYIPPDPPKDIQLNEDFTREMFDKVVEEESEL 270

Query: 238 QKKLLANLSVFVISNCLKNHPGNIDKIYFKTLMHKKTDENEIDASVLQICHQYYEYVTSL 297
           Q +LL  L  F IS  +K    N D  Y+  L  +K + +      L++  +YY+   SL
Sbjct: 271 QVRLLRRLCTFGISTPIKTVTTNADVKYYCALNQQKFELSAYYTEYLELFCRYYQMAFSL 330

Query: 298 DVHMKELLEKCLVESRSIYNSLLMNPAASTPEFKEEINQLVYEVSYAYQIKKLADEKNLE 357
           DV ++   +  + E R IY S+    +A   E K  + ++VY+++Y ++++K A EKN+ 
Sbjct: 331 DVDIEGEFQNVIKECRIIYKSVPQEISAVNDEAKLVLERMVYKLAYTFEVQKAAKEKNVG 390

Query: 358 LDQYGVVILSAIHYSKNGTHLLPQIDIQSAIYLYLRCTTASLFSEIYENKFLESSVRYWL 417
           LD  GV++ S IHY +   HL+ +++I  AIYLYLR TT SL+S++Y N  +ES  RYWL
Sbjct: 391 LDYNGVILFSGIHYLETNQHLVKEMNITDAIYLYLRFTTPSLYSKVYYNVAVESVSRYWL 450

Query: 418 WVSTTETSTEKIKCALQELPGHITTAFLQMLLMKTCNESNNDTKLTEITLLRRLLYLMPE 477
           W + T    E +K  L+ L   +T   L +LL K C + N   ++   TLL RLL L+PE
Sbjct: 451 WYAITTEPLEDVKKELKNLSVFVTKTLLHVLLQKNCIQVNQQLRMITFTLLTRLLCLIPE 510

Query: 478 STSFTFIFETLLHCPYITAKIAVLDILRDMMIRSPEAANRDETVGLIEQQ------NPGN 531
             +F FI + L   P   AK +VL + +D+  R     + D    LI ++      N  N
Sbjct: 511 KVAFEFILDVLKTSPLPLAKTSVLCVFKDLSRRRISTKDNDSETDLIVEKLSKLKVNDSN 570

Query: 532 TANSVPIMPTLPPRPYITINEDRMASIHSIALICFSAAKQKKRTQGDLLLVLTYMKFFVS 591
            A    I      R YI ++  +M ++H   L     +      + D+LL+LTY+  F+ 
Sbjct: 571 KAQQSNI------RHYIQLDSSKMKAVHDCCLQTIQDSFTADAKKSDILLLLTYLNIFIV 624

Query: 592 LRNKWDLGLLTLINKEISESFQG 614
           L+  WD  LL ++  +I  + + 
Sbjct: 625 LKKTWDEDLLKIVCSKIDSNLKS 647

>KLLA0C05698g complement(508204..510312) weakly similar to sp|P38315
           Saccharomyces cerevisiae YBR216c, start by similarity
          Length = 702

 Score =  303 bits (775), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 201/641 (31%), Positives = 324/641 (50%), Gaps = 60/641 (9%)

Query: 1   MYNEQVNSGKSIKEKERYLDALLKILKDNPVTLKEIGWDLPKGLLQFFSRKNINVNIHLV 60
           +Y+E+VN   S+++K  YL  +L +L+ N   + EIGWDLPK L++F    N N      
Sbjct: 35  LYSEEVNFKGSLEQKYEYLSEVLSLLQQNKDVVYEIGWDLPKILIKFIHWGNNNHLGADR 94

Query: 61  FSPLVSSVMECFNELAINGNPKECLLTACELVSTLHI--------------VLTETGXXX 106
               ++ +M+CFNE+A+ GNPKEC    CEL+S+L I              V+       
Sbjct: 95  SKKFLTVIMKCFNEVALFGNPKECFFAGCELMSSLRINDESLVRFIVEEEPVMDPENEDS 154

Query: 107 XXXXXXXXXXXXXASNITDELSVI----TPEIGH-----------YMAKNTVEFIPNLKI 151
                         +   +E + +    TP+  +           +  +   E I  L+ 
Sbjct: 155 GDETYTEDEGSSDKTEEEEEKNAVKDSPTPKSANESIPDLKEGYAFYGRLPQEVITELRF 214

Query: 152 YVLFEFMSLLLKRVDTLYPSKFLAMVTSAIIKYVTTNVQAMDDPHFILRIVYNFCTNYSP 211
           Y + E M   LKR+ TL+PSKFL+    A  ++   N + +DD  FILR +Y+F   Y P
Sbjct: 215 YSIIELMGSTLKRIVTLHPSKFLSEAVEAFSRFNLQNNEDVDDCLFILRRLYSFIRGYIP 274

Query: 212 AQPSASLTDGISTNDLEKIHDDESALQKKLLANLSVFVISNCLK--------NHPGNIDK 263
             P       +S  +LE+I   E  LQ+KLL N+    +   LK        N+  ++  
Sbjct: 275 PSPPPDADKQVSAEELEEIKVSEEVLQRKLLCNILTSALHQLLKARTCISLLNYHSHLQG 334

Query: 264 IYFKTLMHKKTDENEIDASVLQICHQYYEYVTSLDVHMK-ELLEKCLVESRSIYNSLLMN 322
           I   TL    +  +E    +  I  +YY+  TS D+ +  E    C+ ES  IY SL  +
Sbjct: 335 I--PTL----STSSEYLGQLTDILSRYYQLATSFDIDVSAEFKRLCVDESVRIYRSLPKD 388

Query: 323 PAASTPEFKEEINQLVYEVSYAYQIKKLADEKNLELDQYGVVILSAIHYSKNGTHLLP-- 380
               + E  +EI   VY+++Y Y+++K+A+ K + LD  G++IL +     N   L P  
Sbjct: 389 SEIKSDEELKEITNFVYQLAYTYEVEKIANVKEILLDPAGILILRSF---SNEDFLPPSD 445

Query: 381 -QIDIQSAIYLYLRCTTASLFSEIYENKFLESSVRYWLWVSTTETSTEKIKCALQELPGH 439
            +I +Q AIY+YLR  T S+FS ++EN+      R W+  + T  ST  +  +L++LP +
Sbjct: 446 AKITLQEAIYMYLRFVTPSMFSALFENRSSHDLARTWILFALTNNSTHDLMDSLKDLPSY 505

Query: 440 ITTAFLQMLLMKTCNESNNDTKLTEITLLRRLLYLMPESTSFTFIFETLLHCPYITAKIA 499
           I T +LQ  L++ C + N++ + T+ ++L R+L L+PE  +F FI +TLL CPY  AK  
Sbjct: 506 IITVYLQTELIRACLQINDNLRRTQFSILTRILCLLPEDFAFNFIRDTLLSCPYEQAKCC 565

Query: 500 VLDILRDMM---IRSPEAANRDETVGLIEQQNPGNTANSVPIMPTLPPRPYITINEDRMA 556
            L IL+DMM    + P+ ++ D+    +E+    N+       P LP R Y+ +N+DR+A
Sbjct: 566 ALAILKDMMQHERKVPQKSDEDDLAKDMEKLKIKNSP------PPLPSRAYMLLNDDRIA 619

Query: 557 SIHSIALICFSAAKQKKRTQGDLLLVLTYMKFFVSLRNKWD 597
           ++HSI L+   +      ++  +  +LTY+ F  +   KWD
Sbjct: 620 TLHSITLLAIDSCAADPESKK-VKTLLTYLNFLNAFLTKWD 659

>CAGL0K06743g complement(656238..658205) similar to sp|P38315
           Saccharomyces cerevisiae YBR216c, hypothetical start
          Length = 655

 Score =  298 bits (763), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 203/626 (32%), Positives = 323/626 (51%), Gaps = 42/626 (6%)

Query: 3   NEQVNSGKSIKEKERYLDALLKILKDNPVTLKEIGWDLPKGLLQFFSRKNINVNIHLVFS 62
           +E+V+ G  +KEKE++L+ LL +L+ +   +  +GWDLP+ LL+F + KNI  +  L   
Sbjct: 34  SEEVDEGFEVKEKEQFLELLLNLLEADTELVSAVGWDLPRTLLRFCNAKNIKNSDRLRKC 93

Query: 63  PLVSSVMECFNELAINGNPKECLLTACELVSTLHI--------VLTETGXXXXXXXXXXX 114
            +V+  M  FN LA++  P+ECL+T  EL+S L+          L+E G           
Sbjct: 94  KVVTICMAIFNLLALHAKPQECLVTTLELLSELNFKNIVEECHQLSEDG----------- 142

Query: 115 XXXXXASNITDELSVITPEIGHYMA-KNTVEFIPNLKIYVLFEFMSLLLKRVDTLYPSKF 173
                + N T E       +  YM  ++  E I  +K Y LFE    L++RV TL+PSK+
Sbjct: 143 -----SDNNTAEED--NDAVEDYMKDRDQPEIIFGVKSYALFELAGSLIRRVATLHPSKY 195

Query: 174 LAMVTSAIIKYVTTNVQAMDDPHFILRIVYNFCTNYSPAQPSASLTDGISTN--DLEKIH 231
           L    +AI KYVT N + ++D  FILR V+ FC  Y P +P   L   +  N  + ++I 
Sbjct: 196 LEEAVTAIRKYVTNNTEVVEDVKFILRRVFAFCRGYIPPEPPRQLIVDLKMNHEEYDEIM 255

Query: 232 DDESALQKKLLANLSVFVISNCLKNHPGNIDKIYFKTLMHKKTDENEIDASVLQICHQYY 291
           + E  LQ +LL NL  F ++ C+K      + +YF  L++K     E   SV  I  +YY
Sbjct: 256 NSEIELQVRLLRNLCTFSVAYCVKFLNDKTEVVYFHKLINKDLQLPEFYRSVHDIISRYY 315

Query: 292 EYVTSLDVHMKELLEKCLVESRSIYNSLLMNPAASTPEFKEEINQLVYEVSYAYQIKKLA 351
           +   S D+ + +     L E+R IY  ++     +    K   + ++ +  Y Y+++K A
Sbjct: 316 QIAFSFDIDLNDEFNDILRETRGIYEDVIKRINETNNTDKNAKSDILLKAGYYYEVQKTA 375

Query: 352 DEKNLELDQYGVVILSAIHYSKNGTHLLPQIDIQSAIYLYLRCTTASLFSEIYENKFLES 411
            EK +  D  G+++LS  +Y +NG HL+  IDI  A+YLYLR  + SLFS    N  +E 
Sbjct: 376 REKEINPDTKGIILLSGFNYIENGDHLI-DIDIADALYLYLRFASESLFSPTCHNVTIEG 434

Query: 412 SVRYWLWVSTTETSTEKIKCALQELPGHITTAFLQMLLMKTCNESNNDTKLTEITLLRRL 471
             RYW+W + T T    +K  L EL   +  + L +LL+K C++ N + ++   TL+ R+
Sbjct: 435 VARYWIWAALTTTDNNILKEKLAELSPLVLHSVLNLLLVKNCHQVNEEIRMITFTLITRI 494

Query: 472 LYLMPESTSFTFIFETLLHCPYITAKIAVLDILRDMMIRSPE--AANRDETVGLIEQQNP 529
           L L+PE+ S+ F+ + L +C  +  K  VL ILRD++I+     ++N  +T  L E    
Sbjct: 495 LCLLPENCSYEFLMDELDNCAVVFGKSCVLGILRDLVIKVDHSVSSNNTDTEDLSESMAQ 554

Query: 530 GNTANSVPIMPTLPPRPYITINEDRMASIHSIALICFSAAKQKKRTQGDLLLVLTYMKFF 589
               N          + +IT++  R   I  +A+      K K   +  +LLVL Y+KFF
Sbjct: 555 LKINNE-----KRAKKTFITLDPKRAGEIEDLAIKTLKETK-KSMKKDYILLVLNYIKFF 608

Query: 590 VSLRNKWDLGLL----TLINKEISES 611
            +  +KW+   L    TL+    S+S
Sbjct: 609 STFAHKWNKSKLNEFTTLVATNFSDS 634

>AAR159C [347] [Homologous to ScYBR216C - SH; ScYGL060W - SH]
           (630860..632701) [1842 bp, 613 aa]
          Length = 613

 Score =  255 bits (651), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 163/632 (25%), Positives = 312/632 (49%), Gaps = 67/632 (10%)

Query: 4   EQVNSGKSIKEKERYLDALLKILKDNPVTLKEIGWDLPKGLLQFFSRKNINVNIHLVFSP 63
           EQ  +  +      +L+AL + L+++P  + ++GWD+PK L++     N N+N  L    
Sbjct: 35  EQALASGNAGRVASFLEALWEQLREHPALVGDLGWDIPKVLVRCIRADNFNLNEGLGDDM 94

Query: 64  LVSSVMECFNELAINGNPKECLLTACELVSTLHIVLTETGXXXXXXXXXXXXXXXXASNI 123
           +   ++ CF E+   GN +EC LT C+ ++ L +   E                   +++
Sbjct: 95  VWRLLVGCFREVGREGNARECFLTGCQQLAELSVAAEEE----------------EDADL 138

Query: 124 TDELSVITPEIGHYMAKNTVEFIPNLKIYVLFEFMSLLLKRVDTLYPSKFLAMVTSAIIK 183
            +E+                     LK ++L EF++  L R  T YPS+FL  +   ++K
Sbjct: 139 REEMFA-------------------LKFHMLMEFVTTTLGRTTTAYPSRFLGEIIGVLVK 179

Query: 184 YVTTNVQAMDDPHFILRIVYNFCTNYSPAQPSASLTDGISTNDLEKIHDDESALQKKLLA 243
            V  N   + D H +LR +Y FC +Y         T  +S+++ E++   E  LQ+ L  
Sbjct: 180 LVERNADELCDVHLLLRRLYTFCRDY---------TAPVSSSEDEELRAQEDYLQRTLFR 230

Query: 244 NLSVFVISNCLKNHPGNIDKIYFKTLMHKKTDENEIDASVLQICHQYYEYVTSLDVHMKE 303
           +   + ++  L+         YF      +   ++    + +   +Y++   S D+ ++ 
Sbjct: 231 SFLAYALAQLLRRQSVRWAPEYFAKSHGLEFKLHDDHVELRETLGRYFQLAHSFDIDIEG 290

Query: 304 LLEK-CLVESRSIYNSLLMNPAASTPEFKEEINQLVYEVSYAYQIKKLADEKNLELDQYG 362
             +K C++ESR +Y  +      S    K +  +++Y+++Y Y++KK+A+ +++ +D  G
Sbjct: 291 AFQKQCILESRDVYACV------SADADKADGAEVIYQLAYTYELKKIAELQSMPIDARG 344

Query: 363 VVILSAIHYSKNGTHLLPQIDIQSAIYLYLRCTTASLFSEIYENKFLESSVRYWLWVSTT 422
           + +L+ +H+ + G  +   + +  AIY++LR  T  ++S+ + N  +  +  Y++ ++  
Sbjct: 345 IFVLAVLHHFETGKPICLSLRLDDAIYMFLRFNTPEIYSKSFGNIAVTDASLYFVLLALE 404

Query: 423 ETSTEKIKCALQELPGHITTAFLQMLLMKTCNESNNDTKLTEITLLRRLLYLMPESTSFT 482
             S E+    ++E P  +   F+Q+LL+  C   + +      ++L R+L+L  E+T+F 
Sbjct: 405 GNSHEENHKLVREFPQTVFAVFIQVLLLNMCRLPSREIGRMTHSILARVLFLASETTAFD 464

Query: 483 FIFETLLHCPYITAKIAVLDILRDMMIRSPEAANRDETVGLIEQQNPGNTANSVPIMPTL 542
           F+ +TLL CPY TAK  +L+I + MM+         +   +  +  P +T       P L
Sbjct: 465 FVIDTLLQCPYETAKQIILEIAKIMMV--------SDQYTICTRDVPSHTRTDTK-APPL 515

Query: 543 PPRPYITINEDRMASIHSIALICFSAAKQKKRTQG--DLLLVLTYMKFFVSLRNKWDLGL 600
           PPRP+I +N+DRMA+ H++A++   +AK    T+    L  +L+Y+     LR KWD  L
Sbjct: 516 PPRPFIKLNDDRMAAFHTLAMM---SAKFCTETEDPKQLTTLLSYLNLITVLRKKWDQVL 572

Query: 601 LTLINKEISESFQGEGE--PELAFINISNNTL 630
           L  +   +S   +   E  PE+ FI I+N+ L
Sbjct: 573 LRELTVAVSNCIEPRKEDIPEIGFIKIANDGL 604

>CAGL0F06985g 684832..686724 similar to sp|P53169 Saccharomyces
           cerevisiae YGL060w, hypothetical start
          Length = 630

 Score =  247 bits (631), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 189/651 (29%), Positives = 314/651 (48%), Gaps = 85/651 (13%)

Query: 4   EQVNSGKSIKEKERYLDALLKILKDNPVTLK-EIGWDLPKGLLQFFSRKNINVNIHLVFS 62
           E +N     +++  + D L  +L      L  E+ W LPK L++  S KN+         
Sbjct: 32  ECINGLSGSEDQALFFDELYGLLDQFGTPLNDELLWGLPKALIKNISSKNVED------K 85

Query: 63  PLVSSVMECFNELAINGNPKECLLTACELVSTLHIVLTETGXXXXXXXXXXXXXXXXASN 122
            LV ++  C   +A  G      L   EL+                            +N
Sbjct: 86  ALVKAICNCMKLVARVGTDDYNFLFGTELLRECR---------------------AEDTN 124

Query: 123 ITDELSVITPEIGHYMAKNTVEFIPNLKIYV---LFEFMSLLLKRVDTLYPSKFLAMVTS 179
           I D+              N    +   K+ V   L EF+   LK +    PSKFL+++ S
Sbjct: 125 IYDD-------------SNDTYILEAFKVRVELLLEEFILPALKTLGQTNPSKFLSVIVS 171

Query: 180 AIIKYVTTNVQAMDD---PHFILRIVYNFCTNYSPAQPSASLTDGISTNDLEKIHDDESA 236
           A+++ ++ N+Q  ++    + +L ++  F  +Y    PSA +T    T D    + DE  
Sbjct: 172 ALVELISNNMQCGEEIEMSNILLDVIIRFYDSYE--LPSAKVT----TPDGAMANKDEED 225

Query: 237 LQKKLLANLSVFVISNCLKNHPGNIDKIYFKTLMHKKTDENEIDA---------SVLQIC 287
           + +K+L +   F I  C+KN     + I    +      + EID          ++++I 
Sbjct: 226 IVQKILESFWSFSIGRCIKNQSCFPEYILLSQIPRMDFVKQEIDVPDDFIIKSRNIIRIT 285

Query: 288 HQYYEYVTSLDVHMKELLEKCLVESRSIYNSLLMNPAASTPEFKEEINQLVYEVSYAYQI 347
           ++       L + +++++E C  E+R IY  L  NP   T +   ++ + +Y++SY   +
Sbjct: 286 NE------KLQLDLQKMMEACFEETRKIYELLPPNP---TVQDGNDLTEEIYQMSYVNGV 336

Query: 348 KKLADEKN-LELDQYGVVILSAIHYSKNGTHLLPQIDIQSAIYLYLRCTTASLFSEIYEN 406
             L ++K  L LD  GV+ LS ++Y  N   L  +I++  A+ LYLR ++ASL+S I++N
Sbjct: 337 TTLEEQKGKLSLDTAGVLTLSGLYYIANDNKLNVKINLYDAVLLYLRFSSASLYSPIFDN 396

Query: 407 KFLESSVRYWLWVSTTETSTEK--IKCALQELPGHITTAFLQMLLMKTCNESNNDTKLTE 464
            F+E   R+WLW  T   + +K  ++  L  +P ++   F Q+LL+KTCNE++   K   
Sbjct: 397 TFVEGICRFWLWSYTLGENRDKNTLQSELMSVPDYVLKVFFQLLLLKTCNEASTLQKRIN 456

Query: 465 ITLLRRLLYLMPESTSFTFIFETLLHCPYITAKIAVLDILRDMMIRSPEAANRDETVGLI 524
             LL +LL       +F FI +T+L CPY+ AKIA+  IL+D+M      A + + + L 
Sbjct: 457 FNLLTQLLAFSNAEVAFDFIVDTILSCPYLDAKIAIAGILKDLM------AKKSDDIHLK 510

Query: 525 EQQNPGNTANSVPIMPTLPPRPYITINEDRMASIHSIALICFSAAKQ--KKRTQGDLLLV 582
           E +   N  N+    P LP RP IT++E R+ASIHS+  +C     +    +TQG+L+L+
Sbjct: 511 EARQVKNEPNNHNCPPKLPDRPPITVDEHRIASIHSLVKLCIEDCLKPLNNKTQGNLILL 570

Query: 583 LTYMKFFVSLRNKWDLGLLTLINKEISESFQGEGE---PELAFINISNNTL 630
             Y+   ++L  +WD  LL  IN EI + F    E   PEL FI ++N+TL
Sbjct: 571 QYYINILITLYKQWDGFLLKEINDEIKKLFSQRQEQEFPELEFIRLANDTL 621

>YGL192W (IME4) [1801] chr7 (142250..144052) Positive transcription
           factor for IME1 and IME2, mediates control of meiosis by
           carrying signals regarding mating type (a/alpha) and
           nutritional status, might act as a methyltransferase
           that modifies mRNA [1803 bp, 600 aa]
          Length = 600

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 7/66 (10%)

Query: 250 ISNCLKNHPGNID----KIYFKTLMHKKTDENEIDASVLQICHQYYEYVTSLDVHMKELL 305
           IS C +NHPG I+    KI+F   +  +TD +  D S L  CH+     T   +H  + +
Sbjct: 224 ISACQENHPGLIECIQSKIHFIPNIKPQTDISLGDCSYLDTCHKLN---TCRYIHYLQYI 280

Query: 306 EKCLVE 311
             CL E
Sbjct: 281 PSCLQE 286

>Kwal_23.5962
          Length = 552

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 52/118 (44%), Gaps = 16/118 (13%)

Query: 262 DKIYFKTLMHKKTDENEIDASVLQICHQYYEYVTSLDVHMKELLEKCLVESRSIYNSLLM 321
           DK  FK     KT + ++ A + +I  QY + V++         E  L ES    N  L 
Sbjct: 24  DKSGFKNRNAYKTKDKKLKAGLKRIDEQYKDAVSAAAA-----TEYLLPES----NGFLE 74

Query: 322 NPAASTPEFKEEINQLVYEVSYAYQIKKLADEKNLELDQYGVVILSAIHYSKNGTHLL 379
                   FK   +++   V      K L    +L+L ++G     +++YS+NGTHLL
Sbjct: 75  AEDEMEKTFKVGQDEIKSAVDVTTANKAL----DLKLKEFGPY---SVNYSRNGTHLL 125

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,100,903
Number of extensions: 857509
Number of successful extensions: 2689
Number of sequences better than 10.0: 25
Number of HSP's gapped: 2724
Number of HSP's successfully gapped: 29
Length of query: 630
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 522
Effective length of database: 12,857,365
Effective search space: 6711544530
Effective search space used: 6711544530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)