Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL053W (PRM8)23723411741e-165
YAR031W (PRM9)2982358811e-120
YAR033W (MST28)2342365891e-76
YGL051W (MST27)2342345552e-71
YAR028W2342345361e-68
YAR027W (UIP3)2352474901e-61
YCR007C2392304562e-56
YAR023C1791512852e-31
Scas_661.293002282302e-22
YAR029W74621821e-17
YML132W (COS3)3791671398e-10
YBR302C (COS2)3791671398e-10
YHL044W2351361333e-09
YDL248W (COS7)3831671344e-09
Kwal_56.22593200921289e-09
Kwal_49.19404200921289e-09
Scas_611.63071391291e-08
YJR161C (COS5)3831671292e-08
YNL336W (COS1)3811671282e-08
YGR295C (COS6)3811861283e-08
YFL062W (COS4)3791661264e-08
Sklu_2378.52251151165e-07
YGL263W (COS12)3801411175e-07
YHL048W (COS8)3811671167e-07
Kwal_27.100963401541114e-06
YKL219W (COS9)4071731105e-06
Sklu_2378.42361941061e-05
Scas_460.2235511051e-05
YHL043W (ECM34)170152995e-05
YNR075W (COS10)374971016e-05
Kwal_26.904711978913e-04
Scas_600.5d252115910.001
Sklu_2402.320490880.002
Kwal_26.724336692850.007
Kwal_26.767336792800.030
YHL042W15053740.081
KLLA0C19063g20951750.10
YBR200W (BEM1)55163740.19
KLLA0A11957g20847710.27
AFL118W83221681.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL053W
         (234 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL053W (PRM8) [1926] chr7 (402590..403303) Member of the COS fa...   456   e-165
YAR031W (PRM9) [80] chr1 (186832..187728) Member of the duplicat...   343   e-120
YAR033W (MST28) [81] chr1 (188103..188807) Member of the duplica...   231   1e-76
YGL051W (MST27) [1927] chr7 (403688..404392) Member of the dupli...   218   2e-71
YAR028W (YAR028W) [78] chr1 (184888..185592) Protein with strong...   211   1e-68
YAR027W (UIP3) [77] chr1 (183766..184473) Protein with strong si...   193   1e-61
YCR007C (YCR007C) [541] chr3 complement(126008..126727) Protein ...   180   2e-56
YAR023C (YAR023C) [76] chr1 complement(179281..179820) Protein w...   114   2e-31
Scas_661.29                                                            93   2e-22
YAR029W (YAR029W) [79] chr1 (186317..186541) Protein of unknown ...    75   1e-17
YML132W (COS3) [3840] chr13 (7244..8383) Member of the COS famil...    58   8e-10
YBR302C (COS2) [478] chr2 complement(810296..811435) Member of t...    58   8e-10
YHL044W (YHL044W) [2244] chr8 (13563..14270) Member of the dupli...    56   3e-09
YDL248W (COS7) [629] chr4 (1802..2953) Member of the COS family ...    56   4e-09
Kwal_56.22593                                                          54   9e-09
Kwal_49.19404                                                          54   9e-09
Scas_611.6                                                             54   1e-08
YJR161C (COS5) [3051] chr10 complement(742763..743914) Member of...    54   2e-08
YNL336W (COS1) [4279] chr14 (8330..9475) Member of the COS famil...    54   2e-08
YGR295C (COS6) [2237] chr7 complement(1081589..1082734) Member o...    54   3e-08
YFL062W (COS4) [1622] chr6 (6426..7565) Member of the duplicatio...    53   4e-08
Sklu_2378.5 YCR007C, Contig c2378 11079-11756                          49   5e-07
YGL263W (COS12) [1737] chr7 (2790..3932) Member of the COS famil...    50   5e-07
YHL048W (COS8) [2241] chr8 (6400..7545) Member of the COS family...    49   7e-07
Kwal_27.10096                                                          47   4e-06
YKL219W (COS9) [3056] chr11 (14485..15708) Member of the COS fam...    47   5e-06
Sklu_2378.4 , Contig c2378 9846-10556                                  45   1e-05
Scas_460.2                                                             45   1e-05
YHL043W (ECM34) [2245] chr8 (14899..15411) Protein possibly invo...    43   5e-05
YNR075W (COS10) [4658] chr14 (779913..781037) Member of the COS ...    44   6e-05
Kwal_26.9047                                                           40   3e-04
Scas_600.5d                                                            40   0.001
Sklu_2402.3 , Contig c2402 12663-13277                                 39   0.002
Kwal_26.7243                                                           37   0.007
Kwal_26.7673                                                           35   0.030
YHL042W (YHL042W) [2246] chr8 (15665..16117) Protein with simila...    33   0.081
KLLA0C19063g complement(1692492..1693121) no similarity, hypothe...    33   0.10 
YBR200W (BEM1) [383] chr2 (620829..622484) Protein required for ...    33   0.19 
KLLA0A11957g 1041208..1041834 no similarity, hypothetical start        32   0.27 
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    31   1.0  

>YGL053W (PRM8) [1926] chr7 (402590..403303) Member of the COS
           family of subtelomerically-encoded proteins [714 bp, 237
           aa]
          Length = 237

 Score =  456 bits (1174), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 219/234 (93%), Positives = 219/234 (93%)

Query: 1   MQTPSENTNAKSDSLDEPGAYLIEENVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXX 60
           MQTPSENTNAKSDSLDEPGAYLIEENVALPKDIFHSYLSYWIYEAAHCTPVM        
Sbjct: 1   MQTPSENTNAKSDSLDEPGAYLIEENVALPKDIFHSYLSYWIYEAAHCTPVMLLSLVIGV 60

Query: 61  XXXXXXXFHDNENCVGVSVGFLLIFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPT 120
                  FHDNENCVGVSVGFLLIFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPT
Sbjct: 61  LISIIILFHDNENCVGVSVGFLLIFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPT 120

Query: 121 VKGKEWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASNVK 180
           VKGKEWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASNVK
Sbjct: 121 VKGKEWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASNVK 180

Query: 181 DAQSNDETAGTPNEAAESSSFSAGPNFIKLLTKAAEIEQQFQKEYWRQEYPGVD 234
           DAQSNDETAGTPNEAAESSSFSAGPNFIKLLTKAAEIEQQFQKEYWRQEYPGVD
Sbjct: 181 DAQSNDETAGTPNEAAESSSFSAGPNFIKLLTKAAEIEQQFQKEYWRQEYPGVD 234

>YAR031W (PRM9) [80] chr1 (186832..187728) Member of the duplication
           (DUP) family, has high similarity to uncharacterized S.
           cerevisiae Prm8p [897 bp, 298 aa]
          Length = 298

 Score =  343 bits (881), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 172/235 (73%), Positives = 185/235 (78%), Gaps = 3/235 (1%)

Query: 1   MQTPSENTNAKSDSLDEPGAYLIEENVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXX 60
           MQT SE+T+AKSD LDEP AYLIE+NVALPKDIF SYLSYWIYE       +        
Sbjct: 63  MQTSSESTDAKSDFLDEPSAYLIEKNVALPKDIFGSYLSYWIYEVTRHKAAVILLVLIVT 122

Query: 61  XXXXXXXFHDNENCVGVSVG-FLLIFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKP 119
                  F++ E CV   +  F   F G  ++V+   F   I D +FK KLLMEIITRKP
Sbjct: 123 SILLLVFFYNTEFCVAFEILLFSFCFPGTCMVVIA--FSEPIGDREFKVKLLMEIITRKP 180

Query: 120 TVKGKEWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASNV 179
            VKGKEWRTITYKMNQYLFD+ LW+TPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASNV
Sbjct: 181 AVKGKEWRTITYKMNQYLFDHGLWDTPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASNV 240

Query: 180 KDAQSNDETAGTPNEAAESSSFSAGPNFIKLLTKAAEIEQQFQKEYWRQEYPGVD 234
           KDAQSNDETAGTPNEAAESSSFSAGPNFIKLLTKAAEIEQQFQKEYWRQEYPGVD
Sbjct: 241 KDAQSNDETAGTPNEAAESSSFSAGPNFIKLLTKAAEIEQQFQKEYWRQEYPGVD 295

>YAR033W (MST28) [81] chr1 (188103..188807) Member of the
           duplication (DUP) family, has very strong similarity to
           uncharacterized S. cerevisiae Ygl051p [705 bp, 234 aa]
          Length = 234

 Score =  231 bits (589), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 157/236 (66%), Gaps = 11/236 (4%)

Query: 1   MQTPSENTNAKSDSLDEPGAYLIEENVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXX 60
           MQTP E+T+ K D+L+EP A+LIE+NVALPKDIF SYLSYWIYE A  TPVM        
Sbjct: 1   MQTPPESTDVKLDTLNEPSAHLIEKNVALPKDIFRSYLSYWIYEIARYTPVMILSLVIGV 60

Query: 61  XXXXXXXFHDNENCVGVSVGFLLIFSGILVIVLILRFG-PQ-ISDEDFKCKLLMEIITRK 118
                  F+DNE CV  S  F   F+ ++ +++IL  G P+ +S  +F+ +LL+++ITRK
Sbjct: 61  LVLLIIFFNDNEACVFNSAIF--AFTSLVGLLIILSDGNPKLVSRRNFRTELLVDVITRK 118

Query: 119 PTVKGKEWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASN 178
           P V+GKEWR ITY MNQYLF++  W+TPYYFY DEDC+RYFL L++G T KKQ  +S   
Sbjct: 119 PAVEGKEWRIITYNMNQYLFNHGQWHTPYYFYSDEDCYRYFLRLVEGVTPKKQTATSI-- 176

Query: 179 VKDAQSNDETAGTPNEAAESSSFSAGPNFIKLLTKAAEIEQQFQKEYWRQEYPGVD 234
                 N      P +A ES+S S+  N+   L KAAEIE+Q Q+ YWR+ +P +D
Sbjct: 177 -----GNSPVTAKPEDAIESASPSSRLNYQNFLLKAAEIERQAQENYWRRRHPNID 227

>YGL051W (MST27) [1927] chr7 (403688..404392) Member of the
           duplication (DUP) family, has very strong similarity to
           uncharacterized S. cerevisiae Yar033p [705 bp, 234 aa]
          Length = 234

 Score =  218 bits (555), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 116/234 (49%), Positives = 152/234 (64%), Gaps = 7/234 (2%)

Query: 1   MQTPSENTNAKSDSLDEPGAYLIEENVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXX 60
           MQTP E+T+ K D+L+EP A+LIE+NVALPKDIF SYLSYWIYE A  TPVM        
Sbjct: 1   MQTPLESTDVKLDTLNEPSAHLIEKNVALPKDIFRSYLSYWIYEIARYTPVMILSLVIGV 60

Query: 61  XXXXXXXFHDNENCVGVSVGFLLIFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPT 120
                  F+DNE CV  S  +  +   +L+I+L       +S  +F+ +LL+++ITRKP 
Sbjct: 61  LVLLIIFFNDNEACVFNSAYYAYLSLVVLLIILGDGNPKLVSRRNFRTELLVDVITRKPA 120

Query: 121 VKGKEWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASNVK 180
           V+GKEWR ITY MNQYLF++  W+TPYYFY DEDC+RYFL L++G T KKQ  +S     
Sbjct: 121 VEGKEWRIITYNMNQYLFNHGQWHTPYYFYSDEDCYRYFLRLVEGVTPKKQTATSI---- 176

Query: 181 DAQSNDETAGTPNEAAESSSFSAGPNFIKLLTKAAEIEQQFQKEYWRQEYPGVD 234
               N      P +A ES+S S+  N+   L KAAEIE+Q Q+ YWR+ +P +D
Sbjct: 177 ---GNSPVTAKPEDAIESASPSSRLNYRNFLLKAAEIERQAQENYWRRRHPNID 227

>YAR028W (YAR028W) [78] chr1 (184888..185592) Protein with strong
           similarity to subtelomerically-encoded proteins such as
           Cos5p, Ybr302p, Cos3p, Cos1p, Cos4p, Cos8p, Cos6p,
           Cos9p, and Ycr007p [705 bp, 234 aa]
          Length = 234

 Score =  211 bits (536), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 106/234 (45%), Positives = 142/234 (60%), Gaps = 2/234 (0%)

Query: 1   MQTPSENTNAKSDSLDEPGAYLIEENVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXX 60
           MQTPSENT+ K D+LDEP A+LIEENVALP+D F S+LSY +YE AHC P+M        
Sbjct: 1   MQTPSENTDVKMDTLDEPSAHLIEENVALPEDTFSSHLSYVLYEIAHCKPIMFMIIIIVS 60

Query: 61  XXXXXXXFHDNENCVGVSVGFLLIFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPT 120
                  FHDN+ C  + V  L++ S  L++V    FG  I++++F  KLL+E+I RKP 
Sbjct: 61  LISLIVLFHDNDGCTVILVMSLIVASMALMVVAAFTFGKAITEQEFMIKLLVEVIARKPA 120

Query: 121 VKGKEWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASNVK 180
             GKEW T+ Y MNQYLF   LW TPYYFY  + CH +F +LIK        +SS+++ +
Sbjct: 121 --GKEWGTVAYNMNQYLFMKRLWYTPYYFYSGKKCHEFFTTLIKEVNSGSHSDSSSNSAE 178

Query: 181 DAQSNDETAGTPNEAAESSSFSAGPNFIKLLTKAAEIEQQFQKEYWRQEYPGVD 234
           D QS      T N      S  + P  +  + KA +IE++ Q EYWR++YP  D
Sbjct: 179 DTQSPVSAGKTSNGLNNFYSIRSDPILMAYVLKATQIEKEAQSEYWRKQYPDAD 232

>YAR027W (UIP3) [77] chr1 (183766..184473) Protein with strong
           similarity to subtelomerically-encoded proteins such as
           Cos5p, Ybr302p, Cos3p, Cos1p, Cos4p, Cos8p, Cos6p,
           Cos9p, and Ycr007p [708 bp, 235 aa]
          Length = 235

 Score =  193 bits (490), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 105/247 (42%), Positives = 136/247 (55%), Gaps = 27/247 (10%)

Query: 1   MQTPSENTNAKSDSLDEPGAYLIEENVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXX 60
           MQTPSENT+ K D+LDEP A+LIEENVALP+D F+SY SY + E A C P+M        
Sbjct: 1   MQTPSENTDVKLDTLDEPSAHLIEENVALPEDTFNSYWSYILNEIARCKPLMIMFLIPVC 60

Query: 61  XXXXXXXFHDNENCVGVSVGFLLIFSGILVIVL-------------ILRFGPQISDEDFK 107
                  FHD                GILV ++             I  F  +  ++ F 
Sbjct: 61  LVLLITFFHD--------------IKGILVFLVISLILSIIILLIGITAFVSETLNKGFI 106

Query: 108 CKLLMEIITRKPTVKGKEWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSLIKGRT 167
            KLL+E+ITRKP V GKEWR I Y MNQYLFD+ +W+TPYYF+ +  CH++F SLIK   
Sbjct: 107 IKLLVEVITRKPAVGGKEWRIIAYNMNQYLFDHGIWHTPYYFFCEHRCHKFFKSLIKQTR 166

Query: 168 FKKQKESSASNVKDAQSNDETAGTPNEAAESSSFSAGPNFIKLLTKAAEIEQQFQKEYWR 227
                 S  +  ++ QSN       NE  +   FS+ P     L KAAEI ++ + EYWR
Sbjct: 167 SNAHLSSPTNGAENTQSNTPAKEVSNEMVKPYIFSSDPVLEAYLIKAAEIHKEAEFEYWR 226

Query: 228 QEYPGVD 234
           ++YP VD
Sbjct: 227 KQYPEVD 233

>YCR007C (YCR007C) [541] chr3 complement(126008..126727) Protein
           with strong similarity to subtelomerically-encoded
           proteins such as Cos5p, Ybr302p, Cos3p, Cos1p, Cos4p,
           Cos8p, Cos6p, Cos9p [720 bp, 239 aa]
          Length = 239

 Score =  180 bits (456), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 92/230 (40%), Positives = 127/230 (55%), Gaps = 1/230 (0%)

Query: 5   SENTNAKSDSLDEPGAYLIEENVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXXXXXX 64
           S N + K D+L E       EN+ LP+D F SY++Y +YE AH  P++            
Sbjct: 9   SNNDDVKLDTLGEQNVLSSAENITLPEDTFKSYMTYLLYEMAHYKPMIFSFLALSVSILI 68

Query: 65  XXXFHDNENCVGVSVGFLLIFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPTVKGK 124
              FH+ + C  V  GF +  + IL +  ++ F   ISDE F+ KLL+E+IT +P VKGK
Sbjct: 69  VVIFHNVKAC-DVVFGFSIFVTSILFLSTLIPFNVYISDEGFRIKLLLEVITHRPAVKGK 127

Query: 125 EWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASNVKDAQS 184
           EWR IT  MNQYL DN LW+T YYFY  E C+++F  L+K +       SS  +    Q 
Sbjct: 128 EWRAITDNMNQYLLDNGLWSTRYYFYSSERCYKFFRFLVKEKPPGVNVNSSVKDATSTQI 187

Query: 185 NDETAGTPNEAAESSSFSAGPNFIKLLTKAAEIEQQFQKEYWRQEYPGVD 234
           +       NE  +  SFS+ P F     KA E+E+Q Q+EYWR++YP  D
Sbjct: 188 DAPANEASNEVIKCFSFSSDPIFEAYFVKAVEVEKQAQQEYWRKQYPDAD 237

>YAR023C (YAR023C) [76] chr1 complement(179281..179820) Protein with
           strong similarity to subtelomerically-encoded proteins
           such as Cos5p, Ybr302p, Cos3p, Cos1p, Cos4p, Cos8p,
           Cos6p, Cos9p [540 bp, 179 aa]
          Length = 179

 Score =  114 bits (285), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 82/151 (54%), Gaps = 8/151 (5%)

Query: 83  LIFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQYLFDNDL 142
           +   G +V++ I      IS+E F+ KLL+E+IT +P++ GKEW+TITY MNQYLF   L
Sbjct: 32  ICLGGSMVVLQIWSISRPISNETFRTKLLLEVITHRPSIAGKEWKTITYNMNQYLFKAGL 91

Query: 143 WNTPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASNVKDAQSNDETAGTPNEAAESSSFS 202
           W TPY+F+ +  C+ +F  LIKG+    Q         D  +       P   A + +  
Sbjct: 92  WKTPYHFFCEHQCYEFFKDLIKGKYPDVQ--------WDTANTQPFISVPENQAATQNSD 143

Query: 203 AGPNFIKLLTKAAEIEQQFQKEYWRQEYPGV 233
             P     L KAAEI+    +EYW+ +YP V
Sbjct: 144 VEPTVKWCLFKAAEIQAHAVREYWQSQYPDV 174

>Scas_661.29
          Length = 300

 Score = 93.2 bits (230), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 104/228 (45%), Gaps = 18/228 (7%)

Query: 23  IEENVALPKDIFHSYLSYWIYEAAHCTPV--MXXXXXXXXXXXXXXXFHDNENCVGVSVG 80
           +EE+V LP+DIFHS ++Y IY+  +   V  +                  NE+ + + + 
Sbjct: 69  MEEHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNEDAIAIFLL 128

Query: 81  FLLIF---SGILVIVLILRFGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQYL 137
             ++F   S   VIV I+     + D   K KL  E++  KP +  K W  IT+ MN+YL
Sbjct: 129 LAILFFIGSFSFVIVRIV-IDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFHMNEYL 187

Query: 138 FDNDLWNTPYYFYRDEDCHRYFLSLIKGRTFKKQKESS------ASNVKDAQSNDETAGT 191
           + N  +  P+  Y    C+ +FL L    T      +S       +++ DA +NDETA  
Sbjct: 188 YQNGYFRNPFCLYDSSKCYNWFLELTNNGTIDGSGTASNDSMPEPTDLIDA-ANDETAPN 246

Query: 192 PN-----EAAESSSFSAGPNFIKLLTKAAEIEQQFQKEYWRQEYPGVD 234
            N     +A + SS S     IK    A +       EYW+ E+P ++
Sbjct: 247 ENSTANVQAKKGSSHSTENALIKYKNAAIDAYNISMNEYWQTEFPELE 294

>YAR029W (YAR029W) [79] chr1 (186317..186541) Protein of unknown
           function [225 bp, 74 aa]
          Length = 74

 Score = 74.7 bits (182), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 45/62 (72%)

Query: 133 MNQYLFDNDLWNTPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASNVKDAQSNDETAGTP 192
           MN+YLFD+ +W+TPYYFY +EDCHR FLS I+GRTF+K   ++  NV++ ++ +     P
Sbjct: 1   MNKYLFDHKIWSTPYYFYCEEDCHRLFLSFIEGRTFEKPTSNAEENVQETEAGESFTLNP 60

Query: 193 NE 194
            E
Sbjct: 61  GE 62

>YML132W (COS3) [3840] chr13 (7244..8383) Member of the COS family
           of subtelomerically-encoded proteins [1140 bp, 379 aa]
          Length = 379

 Score = 58.2 bits (139), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 75/167 (44%), Gaps = 5/167 (2%)

Query: 25  ENVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXXXXXXXXXFHDNENCV-GVSVGFLL 83
           + + LP+D+F S  +++ YE       +               +  + NC+  + V  L+
Sbjct: 23  QKIVLPQDLFRSSFTWFCYEIYKS---LAFRIWMLLWLPLSVWWKLSNNCIYPLIVSLLV 79

Query: 84  IFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQYLFDNDLW 143
           +F G + +++I     + S      +   EI    P+    +W  +   +N YL++N++W
Sbjct: 80  LFLGPIFVLVICGLSRKRSLSKQLIQFCKEITENTPSSDPHDWEVVAANLNSYLYENNVW 139

Query: 144 NTPYYFYRDEDCHRYF-LSLIKGRTFKKQKESSASNVKDAQSNDETA 189
           NT Y+F+    C   F  +L++  + KK K +   + KD+    E A
Sbjct: 140 NTKYFFFNAMVCQEAFRTTLLEPFSLKKDKAAKVKSFKDSVPYIEEA 186

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 42/93 (45%), Gaps = 8/93 (8%)

Query: 74  CVGVSVGFLLIFSGILV--IVLILRFGPQ-----ISDEDFKCKLLMEIITRKPTVKGKEW 126
           C+ VS G  L+   + +  I+ +L  G Q     I   + K + L  II  + +     W
Sbjct: 248 CIYVSRGMCLLLRTLYLGWILFMLVQGFQNIRVLIMSMEHKMQFLSTIINEQES-GANGW 306

Query: 127 RTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYF 159
             I  KMN+YLF+   W    +F+   DC  +F
Sbjct: 307 DEIARKMNRYLFEKKAWKNEEFFFDGIDCEWFF 339

>YBR302C (COS2) [478] chr2 complement(810296..811435) Member of the
           duplication (DUP) family, has very strong similarity to
           uncharacterized S. cerevisiae Cos3p [1140 bp, 379 aa]
          Length = 379

 Score = 58.2 bits (139), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 75/167 (44%), Gaps = 5/167 (2%)

Query: 25  ENVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXXXXXXXXXFHDNENCV-GVSVGFLL 83
           + + LP+D+F S  +++ YE       +               +  + NC+  + V  L+
Sbjct: 23  QKIVLPQDLFRSSFTWFCYEIYKS---LAFRIWMLLWLPLSVWWKLSNNCIYPLIVSLLV 79

Query: 84  IFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQYLFDNDLW 143
           +F G + +++I     + S      +   EI    P+    +W  +   +N YL++N++W
Sbjct: 80  LFLGPIFVLVICGLSRKRSLSKQLIQFCKEITENTPSSDPHDWEVVAANLNSYLYENNVW 139

Query: 144 NTPYYFYRDEDCHRYF-LSLIKGRTFKKQKESSASNVKDAQSNDETA 189
           NT Y+F+    C   F  +L++  + KK K +   + KD+    E A
Sbjct: 140 NTKYFFFNAMVCQEAFRTTLLEPFSLKKDKAAKVKSFKDSVPYIEEA 186

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 42/93 (45%), Gaps = 8/93 (8%)

Query: 74  CVGVSVGFLLIFSGILV--IVLILRFGPQ-----ISDEDFKCKLLMEIITRKPTVKGKEW 126
           C+ VS G  L+   + +  I+ +L  G Q     I   + K + L  II  + +     W
Sbjct: 248 CIYVSRGMCLLLRTLYLGWILFMLVQGFQNIRVLIMSMEHKMQFLSTIINEQES-GANGW 306

Query: 127 RTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYF 159
             I  KMN+YLF+   W    +F+   DC  +F
Sbjct: 307 DEIARKMNRYLFEKKAWKNEEFFFDGIDCEWFF 339

>YHL044W (YHL044W) [2244] chr8 (13563..14270) Member of the
           duplication (DUP) family, has low similarity to
           uncharacterized S. cerevisiae Ycr007p [708 bp, 235 aa]
          Length = 235

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 61/136 (44%), Gaps = 5/136 (3%)

Query: 96  RFGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQYLFDNDLWNTPYYFYRDEDC 155
           R+  +  D+D K KLL E+IT KP +    W  I Y MNQ+++D  +     +FY    C
Sbjct: 99  RYKLRCLDDDCKFKLLAEVITHKPNMDLSTWDRIAYDMNQFVYDRRICADRSFFYDGSYC 158

Query: 156 HRYFLSLIKGRTFKKQKESSASNVKDAQSNDETAGTPNEAAESSSFSAGPNFIKLLTKAA 215
           ++ F  L+          +S     + +SN  T    N++  SS       +I    KA 
Sbjct: 159 YQVFKKLVATPYLVNSNMNSIYADLEMRSNGAT--NINDSGNSSLHIELGTYI---FKAL 213

Query: 216 EIEQQFQKEYWRQEYP 231
            + +    +YW  +YP
Sbjct: 214 AVFRNSVDKYWEDKYP 229

>YDL248W (COS7) [629] chr4 (1802..2953) Member of the COS family of
           subtelomerically-encoded proteins [1152 bp, 383 aa]
          Length = 383

 Score = 56.2 bits (134), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 74/167 (44%), Gaps = 5/167 (2%)

Query: 25  ENVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXXXXXXXXXFHDNENCV-GVSVGFLL 83
           + + LP+D+F S  +++ YE       +               +  + NC+  + V  L+
Sbjct: 23  QKIVLPQDLFRSSFTWFCYEIYKS---LAFRIWMLLWLPLSVWWKLSNNCIYPLIVSLLV 79

Query: 84  IFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQYLFDNDLW 143
           +F G + +++I     + S      +   EI    P+    +W  +   +N YL++N  W
Sbjct: 80  LFLGPIFVLVICGLSRKRSLSKQLIQFCKEITENTPSSDPHDWEVVVANLNSYLYENKAW 139

Query: 144 NTPYYFYRDEDCHRYF-LSLIKGRTFKKQKESSASNVKDAQSNDETA 189
           NT  +F+   DC + F  ++++  + KK K +   + KD+    E A
Sbjct: 140 NTKNFFFNATDCEKMFRTTVLEPFSLKKDKAAKVKSFKDSVPYIEEA 186

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 61/146 (41%), Gaps = 28/146 (19%)

Query: 25  ENVALPKDIFHSYLSYWIYE--AAHCTPVMXXXXXXXXXXXXXXXFHDNENCVGVSVGFL 82
           E+V LPKDI  S L++++      +  P+                     NC+ VS  F 
Sbjct: 213 EDVQLPKDIHRSKLTWFLKRIFTIYSLPLWLAFL----------------NCICVSQHFC 256

Query: 83  LIFS----GILVIVLI-----LRFGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKM 133
           L F     G+  ++++     +R    +   + K + L+ II  + +     W  I  KM
Sbjct: 257 LAFRILCPGLFFLMMVWLFQNMRTTALLVKMEHKMQFLLTIINEQES-GANGWDEIARKM 315

Query: 134 NQYLFDNDLWNTPYYFYRDEDCHRYF 159
           N+YLF+   W    +F+   DC  +F
Sbjct: 316 NRYLFEKKAWKNEEFFFDGIDCEWFF 341

>Kwal_56.22593
          Length = 200

 Score = 53.9 bits (128), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 50/92 (54%), Gaps = 16/92 (17%)

Query: 81  FLLIFSGILVIVLILRFGPQISDEDFK----------CKLLMEIITRKPTVKGKEWRTIT 130
           FLL   G+    LILR+G ++    F+          CKL+ +    +P++  K+W +I 
Sbjct: 80  FLLAVVGL---YLILRYGRKVEAAKFRDLSVVARVELCKLVSK---DRPSLNLKKWNSIA 133

Query: 131 YKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSL 162
             MN Y+F+  L++ PY+F+  E+C  +FL +
Sbjct: 134 VHMNNYIFEQGLYSMPYFFWDGEECRIFFLGM 165

>Kwal_49.19404
          Length = 200

 Score = 53.9 bits (128), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 50/92 (54%), Gaps = 16/92 (17%)

Query: 81  FLLIFSGILVIVLILRFGPQISDEDFK----------CKLLMEIITRKPTVKGKEWRTIT 130
           FLL   G+    LILR+G ++    F+          CKL+ +    +P++  K+W +I 
Sbjct: 80  FLLAVVGL---YLILRYGRKVEAAKFRDLSVVARVELCKLVSK---DRPSLNLKKWNSIA 133

Query: 131 YKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSL 162
             MN Y+F+  L++ PY+F+  E+C  +FL +
Sbjct: 134 VHMNNYIFEQGLYSMPYFFWDGEECRIFFLGM 165

>Scas_611.6
          Length = 307

 Score = 54.3 bits (129), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 56/139 (40%), Gaps = 2/139 (1%)

Query: 69  HDNENCVGVSVGFLLIFSGILVIVLILRF--GPQISDEDFKCKLLMEIITRKPTVKGKEW 126
           HD+    G  +G        ++I  I  F     I+    K K  +EII  KP    K W
Sbjct: 67  HDDSAAGGFGIGLFASSLTTVIISCIFFFQRTETITGTQAKMKFFLEIIQYKPNATSKSW 126

Query: 127 RTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASNVKDAQSND 186
             I   MN Y +    W    +FY  ++C+ +F+ L     +   ++   ++ +D+    
Sbjct: 127 DVIAAHMNTYFYREGHWANENFFYSGKECYNWFMELTTKVEYVPIEQPPRASQEDSSEPI 186

Query: 187 ETAGTPNEAAESSSFSAGP 205
           E +  P   + +S   A P
Sbjct: 187 ENSKKPTPTSTTSIPIAQP 205

>YJR161C (COS5) [3051] chr10 complement(742763..743914) Member of
           the COS family of subtelomerically-encoded proteins
           [1152 bp, 383 aa]
          Length = 383

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 73/167 (43%), Gaps = 5/167 (2%)

Query: 25  ENVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXXXXXXXXXFHDNENCV-GVSVGFLL 83
           + + LP+D+F S  +++ YE       +               +  + NC+  + V  L+
Sbjct: 23  QKIVLPQDLFRSSFTWFCYEIYKS---LAFPIWMLLWLPLSVWWKLSNNCIYPLIVSLLV 79

Query: 84  IFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQYLFDNDLW 143
           +F G + +++I     + S      +   E+    P+    +W  +   +N YL++N  W
Sbjct: 80  LFLGPIFVLVICGLSRKRSLSKQLIQFCKEVTENTPSSDPHDWEVVAANLNSYLYENKAW 139

Query: 144 NTPYYFYRDEDCHRYF-LSLIKGRTFKKQKESSASNVKDAQSNDETA 189
           NT Y+F+    C   F  +L++  + KK + +   + KD+    E A
Sbjct: 140 NTRYFFFNAMGCQEAFRTTLLEPFSLKKDEAAKVKSFKDSVPYIEEA 186

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 61/146 (41%), Gaps = 28/146 (19%)

Query: 25  ENVALPKDIFHSYLSYWIYE--AAHCTPVMXXXXXXXXXXXXXXXFHDNENCVGVSVGFL 82
           E+V LPKDI  S L++++      +  P+                     NC+ VS  F 
Sbjct: 213 EDVQLPKDIHRSKLTWFLKRIFTIYSLPLWLAFL----------------NCICVSQHFC 256

Query: 83  LIFS----GILVIVLI-----LRFGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKM 133
           L F     G+  ++++     +R    +   + K + L+ II  + +     W  I  KM
Sbjct: 257 LAFRILCPGLFFLMMVWLFQNMRTTALLVKMEHKMQFLLTIINEQES-GANGWDEIARKM 315

Query: 134 NQYLFDNDLWNTPYYFYRDEDCHRYF 159
           N+YLF+   W    +F+   DC  +F
Sbjct: 316 NRYLFEKKAWKNEEFFFEGIDCEWFF 341

>YNL336W (COS1) [4279] chr14 (8330..9475) Member of the COS family
           of subtelomerically-encoded proteins [1146 bp, 381 aa]
          Length = 381

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 73/167 (43%), Gaps = 5/167 (2%)

Query: 25  ENVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXXXXXXXXXFHDNENCV-GVSVGFLL 83
           + + LP+D+F S  +++ YE       +               +  + NC+  + V  L+
Sbjct: 23  QKIVLPQDLFRSSFTWFCYEIYKS---LAFRIWMLLWLPLSVWWKLSNNCIYPLIVSLLV 79

Query: 84  IFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQYLFDNDLW 143
           +F G + +++I     + S      +   E+    P+    +W  +   +N YL++N  W
Sbjct: 80  LFLGPIFVLVICGLSRKRSLSKQLIQFCKEVTENTPSSDPHDWEVVAANLNSYLYENKAW 139

Query: 144 NTPYYFYRDEDCHRYF-LSLIKGRTFKKQKESSASNVKDAQSNDETA 189
           NT Y+F+    C   F  +L++  + KK + +   + KD+    E A
Sbjct: 140 NTKYFFFNAMVCQEAFRTTLLEPFSLKKDEAAKVKSFKDSVPYIEEA 186

 Score = 36.2 bits (82), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 10/95 (10%)

Query: 74  CVGVSVGFLLI----FSGILVIVLI-----LRFGPQISDEDFKCKLLMEIITRKPTVKGK 124
           C+ VS G  L+    + G ++ +L+     +R        + K + L  II  + +    
Sbjct: 248 CIYVSRGMCLLLRTFYLGWILFMLVQGFQNMRMIVLSVKMEHKMQFLSTIINEQES-GAN 306

Query: 125 EWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYF 159
            W  I  KMN+YLF+  +W    +F+   DC  +F
Sbjct: 307 GWDEIAKKMNRYLFEKKVWKNEEFFFDGIDCEWFF 341

>YGR295C (COS6) [2237] chr7 complement(1081589..1082734) Member of
           the COS family of subtelomerically-encoded proteins
           [1146 bp, 381 aa]
          Length = 381

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 78/186 (41%), Gaps = 4/186 (2%)

Query: 6   ENTNAKSDSLDEPGAYLIE-ENVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXXXXXX 64
           EN      S+D      +E +   LP+D+F S  +++ YE  + + V             
Sbjct: 3   ENELKNEKSVDVLSVKQLESQKTVLPQDLFRSSFTWFCYEI-YKSLVFRIWMLLWLPLSV 61

Query: 65  XXXFHDNENCVGVSVGFLLIFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPTVKGK 124
                +N     + V  L++F G + +++I R   + S      +   EI    P+    
Sbjct: 62  WWKLSNNW-IYPLMVSLLVLFWGPVFVLVIFRLSRKRSLSKQLTQFCKEITKNTPSSDPH 120

Query: 125 EWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYF-LSLIKGRTFKKQKESSASNVKDAQ 183
           +W  +   +N Y ++N  WNT Y+F+    C   F  +L++  + KK + +   + KD+ 
Sbjct: 121 DWEVVAANLNSYFYENKAWNTKYFFFSAMSCQEAFRTTLLEPFSLKKDEAAKVKSFKDSV 180

Query: 184 SNDETA 189
              E A
Sbjct: 181 PYIEEA 186

 Score = 33.9 bits (76), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 126 WRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYF 159
           W  I  KMN+YLF+  +W    +F+   DC  +F
Sbjct: 308 WDEIAKKMNRYLFEKKVWKNEEFFFDGIDCEWFF 341

>YFL062W (COS4) [1622] chr6 (6426..7565) Member of the duplication
           (DUP) family, has strong similarity to uncharacterized
           S. cerevisiae Cos1p [1140 bp, 379 aa]
          Length = 379

 Score = 53.1 bits (126), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 68/166 (40%), Gaps = 3/166 (1%)

Query: 25  ENVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXXXXXXXXXFHDNENCVGVSVGFLLI 84
           + + LP+D+F S  +++ YE                          N     + V  L++
Sbjct: 23  QKIVLPQDLFRSSFTWFCYEIYKSLAFRIWMLLWLPLSVWWKL--SNNWIYPLMVSLLVL 80

Query: 85  FSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQYLFDNDLWN 144
           F G + +++I R   + S      +   EI    P+    +W  +   +N YL++N  WN
Sbjct: 81  FWGPVFVLVIFRLSRKRSLSKQLTQFCKEITKSTPSSDPHDWEVVAANLNSYLYENKAWN 140

Query: 145 TPYYFYRDEDCHRYF-LSLIKGRTFKKQKESSASNVKDAQSNDETA 189
             Y+F+    C   F  +L++  + KK + +   + KD+    E A
Sbjct: 141 IRYFFFNAMGCQEAFRTTLLEPFSLKKDEAAKVKSFKDSVPYIEEA 186

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 8/93 (8%)

Query: 74  CVGVSVGFLLIFSGILV--IVLILRFGPQ-----ISDEDFKCKLLMEIITRKPTVKGKEW 126
           C+ VS G  L+   + +  I+ +L  G Q     I   + K + L  II  + +     W
Sbjct: 248 CIYVSRGMCLLLRTLYLGWILFMLVQGFQNIRVLIMSMEHKMQFLSTIINEQES-GANGW 306

Query: 127 RTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYF 159
             I  KMN+YLF+  +W    +F+   DC  +F
Sbjct: 307 DEIARKMNRYLFEKKVWKNEEFFFDGIDCEWFF 339

>Sklu_2378.5 YCR007C, Contig c2378 11079-11756
          Length = 225

 Score = 49.3 bits (116), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 54/115 (46%), Gaps = 4/115 (3%)

Query: 84  IFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQYLFDNDLW 143
           IF+ +   V+I   G  + D   + +LL+EI   +P +   +W  I   +N ++     W
Sbjct: 77  IFTVVPATVVIATRGIGL-DLQGRARLLVEITVTRPALDMSKWDIIAADINNFMLKKGKW 135

Query: 144 NTPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASNVKDAQSNDETAGTPNEAAES 198
           ++  YFY  E+C  +F    KG        S ++N   +  +D+ A   ++A+ +
Sbjct: 136 SSKQYFYNGEECFDFFK---KGYLIPSAGISRSANSDSSPESDQNASAASDASRT 187

>YGL263W (COS12) [1737] chr7 (2790..3932) Member of the COS family
           of subtelomerically-encoded proteins [1143 bp, 380 aa]
          Length = 380

 Score = 49.7 bits (117), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 55/141 (39%), Gaps = 9/141 (6%)

Query: 26  NVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXXXXXXXXXFHDNENCVGVSVGFLLIF 85
           N  LPK++F S++++  YE  +                           V V+     + 
Sbjct: 22  NSTLPKNVFRSFVTWSCYEKFNSLEFRTWLLMWLPLIIAWKIRGKRHYLVIVTALMFEVL 81

Query: 86  SGILVIVLILR---FGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQYLFDNDL 142
             +     I R    G Q+S      +   EIIT  P +  ++W  +    N YL++N L
Sbjct: 82  YFLWTYSYIFRERTLGKQVS------QFAKEIITNTPGIDTEDWERVAVNFNSYLYENKL 135

Query: 143 WNTPYYFYRDEDCHRYFLSLI 163
           WNT Y+F+    C   F  ++
Sbjct: 136 WNTEYFFFDGSSCQEAFRKML 156

 Score = 34.7 bits (78), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 23/53 (43%)

Query: 107 KCKLLMEIITRKPTVKGKEWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYF 159
           K + L  I           W  I  + N Y+F+  +WN+P  F    DC ++F
Sbjct: 291 KLQFLSYITCGHEKSDATNWSQIAKRTNTYMFEQKIWNSPILFSDGIDCEKFF 343

>YHL048W (COS8) [2241] chr8 (6400..7545) Member of the COS family of
           subtelomerically-encoded proteins [1146 bp, 381 aa]
          Length = 381

 Score = 49.3 bits (116), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/167 (20%), Positives = 71/167 (42%), Gaps = 5/167 (2%)

Query: 25  ENVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXXXXXXXXXFHDNENCVG-VSVGFLL 83
           +   LP+D+F + L+++ YE       +               +  + N +  + V  L+
Sbjct: 23  QKTVLPQDVFRNELTWFCYEIYKS---LAFRIWMLLWLPLSVWWKLSSNWIHPLIVSLLV 79

Query: 84  IFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQYLFDNDLW 143
           +F G   +++I     + S      +   EI    P+    +W  +   +N Y ++N  W
Sbjct: 80  LFLGPFFVLVICGLSRKRSLSKQLIQFCKEITEDTPSSDPHDWEVVAANLNSYFYENKTW 139

Query: 144 NTPYYFYRDEDCHRYF-LSLIKGRTFKKQKESSASNVKDAQSNDETA 189
           NT Y+F+    C + F  +L++  + KK + +   + KD+    E A
Sbjct: 140 NTKYFFFNAMSCQKAFKTTLLEPFSLKKDESAKVKSFKDSVPYIEEA 186

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 31/66 (46%), Gaps = 7/66 (10%)

Query: 126 WRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYF-------LSLIKGRTFKKQKESSASN 178
           W  I  KMN+YLF+  +WN   +FY   DC  +F       LSL K   F          
Sbjct: 308 WDEIAKKMNRYLFEKKVWNNEEFFYDGLDCEWFFRRFFYRLLSLKKPMWFASLNVELWPY 367

Query: 179 VKDAQS 184
           +K+AQS
Sbjct: 368 IKEAQS 373

>Kwal_27.10096
          Length = 340

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 63/154 (40%), Gaps = 29/154 (18%)

Query: 24  EENVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXXXXXXXXXFHDNENCVGVSVGFLL 83
           +E + +PKD+FHS    W +  A   P+                      C+ +    ++
Sbjct: 5   KEALTIPKDVFHSKFR-WSFFQARKDPIF---------------------CLFLITCVVI 42

Query: 84  IFSGI--LVIVLILRFGPQISDEDFKCK-----LLMEIITRKPTVKGKEWRTITYKMNQY 136
            FS     V VL++  G  ++      K     L  E+I ++P     +W  IT ++N  
Sbjct: 43  KFSRFEGSVSVLVILVGSYLAGARRALKKNIEKLCNEVIDQRPGADTLKWNLITQRLNGL 102

Query: 137 LFDNDLWNTPYYFYRDEDCHRYFLSLIKGRTFKK 170
           L+D  L+N PY  +  E C   F  L+   + +K
Sbjct: 103 LYDEGLYNNPYCIFDGEHCQELFRELVLEPSLQK 136

 Score = 40.4 bits (93), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 38/77 (49%)

Query: 83  LIFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQYLFDNDL 142
           LI   + V++   R   +    + +   L  +   +P  + + W  +  +MN+Y+++   
Sbjct: 229 LIVVYLFVVLSYRRIKIEEMKIEARLTFLKTVSLVRPHAQVEGWNVVAKRMNKYMYEEKG 288

Query: 143 WNTPYYFYRDEDCHRYF 159
           W++  +F+  EDC RYF
Sbjct: 289 WHSKEFFHDGEDCSRYF 305

>YKL219W (COS9) [3056] chr11 (14485..15708) Member of the COS family
           of subtelomerically-encoded proteins [1224 bp, 407 aa]
          Length = 407

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 65/173 (37%), Gaps = 13/173 (7%)

Query: 25  ENVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXXXXXXXXXFHDNENCVGVSVGFLLI 84
           + V LP+D+F    ++  YE   C                   F      +     F L 
Sbjct: 47  QKVVLPQDLFMDNFTWMFYEFFKC--FTFRTWLLLLLLMWLPGFLSQIKSINRIFPFKLC 104

Query: 85  FSGILVIVLILRFGPQISDEDFKCKLL-------MEIITRKPTVKGKEWRTITYKMNQYL 137
              ILV  L+  F P I     K  L         EI+   P     +W T+   +N Y 
Sbjct: 105 ---ILVSCLVGIFLPNIYSFSHKSVLTNQLTQFSKEIVEHAPGTDTHDWETVAANLNSYF 161

Query: 138 FDNDLWNTPYYFYRDEDCHRYFLS-LIKGRTFKKQKESSASNVKDAQSNDETA 189
           ++N  WNT Y+F+   +C + F   L++  + KK + S   +  D+    E A
Sbjct: 162 YENKAWNTEYFFFNAAECQKAFRKVLLEPFSVKKDESSKIKSFGDSVPYIEEA 214

 Score = 35.4 bits (80), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 8/77 (10%)

Query: 87  GILVIVLILR----FGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQYLFDNDL 142
           G L++V + +    F   + D   K + L  II  + +     W  I  KMN+YLF+  +
Sbjct: 295 GFLLMVRVFQNMRPFSMHMED---KMQFLSTIINEQES-GANGWDEIAKKMNRYLFEKKV 350

Query: 143 WNTPYYFYRDEDCHRYF 159
           W +  +F+   DC  +F
Sbjct: 351 WTSEEFFFDGIDCEWFF 367

>Sklu_2378.4 , Contig c2378 9846-10556
          Length = 236

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 77/194 (39%), Gaps = 16/194 (8%)

Query: 9   NAKSDSLDEPGAYLIEENVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXXXXXXXXXF 68
           +AK   + + GA   E +  LP+DIF +   +  Y+      +                +
Sbjct: 5   DAKLPMVTQNGA---ESSPKLPRDIFKTRSRWRCYKLYKSIAIRISLLIFLIAQVLATFY 61

Query: 69  HDNEN---CVGVSVGFLLIFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPTVKGKE 125
              E    C+ +    L++FS ++V+      G +   E      L+++ T +P +    
Sbjct: 62  GGIEGFGLCL-IPTLILILFSALIVLTTSSSLGLKGQME-----FLVQVTTLRPGLDISR 115

Query: 126 WRTITYKMNQYLFDNDLWNTPYYFYRD-EDCHRYFLSLIKGRTFKKQKESSASNVKDAQS 184
           W  I  +MN+Y+ +   W +  YF+ D E+C +YF           Q+E     + +  +
Sbjct: 116 WDIIANRMNEYMLNTGKWLSENYFFFDGEECFKYFREWC---ILPSQREEKDKKLDNTDT 172

Query: 185 NDETAGTPNEAAES 198
              T   P E  +S
Sbjct: 173 PHNTKDDPTETQQS 186

>Scas_460.2
          Length = 235

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%)

Query: 109 KLLMEIITRKPTVKGKEWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYF 159
           KL +EII  KP V  + W  I   +NQ+L++   WNTP +FY     + +F
Sbjct: 113 KLFLEIIQWKPNVDPRSWDLIALHINQHLYEMGNWNTPGFFYDGHLVYAWF 163

>YHL043W (ECM34) [2245] chr8 (14899..15411) Protein possibly
           involved in cell wall structure or biosynthesis [513 bp,
           170 aa]
          Length = 170

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 57/152 (37%), Gaps = 34/152 (22%)

Query: 26  NVALPKDIFHSYLSYWIYEAAHCTPVMXXXXXXXXXXXXXXXFH-------DNENCVGVS 78
           N  LPK++F S  +++ YE  + +                  F         + N  G  
Sbjct: 24  NAKLPKNVFRSSFTWYCYEVINRSAFHIWLLLCLTLIVGWKVFSGIGGRRPSDSNMDGPQ 83

Query: 79  V------GFLLIFSGILVIVLIL---------------RFGPQISDEDFKCKLLMEIITR 117
                  GFL   S I+++V+ L                FG QI+      +   EII  
Sbjct: 84  TKHKRNPGFLRRHSTIVILVISLAVSFSWEAFKMYRERTFGKQIT------QFAKEIIKS 137

Query: 118 KPTVKGKEWRTITYKMNQYLFDNDLWNTPYYF 149
            P+   + W  +    N Y+++N LWNT Y+F
Sbjct: 138 APSTDMESWDRVAADFNSYMYENKLWNTEYFF 169

>YNR075W (COS10) [4658] chr14 (779913..781037) Member of the COS
           family of subtelomerically-encoded proteins [1125 bp,
           374 aa]
          Length = 374

 Score = 43.5 bits (101), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 3/97 (3%)

Query: 78  SVGFLLIFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQYL 137
           SV  +L    IL +V I      +S++    +L  EII   P     +W  +    N YL
Sbjct: 69  SVVLILALIAILPVVQIQYSKYTLSNQ--LTQLSKEIIKSAPGAYSADWDAVAIHFNSYL 126

Query: 138 FDNDLWNTPYYFYRDEDCHRYFL-SLIKGRTFKKQKE 173
           ++N  W T ++F+   DC   F  ++++    ++Q E
Sbjct: 127 YENKAWKTAHFFFNGTDCQEAFRKTILEPAVLRRQNE 163

 Score = 34.3 bits (77), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 33/79 (41%), Gaps = 1/79 (1%)

Query: 99  PQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRY 158
           P+    D K + L +II  +     K W TI  K N  LF+  +W    +F+   DC  +
Sbjct: 275 PKSMKVDDKMQYLSDIINEQGASPEK-WDTIARKTNTRLFEKRVWKNEEFFFDGTDCQAF 333

Query: 159 FLSLIKGRTFKKQKESSAS 177
           F        F K+  S  S
Sbjct: 334 FERNFSSLLFSKKSASPRS 352

>Kwal_26.9047
          Length = 119

 Score = 39.7 bits (91), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 38/78 (48%)

Query: 82  LLIFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQYLFDND 141
           +LI   ++ +VL  R   +    + + K L  I   KP  + + W  +  +MN+Y+++  
Sbjct: 1   MLIVLLLIGVVLYPRMKIKEMKIEERLKFLKTISLVKPHAQIEGWNIVAKRMNKYMYEEK 60

Query: 142 LWNTPYYFYRDEDCHRYF 159
            W+   +FY  EDC   F
Sbjct: 61  GWHNREFFYNGEDCLNAF 78

>Scas_600.5d
          Length = 252

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 44/115 (38%), Gaps = 9/115 (7%)

Query: 79  VGFLLIFSGILVIVLILRFGPQI---------SDEDFKCKLLMEIITRKPTVKGKEWRTI 129
           + +LLIF     +  I  +G  I           E     L  EII R P      W   
Sbjct: 114 LSYLLIFGIFYTLPFIFWYGLLILLKIDKKDSVKESQPLSLFKEIIDRTPNSTTASWDIT 173

Query: 130 TYKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASNVKDAQS 184
           T  +N  L++   W T Y  +  ++CH +F++           E    N+++ ++
Sbjct: 174 TSHLNDMLYEGKKWPTKYMMWDGKECHAWFINQTSSVNVPLVDEFKKKNIRNLET 228

>Sklu_2402.3 , Contig c2402 12663-13277
          Length = 204

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 7/90 (7%)

Query: 81  FLLIFSGILVIVLILRFGPQIS---DEDFKCKLLM----EIITRKPTVKGKEWRTITYKM 133
           F + F G  + V  L   P ++   +  FK + L+    E+   KP +  + W  +   M
Sbjct: 63  FWMEFIGAEIFVFTLIILPNLTYCVENRFKLRELIRFSEEVTKVKPGIDMEIWDIVASNM 122

Query: 134 NQYLFDNDLWNTPYYFYRDEDCHRYFLSLI 163
           N+++    LW+  Y FY   DC + F  LI
Sbjct: 123 NKFMQSEKLWSILYSFYDGGDCFQQFRRLI 152

>Kwal_26.7243
          Length = 366

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 37/92 (40%), Gaps = 10/92 (10%)

Query: 110 LLMEIITRKPTVKGKEWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSL------- 162
           +L  I+  KP      W  +    N YL D  +   P +FY  +DC  YF  L       
Sbjct: 273 ILAIIVEVKPKPDTSGWDDVARHCNAYLRDEKVRAIPEFFYDGKDCFWYFNRLYSSFLPK 332

Query: 163 ---IKGRTFKKQKESSASNVKDAQSNDETAGT 191
              +    FK   E + +  K+ Q +D  +GT
Sbjct: 333 PCRVSLDEFKPYVEEAIAATKEIQEDDGASGT 364

 Score = 35.4 bits (80), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 14/73 (19%), Positives = 37/73 (50%)

Query: 110 LLMEIITRKPTVKGKEWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSLIKGRTFK 169
           L  E+I  +P    ++W  +   +N+ L+ + +W++PY  +  + C+  F  L+    ++
Sbjct: 82  LCEEVIEVQPGADLRKWDVVAAHINERLYKSGVWHSPYCVFDGKSCYSIFRLLVLTPFYQ 141

Query: 170 KQKESSASNVKDA 182
            + +   + + +A
Sbjct: 142 GKCDKQNTQLAEA 154

>Kwal_26.7673
          Length = 367

 Score = 35.4 bits (80), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 33/92 (35%), Gaps = 2/92 (2%)

Query: 76  GVSVGFLLIFSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQ 135
           G  +G  + F          RF    +   F   LL  I+  KP      W  +  + N 
Sbjct: 240 GFMIGCAIFFMIFSFCYYWARFYDVRASHSFM--LLAIIVEVKPKTDTMAWDNVAKQFNA 297

Query: 136 YLFDNDLWNTPYYFYRDEDCHRYFLSLIKGRT 167
           YL    +W TP +FY   DC   F   +   T
Sbjct: 298 YLQREKVWPTPEFFYDGNDCLWAFNKFVSSDT 329

 Score = 34.7 bits (78), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 27/60 (45%)

Query: 110 LLMEIITRKPTVKGKEWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSLIKGRTFK 169
           L  E+I  +P     +W  +   +N+ L+ +  W  PY  Y  E C   F  L+ G  +K
Sbjct: 81  LCEEVIKIQPGANLSKWDVVAAHINERLYRSGAWYNPYCIYDGEYCISLFRLLVLGPFYK 140

>YHL042W (YHL042W) [2246] chr8 (15665..16117) Protein with
           similarity to subtelomerically-encoded proteins such as
           Cos5p, Ybr302p, Cos3p, Cos1p, Cos4p, Cos8p, Cos6p, Cos9p
           [453 bp, 150 aa]
          Length = 150

 Score = 33.1 bits (74), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 24/53 (45%)

Query: 107 KCKLLMEIITRKPTVKGKEWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYF 159
           + + L  II+         W  I  KMN YLF+  +  +  +F    DC R+F
Sbjct: 58  RMQFLSTIISEHQKSDVNCWDQIAKKMNVYLFEQKVSGSDVFFLDGADCERFF 110

>KLLA0C19063g complement(1692492..1693121) no similarity,
           hypothetical start
          Length = 209

 Score = 33.5 bits (75), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 118 KPT-VKGKEWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSLIKGRT 167
           KP+ +  K+W  +   +N++L++   W    +FY  + C   F++L+K  T
Sbjct: 128 KPSYIDMKQWDIVARVVNKHLYEAGSWPNNRFFYDGKRCQAMFIALVKKPT 178

>YBR200W (BEM1) [383] chr2 (620829..622484) Protein required for
           cell polarization and bud formation, contains two SH3
           domains and a PX (phox) domain [1656 bp, 551 aa]
          Length = 551

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query: 141 DLWNTPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASNVKDAQSNDETAGTPNEAAESSS 200
           DL N P Y  R E  H  F+ L  G   + +++ + +N+K  Q ND    T   A+++S+
Sbjct: 379 DLVNLPDYISRSEMVHSLFVVLNNGFDREFERDENQNNIKTLQEND--TATFATASQTSN 436

Query: 201 FSA 203
           F++
Sbjct: 437 FAS 439

>KLLA0A11957g 1041208..1041834 no similarity, hypothetical start
          Length = 208

 Score = 32.0 bits (71), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 20/47 (42%)

Query: 118 KPTVKGKEWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSLIK 164
           K    G  W  I   MN YLF   LW +    Y  + C+  F++  K
Sbjct: 122 KLIATGYSWEQIGRIMNSYLFQRGLWWSNSCIYDGQQCYVLFINYTK 168

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 16/21 (76%)

Query: 8   TNAKSDSLDEPGAYLIEENVA 28
            N+ SDS DEPGAY++E N A
Sbjct: 486 VNSNSDSYDEPGAYMLEYNSA 506

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,919,094
Number of extensions: 325297
Number of successful extensions: 1236
Number of sequences better than 10.0: 47
Number of HSP's gapped: 1216
Number of HSP's successfully gapped: 61
Length of query: 234
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 136
Effective length of database: 13,203,545
Effective search space: 1795682120
Effective search space used: 1795682120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)