Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL019W (CKB1)27827413770.0
Scas_638.727027411241e-157
CAGL0A00275g26627111011e-153
Sklu_1768.432927410751e-148
Kwal_47.1744925027010191e-141
KLLA0A04818g27726110061e-139
AGR163W2752609871e-136
Kwal_55.215702412444296e-52
Scas_699.432562594272e-51
Sklu_1979.22732354265e-51
KLLA0E21967g2602324194e-50
ACR087C2572354125e-49
YOR039W (CKB2)2582234109e-49
CAGL0I00946g2592324072e-48
Kwal_26.8595103452681.4
CAGL0F02959g63545653.1
AFR027C30621626.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL019W
         (274 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II (Pr...   535   0.0  
Scas_638.7                                                            437   e-157
CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomy...   428   e-153
Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement        418   e-148
Kwal_47.17449                                                         397   e-141
KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces c...   392   e-139
AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH] complement(...   384   e-136
Kwal_55.21570                                                         169   6e-52
Scas_699.43                                                           169   2e-51
Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement        168   5e-51
KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces...   166   4e-50
ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH] (514602..51...   163   5e-49
YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II Pr...   162   9e-49
CAGL0I00946g complement(76974..77753) highly similar to sp|P3893...   161   2e-48
Kwal_26.8595                                                           31   1.4  
CAGL0F02959g 286337..288244 similar to sp|Q04049 Saccharomyces c...    30   3.1  
AFR027C [3219] [Homologous to ScYNL166C (BNI5) - SH] (487430..48...    28   6.0  

>YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II
           (Protein kinase CK2), regulatory (beta) subunit [837 bp,
           278 aa]
          Length = 278

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/274 (94%), Positives = 258/274 (94%)

Query: 1   MSQEFVEDYSRTGSSDDEDSGAYDEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEV 60
           MSQEFVEDYSRTGSSDDEDSGAYDEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEV
Sbjct: 1   MSQEFVEDYSRTGSSDDEDSGAYDEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEV 60

Query: 61  PHYRKALDLILDLEAMSXXXXXXXXXXXXXXXXQEMQSNDGHDEGKRRNKSPVVNKSIIE 120
           PHYRKALDLILDLEAMS                QEMQSNDGHDEGKRRNKSPVVNKSIIE
Sbjct: 61  PHYRKALDLILDLEAMSDEEEDEDDVVEEDEVDQEMQSNDGHDEGKRRNKSPVVNKSIIE 120

Query: 121 HAAEQLYGLIHARFILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTV 180
           HAAEQLYGLIHARFILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTV
Sbjct: 121 HAAEQLYGLIHARFILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTV 180

Query: 181 RLYCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGF 240
           RLYCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGF
Sbjct: 181 RLYCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGF 240

Query: 241 RINDEAVSGPRMKWLRQYPSTEEDWEEFAKCEFE 274
           RINDEAVSGPRMKWLRQYPSTEEDWEEFAKCEFE
Sbjct: 241 RINDEAVSGPRMKWLRQYPSTEEDWEEFAKCEFE 274

>Scas_638.7
          Length = 270

 Score =  437 bits (1124), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 212/274 (77%), Positives = 233/274 (85%), Gaps = 9/274 (3%)

Query: 1   MSQEFVEDYSRTGSSDDEDSGAYDEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEV 60
           MSQ+FVE  S  G   DEDSG Y+EWIPSFC+RFGHEYFC+VPTEFIEDDFN+TSLSQEV
Sbjct: 1   MSQQFVEVPSH-GELSDEDSGNYEEWIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEV 59

Query: 61  PHYRKALDLILDLEAMSXXXXXXXXXXXXXXXXQEMQSNDGHDEGKRRNKSPVVNKSIIE 120
           PHYRKALDLILDLEA+S                  + +N+G  +   + K+  VN+SIIE
Sbjct: 60  PHYRKALDLILDLEAISEEEEEEDEDM--------VGANNGQTDELVKKKAQAVNRSIIE 111

Query: 121 HAAEQLYGLIHARFILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTV 180
           HAAEQLYGLIHAR+ILTKPGLQAMAEKFDHKEFGTCPRY+C GMQLLPCGLSDT+GK+TV
Sbjct: 112 HAAEQLYGLIHARYILTKPGLQAMAEKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTV 171

Query: 181 RLYCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGF 240
           RLYCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELE+YV RK+K SYELKVFGF
Sbjct: 172 RLYCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGF 231

Query: 241 RINDEAVSGPRMKWLRQYPSTEEDWEEFAKCEFE 274
           +IND AVSG RMKWLRQYPS EE+WEEFAKCEFE
Sbjct: 232 KINDRAVSGQRMKWLRQYPSNEEEWEEFAKCEFE 265

>CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1, hypothetical start
          Length = 266

 Score =  428 bits (1101), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 206/271 (76%), Positives = 227/271 (83%), Gaps = 12/271 (4%)

Query: 4   EFVEDYSRTGSSDDEDSGAYDEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPHY 63
           E++ED S +     +DSG YDEWIPSFCSRFGHEYFCQVPT+FIEDDFNMTSL+QEVPHY
Sbjct: 3   EYMEDNSHS-----DDSGTYDEWIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHY 57

Query: 64  RKALDLILDLEAMSXXXXXXXXXXXXXXXXQEMQSNDGHDEGKRRNKSPVVNKSIIEHAA 123
           RKALDLILDLE +S                   +S+ G +     N   +VN++II HAA
Sbjct: 58  RKALDLILDLEMVSDEEDMDEKESGA-------ESSSGANNNGGVNSKALVNRNIIGHAA 110

Query: 124 EQLYGLIHARFILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRLY 183
           EQLYGLIHAR+ILTKPGLQAMAEKFDHK+FGTCPRY+C+GMQLLPCGLSDT+GK  VRLY
Sbjct: 111 EQLYGLIHARYILTKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLY 170

Query: 184 CPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGFRIN 243
           CPSCQDLYLPQSSR LCLEGA+WGTSFPGVFLKHFKELEEYVERK+KESYELKVFGFRIN
Sbjct: 171 CPSCQDLYLPQSSRHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRIN 230

Query: 244 DEAVSGPRMKWLRQYPSTEEDWEEFAKCEFE 274
           D+AVSGPRMKWLRQYP TEEDWEEF KCEFE
Sbjct: 231 DQAVSGPRMKWLRQYPVTEEDWEEFNKCEFE 261

>Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement
          Length = 329

 Score =  418 bits (1075), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 210/274 (76%), Positives = 226/274 (82%), Gaps = 19/274 (6%)

Query: 1   MSQEFVEDYSRTGSSDDEDSGAYDEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEV 60
           MSQEF+ED S   SS+  DSG YDEWIPSFCSRFGHEYFCQVPTEFIEDDFNMT LSQE+
Sbjct: 70  MSQEFIEDQS---SSNSSDSGTYDEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTGLSQEI 126

Query: 61  PHYRKALDLILDLEAMSXXXXXXXXXXXXXXXXQEMQSNDGHDEGKRRNKSPVVNKSIIE 120
           PHYRKALDLILDLEAMS                      DG  E         VN+SI+E
Sbjct: 127 PHYRKALDLILDLEAMSDEDDEDDNDGAA--------EEDGSGE--------PVNRSIME 170

Query: 121 HAAEQLYGLIHARFILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTV 180
           HAAEQLYGLIHAR+ILTKPGLQ+MAEKFDHKEFGTCPRYYC GMQ+LPCGLSDT+GK TV
Sbjct: 171 HAAEQLYGLIHARYILTKPGLQSMAEKFDHKEFGTCPRYYCGGMQMLPCGLSDTLGKQTV 230

Query: 181 RLYCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGF 240
           RLYCPSCQDLYLPQSSR LC++GAFWGTSFPGVFLKHFKELE+YVERKSK+ YELKVFGF
Sbjct: 231 RLYCPSCQDLYLPQSSRHLCMDGAFWGTSFPGVFLKHFKELEDYVERKSKDVYELKVFGF 290

Query: 241 RINDEAVSGPRMKWLRQYPSTEEDWEEFAKCEFE 274
           +IN EAVSGPRMKWLRQYP+TE +WEEF KCEFE
Sbjct: 291 KINGEAVSGPRMKWLRQYPATEAEWEEFEKCEFE 324

>Kwal_47.17449
          Length = 250

 Score =  397 bits (1019), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 193/270 (71%), Positives = 220/270 (81%), Gaps = 28/270 (10%)

Query: 4   EFVEDYSRTGSSDDEDSGAYDEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPHY 63
           E+V D SR+GSSD+  SG +DEWIPSFC+RFGHEYFCQVPTEFIEDDFNMT L QEVPHY
Sbjct: 3   EYVGDNSRSGSSDE--SGTFDEWIPSFCARFGHEYFCQVPTEFIEDDFNMTGLGQEVPHY 60

Query: 64  RKALDLILDLEAMSXXXXXXXXXXXXXXXXQEMQSNDGHDEGKRRNKSPVVNKSIIEHAA 123
           RKALDL+LDLEAMS                         DE  + ++ PV ++SI+EHAA
Sbjct: 61  RKALDLVLDLEAMS-------------------------DEEGQDSEEPV-SRSIVEHAA 94

Query: 124 EQLYGLIHARFILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRLY 183
           EQLYGL+HAR+ILTKPGLQAMAEKFDHKEFGTCPRYYC GMQ+LPCGL+DT+GK TVRLY
Sbjct: 95  EQLYGLVHARYILTKPGLQAMAEKFDHKEFGTCPRYYCAGMQMLPCGLTDTLGKLTVRLY 154

Query: 184 CPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGFRIN 243
           CPSCQDLYLPQSSR LCLEGAFWGTSFPGVFLKHFKELE+YV+RKSK++YEL+VFGFRI 
Sbjct: 155 CPSCQDLYLPQSSRHLCLEGAFWGTSFPGVFLKHFKELEDYVDRKSKDTYELRVFGFRIA 214

Query: 244 DEAVSGPRMKWLRQYPSTEEDWEEFAKCEF 273
            EA SG RM+WLRQ+P T ++  E  +CEF
Sbjct: 215 SEAPSGARMRWLRQHPKTPQELRELQECEF 244

>KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1 casein kinase II, beta subunit,
           start by similarity
          Length = 277

 Score =  392 bits (1006), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 185/261 (70%), Positives = 213/261 (81%), Gaps = 16/261 (6%)

Query: 14  SSDDEDSGAYDEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPHYRKALDLILDL 73
           S+D  DSG Y+EWIP+FCSRFGHEYFCQVPT+FIEDDFN+T LSQEV +YRKALD ILDL
Sbjct: 7   SNDSSDSGNYEEWIPTFCSRFGHEYFCQVPTDFIEDDFNLTGLSQEVAYYRKALDTILDL 66

Query: 74  EAMSXXXXXXXXXXXXXXXXQEMQSNDGHDEGKRRNKSPVVNKSIIEHAAEQLYGLIHAR 133
           E+ S                +E + ND     K+ N + V  +SI+EH+AEQLYGLIHAR
Sbjct: 67  ESTSD---------------EEEEKNDASSNSKKDNDAHVT-RSIVEHSAEQLYGLIHAR 110

Query: 134 FILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRLYCPSCQDLYLP 193
           FILTK GLQAMAEKFD KEFGTCPRY+C  +QLLPCGLSDT+GK TVRLYCPSCQDLY+P
Sbjct: 111 FILTKAGLQAMAEKFDRKEFGTCPRYHCGSIQLLPCGLSDTLGKQTVRLYCPSCQDLYIP 170

Query: 194 QSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGFRINDEAVSGPRMK 253
           QSSR L LEGA+WGTSFPGVFLKHFKELE+YVE+K+KE+YELK+FGF I  EA+ GPRM+
Sbjct: 171 QSSRHLSLEGAYWGTSFPGVFLKHFKELEDYVEKKNKETYELKIFGFSIAKEAICGPRMQ 230

Query: 254 WLRQYPSTEEDWEEFAKCEFE 274
           WLRQYP T+E+WEEF KCEFE
Sbjct: 231 WLRQYPKTDEEWEEFKKCEFE 251

>AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH]
           complement(1052587..1053414) [828 bp, 275 aa]
          Length = 275

 Score =  384 bits (987), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 182/260 (70%), Positives = 205/260 (78%)

Query: 15  SDDEDSGAYDEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPHYRKALDLILDLE 74
           SD  +S  YDEWI SFCSRFGHE+FCQVPTEFIEDDFN+T LS EVPHYR+ALDLILDLE
Sbjct: 8   SDVSESSNYDEWITSFCSRFGHEFFCQVPTEFIEDDFNLTGLSAEVPHYRRALDLILDLE 67

Query: 75  AMSXXXXXXXXXXXXXXXXQEMQSNDGHDEGKRRNKSPVVNKSIIEHAAEQLYGLIHARF 134
           ++S                    SN              +NKSII+H AEQLYGLIHAR+
Sbjct: 68  SLSEEDEDGVAASAGAASNGGDHSNGTSVRQAAHADGQPINKSIIDHCAEQLYGLIHARY 127

Query: 135 ILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRLYCPSCQDLYLPQ 194
           ILTK GLQAMAEKFDHKEFGTCPRYYC GMQLLPCGLSDT+GK+TVRLYC SCQDLYLP 
Sbjct: 128 ILTKQGLQAMAEKFDHKEFGTCPRYYCGGMQLLPCGLSDTLGKNTVRLYCASCQDLYLPH 187

Query: 195 SSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGFRINDEAVSGPRMKW 254
           SSR LCLEGAFWGTSFPGVFLKHFKELE+YVE+K+K  Y L++FGF +  E++SGPRM+W
Sbjct: 188 SSRHLCLEGAFWGTSFPGVFLKHFKELEDYVEQKNKNVYRLRIFGFPVAKESISGPRMEW 247

Query: 255 LRQYPSTEEDWEEFAKCEFE 274
           LRQYPSTE +W+EF KCE+E
Sbjct: 248 LRQYPSTEAEWQEFEKCEYE 267

>Kwal_55.21570
          Length = 241

 Score =  169 bits (429), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 94/244 (38%), Positives = 136/244 (55%), Gaps = 35/244 (14%)

Query: 4   EFVEDYSRTGSSDDEDSGAYDE-WIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPH 62
           E VE  +R  +++  DS  Y E WI  F  R GHEYFC + TE+I D FN+ +L + V  
Sbjct: 5   EMVE--ARPDTAEGSDSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSVNK 62

Query: 63  YRKALDLILDLEAMSXXXXXXXXXXXXXXXXQEMQSNDGHDEGKRRNKSPVVNKSIIEHA 122
           + + +  ++D                        + +DG  E     +        +EH 
Sbjct: 63  FTQVIQYMVD------------------------ELDDGILEQMSSTRL-----EQLEHD 93

Query: 123 AEQLYGLIHARFILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRL 182
           A +LYGLIHAR+++T  GLQ M +K+   +FG CPR YCN   LLP GL D  GK  V+L
Sbjct: 94  ARKLYGLIHARYVITIKGLQKMLQKYKEADFGRCPRVYCNFQPLLPVGLHDVPGKDCVKL 153

Query: 183 YCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGFRI 242
           YC  C+DLY+P+SSR   ++GA++GTSFPG+FL+ F E+   V +   + Y  K+FGF +
Sbjct: 154 YCACCEDLYIPKSSRHSAIDGAYFGTSFPGMFLQAFPEM---VPKHPVKRYVPKIFGFEL 210

Query: 243 NDEA 246
           + +A
Sbjct: 211 HKQA 214

>Scas_699.43
          Length = 256

 Score =  169 bits (427), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 135/259 (52%), Gaps = 52/259 (20%)

Query: 2   SQEFVEDYSRTGSSDDEDSGA--------YDEWIPSFCSRFGHEYFCQVPTEFIEDDFNM 53
           ++  V++   T + D++DS           DEWI  F  + GHEYFC +  ++I D FN+
Sbjct: 4   AKTMVQEEGLTHTQDEDDSMGEVTDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNL 63

Query: 54  TSLSQEVPHYRKALDLILD------LEAMSXXXXXXXXXXXXXXXXQEMQSNDGHDEGKR 107
            +L + V  + + +  I+D      LE MS                              
Sbjct: 64  INLQKTVSKFSQVVQYIVDELDESILETMSNARLEQ------------------------ 99

Query: 108 RNKSPVVNKSIIEHAAEQLYGLIHARFILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLL 167
                      +E+ A + YGLIHAR+I+T  GLQ M +KF   +FG CPR YCN   LL
Sbjct: 100 -----------LENDARKFYGLIHARYIITVKGLQKMLDKFKDADFGRCPRVYCNYQPLL 148

Query: 168 PCGLSDTVGKHTVRLYCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVER 227
           P GL DT G   V+LYC SC+DLY+P+S R  C++GAF+GTSFPG+FL+ F E+   V +
Sbjct: 149 PVGLHDTPGMDCVKLYCASCEDLYIPKSMRHSCIDGAFFGTSFPGMFLQAFPEM---VPK 205

Query: 228 KSKESYELKVFGFRINDEA 246
              + Y  K+FGF ++ +A
Sbjct: 206 HPTKKYVPKIFGFELHKQA 224

>Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement
          Length = 273

 Score =  168 bits (426), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 92/235 (39%), Positives = 131/235 (55%), Gaps = 33/235 (14%)

Query: 13  GSSDDEDSGAYDE-WIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPHYRKALDLIL 71
            + D  DS  Y E WI  F  R GHEYFC V T++I D FN+ +L + V  + + +  I+
Sbjct: 39  ANHDTTDSSEYVEFWIDLFLGRKGHEYFCDVDTDYITDRFNLINLQKTVSRFTQVIQYIV 98

Query: 72  DLEAMSXXXXXXXXXXXXXXXXQEMQSNDGHDEGKRRNKSPVVNKSIIEHAAEQLYGLIH 131
           D                        + +D   E   R++        +E  A +LYGLIH
Sbjct: 99  D------------------------ELDDTALEQMSRSRL-----EQLESDARKLYGLIH 129

Query: 132 ARFILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRLYCPSCQDLY 191
           AR+I+T  GLQ M +K+   +FG CPR YCN   LLP GL D  G   V+LYCPSC+DLY
Sbjct: 130 ARYIITVKGLQKMLQKYRDADFGRCPRVYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLY 189

Query: 192 LPQSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGFRINDEA 246
           +P+SSR   ++GA++GTSFPG+FL+ F E+   V +   + Y  ++FGF ++ +A
Sbjct: 190 IPKSSRHSSIDGAYFGTSFPGMFLQAFPEM---VPKHPVKRYVPRIFGFELHKQA 241

>KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces
           cerevisiae YOR039w CKB2 casein kinase II beta chain,
           start by similarity
          Length = 260

 Score =  166 bits (419), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 128/232 (55%), Gaps = 33/232 (14%)

Query: 16  DDEDSGAYDE-WIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPHYRKALDLILDLE 74
           D  DSG Y E WI  F  + GHEYFC + TE+I D FN+ +L + V  +   +  ++D  
Sbjct: 29  DGSDSGEYVEYWIDLFLGKKGHEYFCDIDTEYITDRFNLINLQKTVSKFTTVVQYMVD-- 86

Query: 75  AMSXXXXXXXXXXXXXXXXQEMQSNDGHDEGKRRNKSPVVNKSIIEHAAEQLYGLIHARF 134
                                       +EG   + SP   + + E    +LYGLIHAR+
Sbjct: 87  --------------------------DLEEGIIESMSPARLEQL-ETDTRKLYGLIHARY 119

Query: 135 ILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRLYCPSCQDLYLPQ 194
           I+T  GLQ M +K+   +FG CPRY+CN   LLP GL D  G   V+LYCPSC+DLY P+
Sbjct: 120 IITAKGLQKMLQKYKAADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPK 179

Query: 195 SSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGFRINDEA 246
           SSR   ++GA++GTSFPG+FL+ F E+     +   + Y  KVFGF ++ +A
Sbjct: 180 SSRHSAIDGAYFGTSFPGMFLQGFPEM---CPKHPTKRYVPKVFGFDLHKQA 228

>ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH]
           (514602..515375) [774 bp, 257 aa]
          Length = 257

 Score =  163 bits (412), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 92/235 (39%), Positives = 130/235 (55%), Gaps = 37/235 (15%)

Query: 12  TGSSDDEDSGAYDEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPHYRKALDLIL 71
           TGSSD       + WI  F  + GHEYFC V TE+I D FN+ +L + V  + + +  ++
Sbjct: 28  TGSSD-----YVELWIDLFLGKKGHEYFCDVDTEYITDRFNLINLQKTVSKFTQVIQYMV 82

Query: 72  DLEAMSXXXXXXXXXXXXXXXXQEMQSNDGHDEGKRRNKSPVVNKSIIEHAAEQLYGLIH 131
           D                        + +D   E   R K      + +E  A +LYGLIH
Sbjct: 83  D------------------------ELDDTTLEAMSRTKL-----TQLEADARKLYGLIH 113

Query: 132 ARFILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRLYCPSCQDLY 191
           AR+I+T  GLQ M +K+   +F  CPR +CN   LLP GL D  G   V+LYCPSC+DLY
Sbjct: 114 ARYIITIKGLQKMLQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLY 173

Query: 192 LPQSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGFRINDEA 246
           +P+SSR   ++GA++GTSFPG+FL+ F E+   V +   + Y  KVFGF ++ +A
Sbjct: 174 IPKSSRHSSIDGAYFGTSFPGMFLQAFPEV---VPKHPTKRYVPKVFGFDLHKQA 225

>YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II
           Protein kinase CK2, regulatory (beta-prime) subunit [777
           bp, 258 aa]
          Length = 258

 Score =  162 bits (410), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 122/223 (54%), Gaps = 32/223 (14%)

Query: 24  DEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPHYRKALDLILDLEAMSXXXXXX 83
           D WI  F  R GHEYFC V  E+I D FN+ +L + V  +   +  I+D           
Sbjct: 36  DMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVSKFSYVVQYIVD----------- 84

Query: 84  XXXXXXXXXXQEMQSNDGHDEGKRRNKSPVVNKSIIEHAAEQLYGLIHARFILTKPGLQA 143
                       +  N  H   ++           +E  + +LYGLIHAR+I+T  GLQ 
Sbjct: 85  -------DLDDSILENMTHARLEQ-----------LESDSRKLYGLIHARYIITIKGLQK 126

Query: 144 MAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRLYCPSCQDLYLPQSSRFLCLEG 203
           M  K+   +FG CPR YCN  QLLP GL D  G   V+LYCPSC+DLY+P+SSR   ++G
Sbjct: 127 MYAKYKEADFGRCPRVYCNLQQLLPVGLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDG 186

Query: 204 AFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGFRINDEA 246
           A++GTSFPG+FL+ F ++   V +   + Y  K+FGF ++ +A
Sbjct: 187 AYFGTSFPGMFLQAFPDM---VPKHPTKRYVPKIFGFELHKQA 226

>CAGL0I00946g complement(76974..77753) highly similar to sp|P38930
           Saccharomyces cerevisiae YOR039w CKB2 casein kinase II
           beta chain, start by similarity
          Length = 259

 Score =  161 bits (407), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 126/232 (54%), Gaps = 33/232 (14%)

Query: 16  DDEDSGAYDE-WIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPHYRKALDLILDLE 74
           D  DS  Y + WI  F  R GHEYFC V  E+I D FN+ +L + V  + + +  I+D  
Sbjct: 28  DATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYITDRFNLINLQKTVSKFSQVVQYIVD-- 85

Query: 75  AMSXXXXXXXXXXXXXXXXQEMQSNDGHDEGKRRNKSPVVNKSIIEHAAEQLYGLIHARF 134
                               E+  +   +  K R +        +E+ A + YGLIHAR+
Sbjct: 86  --------------------ELDDSIVENMSKARLEQ-------LENDARKFYGLIHARY 118

Query: 135 ILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRLYCPSCQDLYLPQ 194
           I+T  GLQ M  K+   +FG C R YCN   LLP GL D  G  +V+LYCPSC+DLY P+
Sbjct: 119 IITVKGLQKMLSKYKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPK 178

Query: 195 SSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGFRINDEA 246
           SSR   ++GA++GTSFPG+FL+ F ++   V +     Y  K+FGF ++ +A
Sbjct: 179 SSRHSSIDGAYFGTSFPGMFLQAFPDM---VPKHPTARYVPKIFGFELHKQA 227

>Kwal_26.8595
          Length = 1034

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 6/52 (11%)

Query: 146 EKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRLYCPSCQDLYLPQSSR 197
           E+ +    G C +Y+ N M     G+SD     TV  Y PSC+ + L Q S+
Sbjct: 935 EEINETNNGDCEKYHVNDM-----GVSDA-DSGTVEQYIPSCEQIRLHQLSQ 980

>CAGL0F02959g 286337..288244 similar to sp|Q04049 Saccharomyces
           cerevisiae YDR419w RAD30 DNA repair protein,
           hypothetical start
          Length = 635

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 3/45 (6%)

Query: 103 DEGKRRNKSPVVNKSIIEHAAEQLYGLIHARF---ILTKPGLQAM 144
           DE + + K PVV  S +E  +++L+ ++   F   I  KP +Q+M
Sbjct: 353 DEAENKKKYPVVAGSKLEVLSDKLFSMVRGTFSTPITPKPLIQSM 397

>AFR027C [3219] [Homologous to ScYNL166C (BNI5) - SH]
           (487430..488350) [921 bp, 306 aa]
          Length = 306

 Score = 28.5 bits (62), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%)

Query: 218 FKELEEYVERKSKESYELKVF 238
             +L+EY++RKSKE YE+ V 
Sbjct: 264 LDKLQEYLDRKSKEKYEIGVL 284

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,315,597
Number of extensions: 387698
Number of successful extensions: 911
Number of sequences better than 10.0: 18
Number of HSP's gapped: 900
Number of HSP's successfully gapped: 25
Length of query: 274
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 174
Effective length of database: 13,134,309
Effective search space: 2285369766
Effective search space used: 2285369766
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)