Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL018C (JAC1)1841829641e-135
Scas_638.81881855939e-79
CAGL0A00297g1981855096e-66
Sklu_1768.31851794643e-59
Kwal_47.174511861814271e-53
KLLA0A04840g1981734108e-51
AGR164C2001634072e-50
Scas_488.336759880.002
Sklu_2442.134859850.003
CAGL0H03707g34959830.007
CAGL0L12276g45261810.013
AFR639W15656780.018
Kwal_0.20735356790.021
Sklu_1617.316560770.026
Scas_695.1432758780.030
YNL007C (SIS1)35258770.036
AAL008W34945750.069
YNL064C (YDJ1)40969750.081
Scas_711.4063553740.13
YMR214W (SCJ1)37759720.15
Scas_694.2041051720.16
ADL327W30557710.20
CAGL0J07370g62347720.21
Scas_532.261647720.22
YNL227C59047710.28
Scas_564.1*45755700.34
CAGL0F03729g36147700.35
Sklu_2257.642970690.45
Scas_715.2938752690.47
CAGL0J02750g38248680.54
AGR084C42749680.56
YLR090W (XDJ1)45951680.58
YJL073W (JEM1)64553680.58
Kwal_23.442059253680.59
AFR659W27368670.67
Scas_669.222451670.67
CAGL0I09526g29646670.69
Kwal_26.949542851670.74
AGL339C43052670.76
AFR507W47447670.79
ADR261C53359670.85
ABL194C55247670.85
KLLA0D04818g35449670.86
YMR161W (HLJ1)22447660.93
Kwal_14.245260751660.98
Sklu_2422.1067847661.00
KLLA0F19184g51249661.1
CAGL0H02827g65654651.3
KLLA0C07260g36849641.6
AER346W36756641.7
YOR254C (SEC63)66353642.1
KLLA0F03333g40949632.2
Scas_692.3437547632.4
KLLA0E01628g23148622.5
Kwal_26.887965653632.8
Sklu_2292.443250632.9
KLLA0E07876g49552623.2
CAGL0J09966g40747623.5
Sklu_2174.639348614.4
YER048C (CAJ1)39148605.2
KLLA0F13046g137945615.2
YIR004W (DJP1)43257605.3
ADR113W70838606.1
Kwal_56.2378241452606.7
YNL077W (APJ1)52848607.0
Kwal_47.1919830043597.0
KLLA0C09823g66952607.2
KLLA0D02420g21225588.0
CAGL0I04972g12776578.5
CAGL0D01584g30040588.7
Kwal_47.1813339346598.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL018C
         (182 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL018C (JAC1) [1955] chr7 complement(459113..459667) J-type cha...   375   e-135
Scas_638.8                                                            233   9e-79
CAGL0A00297g complement(30179..30775) similar to sp|P53193 Sacch...   200   6e-66
Sklu_1768.3 YGL018C, Contig c1768 3648-4205                           183   3e-59
Kwal_47.17451                                                         169   1e-53
KLLA0A04840g complement(430541..431137) similar to sp|P53193 Sac...   162   8e-51
AGR164C [4475] [Homologous to ScYGL018C (JAC1) - SH] (1053441..1...   161   2e-50
Scas_488.3                                                             39   0.002
Sklu_2442.1 YNL007C, Contig c2442 2508-3554 reverse complement         37   0.003
CAGL0H03707g complement(341230..342279) highly similar to sp|P25...    37   0.007
CAGL0L12276g 1327171..1328529 similar to tr|Q12014 Saccharomyces...    36   0.013
AFR639W [3831] [Homologous to ScYJR097W - NSH] complement(160398...    35   0.018
Kwal_0.207                                                             35   0.021
Sklu_1617.3 YJR097W, Contig c1617 3142-3639                            34   0.026
Scas_695.14                                                            35   0.030
YNL007C (SIS1) [4578] chr14 complement(618506..619564) Protein r...    34   0.036
AAL008W [179] [Homologous to ScYNL007C (SIS1) - SH] complement(3...    33   0.069
YNL064C (YDJ1) [4526] chr14 complement(505866..507095) Protein i...    33   0.081
Scas_711.40                                                            33   0.13 
YMR214W (SCJ1) [4170] chr13 (695349..696482) Homolog of E. coli ...    32   0.15 
Scas_694.20                                                            32   0.16 
ADL327W [1414] [Homologous to ScYPR061C - SH] complement(123853....    32   0.20 
CAGL0J07370g 711363..713234 similar to sp|P53863 Saccharomyces c...    32   0.21 
Scas_532.2                                                             32   0.22 
YNL227C (YNL227C) [4378] chr14 complement(220658..222430) Member...    32   0.28 
Scas_564.1*                                                            32   0.34 
CAGL0F03729g complement(362972..364057) similar to sp|P25303 Sac...    32   0.35 
Sklu_2257.6 YIR004W, Contig c2257 8880-10169 reverse complement        31   0.45 
Scas_715.29                                                            31   0.47 
CAGL0J02750g complement(270406..271554) highly similar to sp|P39...    31   0.54 
AGR084C [4394] [Homologous to ScYLR090W (XDJ1) - SH] (885026..88...    31   0.56 
YLR090W (XDJ1) [3505] chr12 (320702..322081) Homolog of E. coli ...    31   0.58 
YJL073W (JEM1) [2839] chr10 (303097..305034) DnaJ-like protein r...    31   0.58 
Kwal_23.4420                                                           31   0.59 
AFR659W [3852] [Homologous to ScYGL128C (CWC23) - NSH] complemen...    30   0.67 
Scas_669.2                                                             30   0.67 
CAGL0I09526g 911127..912017 weakly similar to sp|P52868 Saccharo...    30   0.69 
Kwal_26.9495                                                           30   0.74 
AGL339C [3973] [Homologous to ScYGR285C (ZUO1) - SH] (77330..786...    30   0.76 
AFR507W [3699] [Homologous to ScYFL016C (MDJ1) - SH] complement(...    30   0.79 
ADR261C [2002] [Homologous to NOHBY] (1153772..1155373) [1602 bp...    30   0.85 
ABL194C [398] [Homologous to ScYNL227C - SH] (42210..43868) [165...    30   0.85 
KLLA0D04818g complement(411615..412679) similar to sp|P25294 Sac...    30   0.86 
YMR161W (HLJ1) [4116] chr13 (577717..578391) Endoplasmic reticul...    30   0.93 
Kwal_14.2452                                                           30   0.98 
Sklu_2422.10 YNL227C, Contig c2422 20011-22047 reverse complement      30   1.00 
KLLA0F19184g 1778227..1779765 weakly similar to sp|P39102 Saccha...    30   1.1  
CAGL0H02827g 261006..262976 similar to sp|P40358 Saccharomyces c...    30   1.3  
KLLA0C07260g complement(632987..634093) similar to sp|P25303 Sac...    29   1.6  
AER346W [2847] [Homologous to ScYMR214W (SCJ1) - SH] complement(...    29   1.7  
YOR254C (SEC63) [5042] chr15 complement(805031..807022) Componen...    29   2.1  
KLLA0F03333g complement(313991..315220) similar to sp|P25491 Sac...    29   2.2  
Scas_692.34                                                            29   2.4  
KLLA0E01628g 155088..155783 weakly similar to sp|P48353 Saccharo...    28   2.5  
Kwal_26.8879                                                           29   2.8  
Sklu_2292.4 YGR285C, Contig c2292 5220-6518                            29   2.9  
KLLA0E07876g complement(709306..710793) weakly similar to sp|P53...    28   3.2  
CAGL0J09966g complement(976568..977791) highly similar to sp|P25...    28   3.5  
Sklu_2174.6 YER048C, Contig c2174 7478-8659                            28   4.4  
YER048C (CAJ1) [1475] chr5 complement(246981..248156) Homolog of...    28   5.2  
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    28   5.2  
YIR004W (DJP1) [2669] chr9 (363218..364516) Protein required for...    28   5.3  
ADR113W [1854] [Homologous to ScYOL095C (HMI1) - SH] complement(...    28   6.1  
Kwal_56.23782                                                          28   6.7  
YNL077W (APJ1) [4513] chr14 (481390..482976) Protein induced by ...    28   7.0  
Kwal_47.19198                                                          27   7.0  
KLLA0C09823g 848641..850650 similar to sp|P14906 Saccharomyces c...    28   7.2  
KLLA0D02420g complement(206544..207182) some similarities with s...    27   8.0  
CAGL0I04972g complement(454872..455255) similar to sp|P40060 Sac...    27   8.5  
CAGL0D01584g 167879..168781 similar to tr|Q12350 Saccharomyces c...    27   8.7  
Kwal_47.18133                                                          27   8.9  

>YGL018C (JAC1) [1955] chr7 complement(459113..459667) J-type
           chaperone protein, may be involved in assembly of
           mitochondrial iron-sulfur proteins [555 bp, 184 aa]
          Length = 184

 Score =  375 bits (964), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 182/182 (100%), Positives = 182/182 (100%)

Query: 1   MLKYLVQRRFTSTFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQGSEQSS 60
           MLKYLVQRRFTSTFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQGSEQSS
Sbjct: 1   MLKYLVQRRFTSTFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQGSEQSS 60

Query: 61  TLNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDD 120
           TLNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDD
Sbjct: 61  TLNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDD 120

Query: 121 EAGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPGKQL 180
           EAGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPGKQL
Sbjct: 121 EAGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPGKQL 180

Query: 181 EM 182
           EM
Sbjct: 181 EM 182

>Scas_638.8
          Length = 188

 Score =  233 bits (593), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 142/185 (76%), Gaps = 3/185 (1%)

Query: 1   MLKYLVQRRFTSTFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQGSE--- 57
           M ++L Q+R+ +TFYELFP+TFP K PIW++DQS+LRKEYR LQAQHHPDMAQ   E   
Sbjct: 1   MKRFLTQKRYLTTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDT 60

Query: 58  QSSTLNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQ 117
            SS LN+AYH LK+PL RSQY++KLL N+DLTQ+    ++T SDP++L+KV++IH++L  
Sbjct: 61  HSSLLNKAYHVLKEPLTRSQYLIKLLDNVDLTQDSVKEKITQSDPEILMKVIEIHEQLMD 120

Query: 118 MDDEAGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPG 177
           +D E  VK + ++N ER+  IE QL   +  KD+  A+KLTVELKYW N+A A K+WAPG
Sbjct: 121 IDTEEDVKKIRRENTERMATIEGQLENAFKKKDFETAIKLTVELKYWSNVAYAIKEWAPG 180

Query: 178 KQLEM 182
           K++++
Sbjct: 181 KEIQI 185

>CAGL0A00297g complement(30179..30775) similar to sp|P53193
           Saccharomyces cerevisiae YGL018c JAC1 molecular
           chaperone, hypothetical start
          Length = 198

 Score =  200 bits (509), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 92/185 (49%), Positives = 135/185 (72%), Gaps = 4/185 (2%)

Query: 2   LKYLVQRRFTSTFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQ----GSE 57
           ++ ++QRR+  ++YELFP TFP   P W +D  +LRKEYR+LQA+ HPD  Q+     SE
Sbjct: 12  IRQVLQRRWIVSYYELFPGTFPDSQPRWDVDLGKLRKEYRKLQAEVHPDKIQKEQEADSE 71

Query: 58  QSSTLNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQ 117
           QSS LN+AYH LKDPL RSQ+M+++L+++DLT +  + E T  DP+LL+ V+D+H++L  
Sbjct: 72  QSSLLNKAYHALKDPLTRSQHMIQILKDVDLTVDSVAREYTQMDPELLMDVMDVHEQLLD 131

Query: 118 MDDEAGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPG 177
            +    V+ +EK NK+RI+ IEA+L +CY++K+Y  A+ LT  LKYW N+A A KDWAPG
Sbjct: 132 ANSRDEVREIEKVNKQRIEKIEAELKECYDNKEYERAINLTARLKYWKNVASAVKDWAPG 191

Query: 178 KQLEM 182
           K +++
Sbjct: 192 KPIDL 196

>Sklu_1768.3 YGL018C, Contig c1768 3648-4205
          Length = 185

 Score =  183 bits (464), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 127/179 (70%), Gaps = 7/179 (3%)

Query: 9   RFTST--FYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQGS---EQSSTLN 63
           RF ST  FY+LFPKTFPK  P WT+D  +LR+EYR+LQA  HPD   QGS   + SSTLN
Sbjct: 7   RFYSTKNFYQLFPKTFPKGKPQWTVDLRQLRQEYRKLQAISHPDA--QGSTTNDDSSTLN 64

Query: 64  QAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDDEAG 123
           +AYHTL+ PL RSQY+L+   +IDL+++Q ++E+T  DP+LL+ VLDIH++L  +  E  
Sbjct: 65  KAYHTLRQPLTRSQYLLQTQAHIDLSKDQVASEITQQDPELLMTVLDIHEQLESITTEED 124

Query: 124 VKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPGKQLEM 182
           +  + K+NK+R++ ++  L  CY + D+  A +LT+ELKYW NL  A K+W PGK + +
Sbjct: 125 LHQISKENKQRMERVQELLDDCYANHDFETAARLTIELKYWVNLDNAIKEWEPGKPVHL 183

>Kwal_47.17451
          Length = 186

 Score =  169 bits (427), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 121/181 (66%), Gaps = 3/181 (1%)

Query: 5   LVQRRFTS--TFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQG-SEQSST 61
           LV RR  S  + Y+LFPKTF      W +D  RLR EYR+LQA  HPD    G + +SS 
Sbjct: 4   LVPRRLYSVRSAYQLFPKTFASGNMRWDVDLRRLRMEYRELQAAEHPDTNSNGDASRSSE 63

Query: 62  LNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDDE 121
           LN AY TL+ PL R++Y+LK    IDL  EQT+  +   +P+LL++VLD+H++L  M  E
Sbjct: 64  LNHAYQTLRQPLLRAEYILKNQAGIDLRNEQTAQGIAQQNPELLMQVLDVHEQLESMTTE 123

Query: 122 AGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPGKQLE 181
             V  + ++N+ER+++IE +LG  +  +D+ AA +LTVEL+YW +L +A K+W PG++LE
Sbjct: 124 EDVAAVARENQERMREIEQRLGAAFEKQDWDAATQLTVELRYWTSLDRAVKEWEPGQRLE 183

Query: 182 M 182
           M
Sbjct: 184 M 184

>KLLA0A04840g complement(430541..431137) similar to sp|P53193
           Saccharomyces cerevisiae YGL018c JAC1 molecular
           chaperone singleton, start by similarity
          Length = 198

 Score =  162 bits (410), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 116/173 (67%), Gaps = 2/173 (1%)

Query: 9   RFTSTFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQGSEQ-SSTLNQAYH 67
           + + T ++ FPKTF    P W +D  +LRKEYRQLQ++HHPD+     +  SS LN+AY 
Sbjct: 23  KTSKTLFQWFPKTFTSGKPQWEVDLKKLRKEYRQLQSEHHPDVITSTVDNVSSELNRAYK 82

Query: 68  TLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDDEAGVKLL 127
           TL  PL RSQY+L L   IDLTQ+  + +V + DPQLL+ VLD+H++L  ++ E  +K +
Sbjct: 83  TLSKPLPRSQYILSL-HGIDLTQDGEAQKVMSKDPQLLMLVLDVHEQLEDINSEEDLKQI 141

Query: 128 EKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPGKQL 180
           E++NK+R+ + E +L + +  +D+  A  LTVEL+YW NL  A K+W PGK +
Sbjct: 142 EQENKQRLNECEQKLKKAHESQDWETAAMLTVELRYWSNLDNAIKEWEPGKPI 194

>AGR164C [4475] [Homologous to ScYGL018C (JAC1) - SH]
           (1053441..1054043) [603 bp, 200 aa]
          Length = 200

 Score =  161 bits (407), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 70/163 (42%), Positives = 109/163 (66%), Gaps = 1/163 (0%)

Query: 15  YELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQGSEQSSTLNQAYHTLKDPLR 74
           +  FP TFP   P W +D  RLR+EYRQLQ QHHPD+A    E +  LN+AY TL  PL 
Sbjct: 32  FRAFPATFPSGEPQWDVDVRRLRREYRQLQGQHHPDVAGGTDEAAQRLNRAYGTLVRPLA 91

Query: 75  RSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDDEAGVKLLEKQNKER 134
           R+Q++L   + +D+T + T+ E+   DP LL++VLD+H++L +++ EA V+ L ++N+ R
Sbjct: 92  RAQFLLAR-QGVDVTADATAQEIMQRDPGLLMRVLDVHEQLEELESEADVRRLREENRAR 150

Query: 135 IQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPG 177
           +  +EA+LG+ +  + +  A +L VEL+YW N+  A ++W PG
Sbjct: 151 MAGVEAELGRAFAARAWDRAAQLAVELRYWDNVESAVREWEPG 193

>Scas_488.3
          Length = 367

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 30 TIDQSRLRKEYRQLQAQHHPDMAQQGSEQSSTLNQAYHTLKDPLRRS---QYMLKLLRN 85
          T ++  L+K YR+   ++HPD     +E+   +++A+  L DP +R    QY L+  RN
Sbjct: 16 TANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDQYGLEAARN 74

>Sklu_2442.1 YNL007C, Contig c2442 2508-3554 reverse complement
          Length = 348

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 30 TIDQSRLRKEYRQLQAQHHPDMAQQGSEQSSTLNQAYHTLKDPLRRS---QYMLKLLRN 85
          + D+  L+K YR+   ++HPD     +E+   +++A+  L DP +R     Y L+  RN
Sbjct: 16 SADEGELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDSYGLEAARN 74

>CAGL0H03707g complement(341230..342279) highly similar to
          sp|P25294 Saccharomyces cerevisiae YNL007c SIS1 heat
          shock protein, start by similarity
          Length = 349

 Score = 36.6 bits (83), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 30 TIDQSRLRKEYRQLQAQHHPDMAQQGSEQSSTLNQAYHTLKDPLRR---SQYMLKLLRN 85
          + ++  ++K YR+   ++HPD     +E+   +++A+  L DP +R    QY L+  RN
Sbjct: 16 SANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQKREVYDQYGLEAARN 74

>CAGL0L12276g 1327171..1328529 similar to tr|Q12014 Saccharomyces
          cerevisiae YLR090w, hypothetical start
          Length = 452

 Score = 35.8 bits (81), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 11/61 (18%)

Query: 33 QSRLRKEYRQLQAQHHPDMAQ--QGSEQSST---------LNQAYHTLKDPLRRSQYMLK 81
          Q  +++ YR+L  +HHPD A+  +G E SS          +  AY  L D   R++Y  K
Sbjct: 15 QDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLSDASLRAEYDQK 74

Query: 82 L 82
          L
Sbjct: 75 L 75

>AFR639W [3831] [Homologous to ScYJR097W - NSH]
          complement(1603985..1604455) [471 bp, 156 aa]
          Length = 156

 Score = 34.7 bits (78), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 36 LRKEYRQLQAQHHPDMAQQGSEQSST--LNQAYHTLKDPLRRSQYMLKLLRNIDLT 89
          +R+ YRQ   + HPD  Q G ++ +   + QAY  L DP +RS Y  +L   I  T
Sbjct: 20 VRQAYRQRLLEAHPDK-QGGVDKGAVTRIQQAYRVLSDPTQRSAYDGELAVQIAAT 74

>Kwal_0.207
          Length = 353

 Score = 35.0 bits (79), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 33 QSRLRKEYRQLQAQHHPDMAQQGSEQSSTLNQAYHTLKDPLRR---SQYMLKLLRN 85
          ++ L+K YR+   ++HPD     +E+   +++A+  L DP +R     Y L+  RN
Sbjct: 19 ETELKKGYRKAALKYHPDKPSGDAEKFKEISEAFEILNDPQKREVYDTYGLEAARN 74

>Sklu_1617.3 YJR097W, Contig c1617 3142-3639
          Length = 165

 Score = 34.3 bits (77), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 8/60 (13%)

Query: 34 SRLRKEYRQLQAQHHPDM--AQQGSEQSST------LNQAYHTLKDPLRRSQYMLKLLRN 85
          S++++ YR+     HPD    QQ   Q+ T      + QAY  L DP RR QY  +L ++
Sbjct: 18 SQIKRAYRERLLDTHPDKKNGQQARSQAHTQASIEQIQQAYRVLADPTRREQYDAELAKS 77

>Scas_695.14
          Length = 327

 Score = 34.7 bits (78), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 30 TIDQSRLRKEYRQLQAQHHPDMAQQGSEQSSTLNQAYHTLKDPLRR---SQYMLKLLR 84
          T ++  L+K YR+   ++HPD     +E+   +++A+  L DP  R    QY L+  R
Sbjct: 16 TANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNTREVYDQYGLEAAR 73

>YNL007C (SIS1) [4578] chr14 complement(618506..619564) Protein
          required for initiation of translation, member of DnaJ
          family of protein chaperones [1059 bp, 352 aa]
          Length = 352

 Score = 34.3 bits (77), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 30 TIDQSRLRKEYRQLQAQHHPDMAQQGSEQSSTLNQAYHTLKDPLRR---SQYMLKLLR 84
          + ++  L+K YR+   ++HPD     +E+   +++A+  L DP +R    QY L+  R
Sbjct: 16 SANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDQYGLEAAR 73

>AAL008W [179] [Homologous to ScYNL007C (SIS1) - SH]
          complement(327127..328176) [1050 bp, 349 aa]
          Length = 349

 Score = 33.5 bits (75), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (57%)

Query: 34 SRLRKEYRQLQAQHHPDMAQQGSEQSSTLNQAYHTLKDPLRRSQY 78
          + L+K YR+   ++HPD     +E+   +++A+  L DP +R  Y
Sbjct: 20 AELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPNKREVY 64

>YNL064C (YDJ1) [4526] chr14 complement(505866..507095) Protein
          involved in protein import into mitochondria and ER,
          homolog of E. coli DnaJ [1230 bp, 409 aa]
          Length = 409

 Score = 33.5 bits (75), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 35/69 (50%), Gaps = 9/69 (13%)

Query: 12 STFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDM--AQQGSEQSSTLNQAYHTL 69
          + FY++        +P+   D   ++K YR+   ++HPD   +++ +E+    + AY  L
Sbjct: 5  TKFYDIL------GVPVTATD-VEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEIL 57

Query: 70 KDPLRRSQY 78
           DP +R  Y
Sbjct: 58 SDPEKRDIY 66

>Scas_711.40
          Length = 635

 Score = 33.1 bits (74), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 8/53 (15%)

Query: 36  LRKEYRQLQAQHHPDMAQQGSEQS--------STLNQAYHTLKDPLRRSQYML 80
           +RK Y  L  + HPD   Q SE+         S +N+AY  L D  +R++Y L
Sbjct: 543 IRKSYLNLTKKFHPDKQGQLSEKEQKKIQEKMSEINEAYEVLSDETKRNEYDL 595

>YMR214W (SCJ1) [4170] chr13 (695349..696482) Homolog of E. coli
          DnaJ, functions in the endoplasmic reticulum by
          interaction with Kar2p [1134 bp, 377 aa]
          Length = 377

 Score = 32.3 bits (72), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 9/59 (15%)

Query: 28 IWTIDQSRLRKE----YRQLQAQHHPDMAQQGSEQSS----TLNQAYHTLKDPLRRSQY 78
          I  ID+    KE    YRQL  ++HPD    GSE++      + +AY  L DP ++  Y
Sbjct: 27 ILEIDKDATEKEIKSAYRQLSKKYHPD-KNAGSEEAHQKFIEVGEAYDVLSDPEKKKIY 84

>Scas_694.20
          Length = 410

 Score = 32.3 bits (72), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 30 TIDQSRLRKEYRQLQAQHHPDM--AQQGSEQSSTLNQAYHTLKDPLRRSQY 78
          T   S ++K YR+   ++HPD    ++G+E+   ++ AY  L D  +R  Y
Sbjct: 16 TAGDSEIKKAYRKSALKYHPDKNPTEEGAEKFKEVSAAYEILSDSEKREIY 66

>ADL327W [1414] [Homologous to ScYPR061C - SH]
           complement(123853..124770) [918 bp, 305 aa]
          Length = 305

 Score = 32.0 bits (71), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 9/57 (15%)

Query: 31  IDQSRLRKEYRQLQAQHHPD---MAQQGSEQSSTL------NQAYHTLKDPLRRSQY 78
           +D  +L+K Y +L   +HPD    AQQG  +   L      N+AY  L D  RR  Y
Sbjct: 103 VDARQLKKRYHELAKLYHPDTAGAAQQGLGEHERLRRFKLVNEAYALLSDASRRRMY 159

>CAGL0J07370g 711363..713234 similar to sp|P53863 Saccharomyces
          cerevisiae YNL227c, start by similarity
          Length = 623

 Score = 32.3 bits (72), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 4/47 (8%)

Query: 36 LRKEYRQLQAQHHPDMAQQGSEQSST----LNQAYHTLKDPLRRSQY 78
          L+K YR+   Q+HPD      E+++T    +  AY  L DP  R+ Y
Sbjct: 20 LKKAYRRKALQYHPDKNPDNVEEATTIFAEIRAAYEVLSDPQERAWY 66

>Scas_532.2
          Length = 616

 Score = 32.3 bits (72), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 4/47 (8%)

Query: 36 LRKEYRQLQAQHHPDM----AQQGSEQSSTLNQAYHTLKDPLRRSQY 78
          L+K YR+   Q HPD       + +E  +T+  AY  L DP  R+ Y
Sbjct: 20 LKKAYRKKALQFHPDKNPDNVDEATEIFATIRSAYEVLSDPQERAWY 66

>YNL227C (YNL227C) [4378] chr14 complement(220658..222430) Member
          of the DnaJ family of protein chaperones, contains two
          C2H2-type zinc finger domains [1773 bp, 590 aa]
          Length = 590

 Score = 32.0 bits (71), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 4/47 (8%)

Query: 36 LRKEYRQLQAQHHPDM----AQQGSEQSSTLNQAYHTLKDPLRRSQY 78
          L+K YR+   Q+HPD      ++ +++ + +  AY  L DP  R+ Y
Sbjct: 20 LKKAYRKKALQYHPDKNPDNVEEATQKFAVIRAAYEVLSDPQERAWY 66

>Scas_564.1*
          Length = 457

 Score = 31.6 bits (70), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 8/55 (14%)

Query: 34  SRLRKEYRQLQAQHHPDMA-------QQGSE-QSSTLNQAYHTLKDPLRRSQYML 80
           S ++K YR+L  QHHPD         ++ SE +   ++ AY  L D  +R+ Y L
Sbjct: 357 SDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDEDKRAHYDL 411

>CAGL0F03729g complement(362972..364057) similar to sp|P25303
          Saccharomyces cerevisiae YMR214w SCJ1, hypothetical
          start
          Length = 361

 Score = 31.6 bits (70), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 5/47 (10%)

Query: 36 LRKEYRQLQAQHHPDMAQQGSEQSS----TLNQAYHTLKDPLRRSQY 78
          ++  YRQL  ++HPD    G E++      + +AY  L DP +R  Y
Sbjct: 36 IKSAYRQLSKKYHPD-KNPGDEEAHHKFIEVGEAYDILGDPEKRKTY 81

>Sklu_2257.6 YIR004W, Contig c2257 8880-10169 reverse complement
          Length = 429

 Score = 31.2 bits (69), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 10/70 (14%)

Query: 12 STFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQ---GSEQSSTLNQAYHT 68
          +T+Y+L   + P   PI       ++K YR+   Q HPD        +E+  +++QAY  
Sbjct: 5  TTYYDLLGVS-PNARPI------EIKKAYRKKSVQEHPDKNPNDPSATERFQSISQAYQV 57

Query: 69 LKDPLRRSQY 78
          L +   R++Y
Sbjct: 58 LSNEELRTKY 67

>Scas_715.29
          Length = 387

 Score = 31.2 bits (69), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 30 TIDQSRLRKEYRQLQAQHHPDMAQQGSEQSST---LNQAYHTLKDPLRRSQY 78
          T   + ++K YR+   Q HPD      E  +    + +AY  L DP  RS+Y
Sbjct: 16 TATPAEIKKAYRRRAMQTHPDKHPDDPEAQAKFQEVGEAYQVLSDPGLRSRY 67

>CAGL0J02750g complement(270406..271554) highly similar to
          sp|P39101 Saccharomyces cerevisiae YER048c CAJ1, start
          by similarity
          Length = 382

 Score = 30.8 bits (68), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 3/48 (6%)

Query: 34 SRLRKEYRQLQAQHHPDMAQQGSEQSS---TLNQAYHTLKDPLRRSQY 78
          S ++K YR++    HPD      E  +    + +AY  L DP  R QY
Sbjct: 20 SEIKKAYRKMAMLTHPDKHPDDPEAQAKFQAVGEAYQVLNDPALRKQY 67

>AGR084C [4394] [Homologous to ScYLR090W (XDJ1) - SH]
          (885026..886309) [1284 bp, 427 aa]
          Length = 427

 Score = 30.8 bits (68), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 6/49 (12%)

Query: 36 LRKEYRQLQAQHHPDMAQQGSEQSST------LNQAYHTLKDPLRRSQY 78
          +++ YRQL  ++HPD     SE+ ++      ++ AY  L D  +R++Y
Sbjct: 20 VKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKRAEY 68

>YLR090W (XDJ1) [3505] chr12 (320702..322081) Homolog of E. coli
          DnaJ [1380 bp, 459 aa]
          Length = 459

 Score = 30.8 bits (68), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 6/51 (11%)

Query: 36 LRKEYRQLQAQHHPD-MAQQGSEQSS-----TLNQAYHTLKDPLRRSQYML 80
          ++  YR+L  +HHPD    Q S++ +      +  AY  L DP ++S Y L
Sbjct: 25 IKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKKSHYDL 75

>YJL073W (JEM1) [2839] chr10 (303097..305034) DnaJ-like protein
           required for the nuclear fusion step of karyogamy [1938
           bp, 645 aa]
          Length = 645

 Score = 30.8 bits (68), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 8/53 (15%)

Query: 36  LRKEYRQLQAQHHPDMAQQGS--------EQSSTLNQAYHTLKDPLRRSQYML 80
           +RK Y  L  ++HPD  +           E  S +N+AY TL D  +R +Y L
Sbjct: 554 IRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETLSDDDKRKEYDL 606

>Kwal_23.4420
          Length = 592

 Score = 30.8 bits (68), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 30 TIDQSRLRKEYRQLQAQHHPDMAQQGSEQS----STLNQAYHTLKDPLRRSQY 78
          T   + L+K YR+    +HPD  +   E++    +T+  AY  L DP  R+ Y
Sbjct: 14 TASDADLKKAYRKKALVYHPDKNRDNVEEATAIFATIRAAYEVLADPQERAWY 66

>AFR659W [3852] [Homologous to ScYGL128C (CWC23) - NSH]
          complement(1640183..1641004) [822 bp, 273 aa]
          Length = 273

 Score = 30.4 bits (67), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 14 FYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQGSEQSS---TLNQAYHTLK 70
           Y L   +      +  +D ++LR ++R+L  ++HPD  +  ++Q+    ++ +AY  L 
Sbjct: 16 LYALLEVSISSPEELEAVDAAQLRAQFRRLALRYHPDKRRDDTQQNDKFVSVQKAYDILS 75

Query: 71 DPLRRSQY 78
          +   R+ Y
Sbjct: 76 NSSLRATY 83

>Scas_669.2
          Length = 224

 Score = 30.4 bits (67), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 30 TIDQSRLRKEYRQLQAQHHPDMA--QQGSEQSSTLNQAYHTLKDPLRRSQY 78
          T + + ++K YR+L  + HPD     + SE    +N+A+  L D  +R  Y
Sbjct: 32 TANDNEIKKAYRKLAVKLHPDKNPHPKASEAFKIINRAFEVLSDVEKRQLY 82

>CAGL0I09526g 911127..912017 weakly similar to sp|P52868
          Saccharomyces cerevisiae YGL128c, hypothetical start
          Length = 296

 Score = 30.4 bits (67), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 4/46 (8%)

Query: 36 LRKEYRQLQAQHHPDMAQQGSE---QSSTLNQAYHTLKDPLRRSQY 78
          L+K+YR+L  ++HPD    G E   +   LN A   L DP ++++Y
Sbjct: 38 LKKQYRKLSLRYHPD-KNPGPEYIDRFHLLNLAITVLADPAKKAEY 82

>Kwal_26.9495
          Length = 428

 Score = 30.4 bits (67), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 5/51 (9%)

Query: 33  QSRLRKEYRQLQAQHHPD--MAQQGSEQSS---TLNQAYHTLKDPLRRSQY 78
           ++++ K +R+   +HHPD   A  G EQ      + +AY TL D  +R+QY
Sbjct: 112 EAQIIKAHRKQVLKHHPDKKSASGGLEQDGFFKIIQKAYETLTDSNKRAQY 162

>AGL339C [3973] [Homologous to ScYGR285C (ZUO1) - SH] (77330..78622)
           [1293 bp, 430 aa]
          Length = 430

 Score = 30.4 bits (67), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 6/52 (11%)

Query: 33  QSRLRKEYRQLQAQHHPD---MAQQGSEQSS---TLNQAYHTLKDPLRRSQY 78
           Q+++ K +R+   +HHPD    A    E+ +    + +A+ TL DP++R+Q+
Sbjct: 113 QAQIIKAHRKQVLKHHPDKKSAAGASLEEDNFFKIIQKAFETLTDPVKRAQF 164

>AFR507W [3699] [Homologous to ScYFL016C (MDJ1) - SH]
           complement(1347615..1349039) [1425 bp, 474 aa]
          Length = 474

 Score = 30.4 bits (67), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 34  SRLRKEYRQLQAQHHPDMAQ-QGSEQS-STLNQAYHTLKDPLRRSQY 78
           S+++K Y +L  Q HPD+ + +G+E+    L  AY  L D  +R QY
Sbjct: 55  SQIKKAYYKLAKQFHPDINKDEGAEKKFHDLQNAYEILSDENKRRQY 101

>ADR261C [2002] [Homologous to NOHBY] (1153772..1155373) [1602 bp,
           533 aa]
          Length = 533

 Score = 30.4 bits (67), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%)

Query: 101 DPQLLLKVLDIHDELSQMDDEAGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTV 159
           D  +L K+++   EL +MDD   VKL   +   R+QDI  +L       + A A  + +
Sbjct: 354 DRHILTKLIEFGPELVRMDDPNTVKLSWNETHFRLQDIANELKLFMAQSNEAVASGVNI 412

>ABL194C [398] [Homologous to ScYNL227C - SH] (42210..43868) [1659
          bp, 552 aa]
          Length = 552

 Score = 30.4 bits (67), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 4/47 (8%)

Query: 36 LRKEYRQLQAQHHPDM----AQQGSEQSSTLNQAYHTLKDPLRRSQY 78
          L+K YR+   Q+HPD      QQ +E  +++  AY  L D   R+ Y
Sbjct: 20 LKKAYRRKALQYHPDKNIGNVQQATEIFASIRAAYEVLSDAQERAWY 66

>KLLA0D04818g complement(411615..412679) similar to sp|P25294
          Saccharomyces cerevisiae YNL007c SIS1 heat shock
          protein, start by similarity
          Length = 354

 Score = 30.4 bits (67), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 27/49 (55%)

Query: 30 TIDQSRLRKEYRQLQAQHHPDMAQQGSEQSSTLNQAYHTLKDPLRRSQY 78
          +  ++ ++K YR+   ++HPD     +E+   +++A+  L D  +R  Y
Sbjct: 16 SAGEAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDAQKREVY 64

>YMR161W (HLJ1) [4116] chr13 (577717..578391) Endoplasmic
          reticulum membrane protein, member of the DnaJ family
          of putative protein chaperones [675 bp, 224 aa]
          Length = 224

 Score = 30.0 bits (66), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 34 SRLRKEYRQLQAQHHPDMAQ--QGSEQSSTLNQAYHTLKDPLRRSQY 78
          S ++K YR+L  + HPD     +  E    +N+A+  L +  +RS Y
Sbjct: 35 SEIKKAYRKLAIKLHPDKNSHPKAGEAFKVINRAFEVLSNEEKRSIY 81

>Kwal_14.2452
          Length = 607

 Score = 30.0 bits (66), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 8/51 (15%)

Query: 36  LRKEYRQLQAQHHPDMAQQGS--------EQSSTLNQAYHTLKDPLRRSQY 78
           +RK Y  +  ++HPD   Q S        E+ S +N+AY  L D  +R +Y
Sbjct: 521 IRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEILSDEGKRKEY 571

>Sklu_2422.10 YNL227C, Contig c2422 20011-22047 reverse complement
          Length = 678

 Score = 30.0 bits (66), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 4/47 (8%)

Query: 36 LRKEYRQLQAQHHPDMAQQGSEQSS----TLNQAYHTLKDPLRRSQY 78
          L+K YR+   ++HPD      E+++    T+  AY  L DP  R+ Y
Sbjct: 20 LKKAYRKKALKYHPDKNPNNVEEATQAFATIRLAYEVLSDPQERAWY 66

>KLLA0F19184g 1778227..1779765 weakly similar to sp|P39102
           Saccharomyces cerevisiae YLR090w XDJ1, start by
           similarity
          Length = 512

 Score = 30.0 bits (66), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 6/49 (12%)

Query: 36  LRKEYRQLQAQHHPDMAQQGSEQSST------LNQAYHTLKDPLRRSQY 78
           +RK YR+L  ++HPD     +E+ ++      +  AY  L DP  +S+Y
Sbjct: 88  IRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELKSRY 136

>CAGL0H02827g 261006..262976 similar to sp|P40358 Saccharomyces
           cerevisiae YJL073w JEM, start by similarity
          Length = 656

 Score = 29.6 bits (65), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 13/54 (24%)

Query: 36  LRKEYRQLQAQHHPDMAQQGSEQS-----------STLNQAYHTLKDPLRRSQY 78
           +RK Y  L  ++HPD  +QG + S           S +N+AY  L D  +R +Y
Sbjct: 557 IRKAYLSLTKKYHPD--KQGKQLSEEEEKKNDEKMSEINEAYEVLNDEEKRKEY 608

>KLLA0C07260g complement(632987..634093) similar to sp|P25303
          Saccharomyces cerevisiae YMR214w SCJ1 homolog of E.
          coli DnaJ, functions in the endoplasmic reticulum by
          interaction with KAR2P, start by similarity
          Length = 368

 Score = 29.3 bits (64), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 3/49 (6%)

Query: 33 QSRLRKEYRQLQAQHHPDMAQQGSEQSS---TLNQAYHTLKDPLRRSQY 78
          +  ++  YRQL  ++HPD      E       + +AY  L DP +R  Y
Sbjct: 33 EKEIKSAYRQLSKKYHPDKNPGNDEAHHHFIEVGEAYDVLSDPEKRQIY 81

>AER346W [2847] [Homologous to ScYMR214W (SCJ1) - SH]
          complement(1271436..1272539) [1104 bp, 367 aa]
          Length = 367

 Score = 29.3 bits (64), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 6/56 (10%)

Query: 36 LRKEYRQLQAQHHPDMAQQGSEQSST---LNQAYHTLKDPLRR---SQYMLKLLRN 85
          ++  YRQL  ++HPD     +        + +AY  L DP +R    QY  + L+N
Sbjct: 37 IKSAYRQLSKKYHPDKNPGDTTAHHNFIEVGEAYEALSDPEKRRIYDQYGAEALKN 92

>YOR254C (SEC63) [5042] chr15 complement(805031..807022) Component
           of ER protein-translocation subcomplex, which includes
           Sec62p, Sec63p, Sec66p, and Sec72p, member of DnaJ
           protein family [1992 bp, 663 aa]
          Length = 663

 Score = 29.3 bits (64), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 9/53 (16%)

Query: 36  LRKEYRQLQAQHHPDMAQQG---------SEQSSTLNQAYHTLKDPLRRSQYM 79
           ++  YR+L  + HPD   +G          E    + +AY +L D L R  Y+
Sbjct: 141 IKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAYESLTDELVRQNYL 193

>KLLA0F03333g complement(313991..315220) similar to sp|P25491
          Saccharomyces cerevisiae YNL064c YDJ1 mitochondrial and
          ER import protein, start by similarity
          Length = 409

 Score = 28.9 bits (63), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 32 DQSRLRKEYRQLQAQHHPDM--AQQGSEQSSTLNQAYHTLKDPLRRSQY 78
          D ++++K YR+   + HPD   +++ +E+   +  AY  L D  +R  Y
Sbjct: 18 DDNQIKKAYRKSALKFHPDKNPSEEAAEKFKEITSAYEILSDSQKREVY 66

>Scas_692.34
          Length = 375

 Score = 28.9 bits (63), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 5/47 (10%)

Query: 36 LRKEYRQLQAQHHPDMAQQGSEQSS----TLNQAYHTLKDPLRRSQY 78
          ++  YRQL  + HPD    G+E +      + +AY  L DP +R  +
Sbjct: 37 IKSAYRQLSKKFHPD-KNPGNEDAHQKFIEVGEAYEVLSDPQKRQTF 82

>KLLA0E01628g 155088..155783 weakly similar to sp|P48353
          Saccharomyces cerevisiae YMR161w HLJ1, start by
          similarity
          Length = 231

 Score = 28.5 bits (62), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 30 TIDQSRLRKEYRQLQAQHHPDMAQ--QGSEQSSTLNQAYHTLKDPLRR 75
          +  +S ++K YR+L  + HPD  +  + SE    +N+A+  L D  +R
Sbjct: 32 SASESDIKKAYRKLAIKLHPDKNRHPRASEAFKKINRAFEVLSDDSKR 79

>Kwal_26.8879
          Length = 656

 Score = 28.9 bits (63), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 9/53 (16%)

Query: 36  LRKEYRQLQAQHHPD------MAQQGS---EQSSTLNQAYHTLKDPLRRSQYM 79
           +R  YR+L  + HPD       A + S   EQ   + +AY  L D + R  Y+
Sbjct: 133 IRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKALTDEVTRENYL 185

>Sklu_2292.4 YGR285C, Contig c2292 5220-6518
          Length = 432

 Score = 28.9 bits (63), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 5/50 (10%)

Query: 34  SRLRKEYRQLQAQHHPD--MAQQGSEQSS---TLNQAYHTLKDPLRRSQY 78
           +++ K +R+   +HHPD   A  G E+      + +AY TL D  +R+QY
Sbjct: 114 AQIIKAHRKQVLKHHPDKKSASGGLEEDGFFKIIQKAYETLTDSNKRAQY 163

>KLLA0E07876g complement(709306..710793) weakly similar to
          sp|P53940 Saccharomyces cerevisiae YNL077w, start by
          similarity
          Length = 495

 Score = 28.5 bits (62), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 30 TIDQSRLRKEYRQLQAQHHPDMAQQGSEQSS---TLNQAYHTLKDPLRRSQY 78
          T  +  ++K YR+   +HHPD     +E       ++ AY TL +  +R  Y
Sbjct: 16 TATEQEIKKAYRKKALKHHPDKNNHSAESIKLFQDISHAYETLSNSNKRELY 67

>CAGL0J09966g complement(976568..977791) highly similar to
          sp|P25491 Saccharomyces cerevisiae YNL064c YDJ1, start
          by similarity
          Length = 407

 Score = 28.5 bits (62), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 34 SRLRKEYRQLQAQHHPDM--AQQGSEQSSTLNQAYHTLKDPLRRSQY 78
          + ++K YR+   ++HPD   +++ +E+   ++ AY  L D  +R  Y
Sbjct: 20 AEIKKAYRKSALKYHPDKNPSEEAAEKFKEVSSAYEILSDSQKREVY 66

>Sklu_2174.6 YER048C, Contig c2174 7478-8659
          Length = 393

 Score = 28.1 bits (61), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 3/48 (6%)

Query: 34 SRLRKEYRQLQAQHHPDMAQQGSEQSS---TLNQAYHTLKDPLRRSQY 78
          + ++K YR+     HPD      +  +    + QAY  L DP  RS+Y
Sbjct: 20 TEIKKAYRKKAMLTHPDKHPNDPDAQAKFQAVGQAYQVLSDPGLRSRY 67

>YER048C (CAJ1) [1475] chr5 complement(246981..248156) Homolog of
          E. coli DnaJ, has a leucine zipper [1176 bp, 391 aa]
          Length = 391

 Score = 27.7 bits (60), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 3/48 (6%)

Query: 34 SRLRKEYRQLQAQHHPDMAQQGSEQSS---TLNQAYHTLKDPLRRSQY 78
          + ++K YR+   + HPD      +  +    + +AY  L DP  RS+Y
Sbjct: 20 TEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSDPGLRSKY 67

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 28.1 bits (61), Expect = 5.2,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 3/45 (6%)

Query: 87  DLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDDEAGVKLLEKQN 131
           D TQE+    V  S PQ+L   LD+ D + Q D+     LL++ N
Sbjct: 330 DFTQEK-PERVDFSTPQML--PLDLFDTIPQFDEPTNFNLLDRNN 371

>YIR004W (DJP1) [2669] chr9 (363218..364516) Protein required for
          peroxisomal biogenesis, has similarity to E. coli DnaJ
          and other DnaJ-like proteins [1299 bp, 432 aa]
          Length = 432

 Score = 27.7 bits (60), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 26 LPIWTIDQS-RLRKEYRQLQAQHHPDMAQQ---GSEQSSTLNQAYHTLKDPLRRSQY 78
          L + T   S  ++K YR+   Q HPD        +E+   +++AY  L D   R++Y
Sbjct: 11 LGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLGDDDLRAKY 67

>ADR113W [1854] [Homologous to ScYOL095C (HMI1) - SH]
           complement(905272..907398) [2127 bp, 708 aa]
          Length = 708

 Score = 27.7 bits (60), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 24/38 (63%)

Query: 109 LDIHDELSQMDDEAGVKLLEKQNKERIQDIEAQLGQCY 146
           LD+ +ELSQ+ +   + L + QN+E++Q+    L + Y
Sbjct: 498 LDLMNELSQLIERMDIPLFQVQNEEQLQEFRDNLLEFY 535

>Kwal_56.23782
          Length = 414

 Score = 27.7 bits (60), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 6/52 (11%)

Query: 33 QSRLRKEYRQLQAQHHPDMAQQGS--EQSST----LNQAYHTLKDPLRRSQY 78
          Q  ++K YR+L  QHHPD     S  E+S      +  AY  L +  +R  Y
Sbjct: 15 QDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKRRNY 66

>YNL077W (APJ1) [4513] chr14 (481390..482976) Protein induced by
          cell stress, member of the DnaJ family of predicted
          protein chaperones [1587 bp, 528 aa]
          Length = 528

 Score = 27.7 bits (60), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 3/48 (6%)

Query: 34 SRLRKEYRQLQAQHHPDMAQQGSEQSST---LNQAYHTLKDPLRRSQY 78
          S ++K YR    ++HPD      E       + QAY  LKD   R+ Y
Sbjct: 20 SEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEILKDNRLRALY 67

>Kwal_47.19198
          Length = 300

 Score = 27.3 bits (59), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 22/43 (51%)

Query: 36  LRKEYRQLQAQHHPDMAQQGSEQSSTLNQAYHTLKDPLRRSQY 78
           +RK +R+L  ++HPD  +   +    +N A   L D  +R  Y
Sbjct: 64  IRKNFRKLSKKYHPDKNKNYKKVYELINLATKILSDDSQRKTY 106

>KLLA0C09823g 848641..850650 similar to sp|P14906 Saccharomyces
           cerevisiae YOR254c SEC63 ER protein-translocation
           complex subunit singleton, start by similarity
          Length = 669

 Score = 27.7 bits (60), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 23/52 (44%), Gaps = 9/52 (17%)

Query: 36  LRKEYRQLQAQHHPDMAQQG---------SEQSSTLNQAYHTLKDPLRRSQY 78
           ++  YR+L  + HPD   +           EQ   +N+AY  L D + +  Y
Sbjct: 127 IKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKALTDEITKENY 178

>KLLA0D02420g complement(206544..207182) some similarities with
           sp|P36110 Saccharomyces cerevisiae YKR013w PRY2,
           hypothetical start
          Length = 212

 Score = 26.9 bits (58), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 16/25 (64%)

Query: 91  EQTSNEVTTSDPQLLLKVLDIHDEL 115
           EQ S + T +DP    ++LD+H+ L
Sbjct: 63  EQVSTKPTATDPDFKTEILDVHNSL 87

>CAGL0I04972g complement(454872..455255) similar to sp|P40060
           Saccharomyces cerevisiae YER092w, hypothetical start
          Length = 127

 Score = 26.6 bits (57), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 43/76 (56%), Gaps = 9/76 (11%)

Query: 30  TIDQSRLRKEYRQLQAQHHPDMAQQGSEQSSTLNQAYHTLKDPLRRSQYMLKLLRNIDLT 89
            ID+  L KEYR+L A++  D+ +    Q +T  + Y T     R+   ++ LL++++ T
Sbjct: 3   AIDREALEKEYRKLTARND-DIIR----QEATSKKEYATFS---RKETSIITLLQSLEPT 54

Query: 90  QEQTSNEVTTSDPQLL 105
             Q  +E+  ++P+L+
Sbjct: 55  L-QDMHELKNNEPRLI 69

>CAGL0D01584g 167879..168781 similar to tr|Q12350 Saccharomyces
           cerevisiae YPR061c, hypothetical start
          Length = 300

 Score = 26.9 bits (58), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 10/40 (25%), Positives = 24/40 (60%)

Query: 31  IDQSRLRKEYRQLQAQHHPDMAQQGSEQSSTLNQAYHTLK 70
           +D  +L+ EY +    +HPD++     + S+L +++H ++
Sbjct: 69  VDLKKLKMEYHKYVKMYHPDLSSHIQIRKSSLVKSHHAME 108

>Kwal_47.18133
          Length = 393

 Score = 27.3 bits (59), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 3/46 (6%)

Query: 36 LRKEYRQLQAQHHPDMAQQGSEQSS---TLNQAYHTLKDPLRRSQY 78
          ++K YR+     HPD      E  +    + +AY  L DP  RS+Y
Sbjct: 22 IKKAYRKKAMLTHPDKHPDDPEAQAKFQAIGEAYQVLSDPDLRSRY 67

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.131    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,874,372
Number of extensions: 236923
Number of successful extensions: 1332
Number of sequences better than 10.0: 149
Number of HSP's gapped: 1306
Number of HSP's successfully gapped: 150
Length of query: 182
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 87
Effective length of database: 13,307,399
Effective search space: 1157743713
Effective search space used: 1157743713
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 58 (26.9 bits)