Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL017W (ATE1)50349526820.0
Kwal_47.1745354454212691e-171
Sklu_1768.254253812661e-170
Scas_638.951050112241e-165
CAGL0A00319g50951111951e-160
KLLA0A04862g50350611271e-150
AGR165W50050910721e-142
KLLA0F04213g76838692.6
ADL126C46667656.4
ABR225C943152648.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL017W
         (495 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL017W (ATE1) [1956] chr7 (459857..461368) Arginyltransferase (...  1037   0.0  
Kwal_47.17453                                                         493   e-171
Sklu_1768.2 YGL017W, Contig c1768 1526-3154 reverse complement        492   e-170
Scas_638.9                                                            476   e-165
CAGL0A00319g 30978..32507 similar to sp|P16639 Saccharomyces cer...   464   e-160
KLLA0A04862g 431710..433221 similar to sp|P16639 Saccharomyces c...   438   e-150
AGR165W [4476] [Homologous to ScYGL017W (ATE1) - SH] complement(...   417   e-142
KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces c...    31   2.6  
ADL126C [1615] [Homologous to ScYFR032C - SH] (469991..471391) [...    30   6.4  
ABR225C [819] [Homologous to ScYLR067C (PET309) - SH] (823556..8...    29   8.8  

>YGL017W (ATE1) [1956] chr7 (459857..461368) Arginyltransferase
           (arg-tRNA protein transferase), transfers arg to N-Asp
           or N-Glu of proteins prior to degradation by the N-end
           rule pathway [1512 bp, 503 aa]
          Length = 503

 Score = 1037 bits (2682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/495 (100%), Positives = 495/495 (100%)

Query: 1   MSDRFVIWAPSMHNEPAAKCGYCHGNKGGNMDQLFALDSWAHRYMNKMDVVKIENCTIGS 60
           MSDRFVIWAPSMHNEPAAKCGYCHGNKGGNMDQLFALDSWAHRYMNKMDVVKIENCTIGS
Sbjct: 1   MSDRFVIWAPSMHNEPAAKCGYCHGNKGGNMDQLFALDSWAHRYMNKMDVVKIENCTIGS 60

Query: 61  FVEHMDVATYDRMCNMGFRRSGKFLYKVDPLRNCCRLYTIRTAPQELNMTKELKKCISRF 120
           FVEHMDVATYDRMCNMGFRRSGKFLYKVDPLRNCCRLYTIRTAPQELNMTKELKKCISRF
Sbjct: 61  FVEHMDVATYDRMCNMGFRRSGKFLYKVDPLRNCCRLYTIRTAPQELNMTKELKKCISRF 120

Query: 121 ATRITSEDYCPAAVASSDFVGKIVNAEMNSKTFYTRFEPALYSEEKYHLFVKYQEKVHQD 180
           ATRITSEDYCPAAVASSDFVGKIVNAEMNSKTFYTRFEPALYSEEKYHLFVKYQEKVHQD
Sbjct: 121 ATRITSEDYCPAAVASSDFVGKIVNAEMNSKTFYTRFEPALYSEEKYHLFVKYQEKVHQD 180

Query: 181 YNNSPKSFKRFLCDTPFGPEAVLGTQESWEQLNNWQRMKPGEKLKHMGPVHECYYYEGKL 240
           YNNSPKSFKRFLCDTPFGPEAVLGTQESWEQLNNWQRMKPGEKLKHMGPVHECYYYEGKL
Sbjct: 181 YNNSPKSFKRFLCDTPFGPEAVLGTQESWEQLNNWQRMKPGEKLKHMGPVHECYYYEGKL 240

Query: 241 IAITVSDILPSGISSVYFIWDPDYSKWSLGKLSALRDLAIIQRTNLQYYYLGYYIEDCPK 300
           IAITVSDILPSGISSVYFIWDPDYSKWSLGKLSALRDLAIIQRTNLQYYYLGYYIEDCPK
Sbjct: 241 IAITVSDILPSGISSVYFIWDPDYSKWSLGKLSALRDLAIIQRTNLQYYYLGYYIEDCPK 300

Query: 301 MNYKANYGAEVLDVCHSKYIPLKPIQDMISRGKLFVIGEEETKVTKELYLVDSETGRGEG 360
           MNYKANYGAEVLDVCHSKYIPLKPIQDMISRGKLFVIGEEETKVTKELYLVDSETGRGEG
Sbjct: 301 MNYKANYGAEVLDVCHSKYIPLKPIQDMISRGKLFVIGEEETKVTKELYLVDSETGRGEG 360

Query: 361 FPTDNVVKYKNIAEEIYGVGGCAFKSANESALELKELYGIPYEEEDLDTIYHLKEHNGHA 420
           FPTDNVVKYKNIAEEIYGVGGCAFKSANESALELKELYGIPYEEEDLDTIYHLKEHNGHA
Sbjct: 361 FPTDNVVKYKNIAEEIYGVGGCAFKSANESALELKELYGIPYEEEDLDTIYHLKEHNGHA 420

Query: 421 PNGIPNVVPGLLPLWELLDIMQSGKITDLEGRLFLFEIETEGIRPLINFYSEPPNVKKRI 480
           PNGIPNVVPGLLPLWELLDIMQSGKITDLEGRLFLFEIETEGIRPLINFYSEPPNVKKRI
Sbjct: 421 PNGIPNVVPGLLPLWELLDIMQSGKITDLEGRLFLFEIETEGIRPLINFYSEPPNVKKRI 480

Query: 481 CDVIRLFGFETCMKA 495
           CDVIRLFGFETCMKA
Sbjct: 481 CDVIRLFGFETCMKA 495

>Kwal_47.17453
          Length = 544

 Score =  493 bits (1269), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 250/542 (46%), Positives = 341/542 (62%), Gaps = 51/542 (9%)

Query: 1   MSDRFVIWAPSMHNEPAAKCGYCHGNKGGNMDQLFALDSWAHRYMNKMDVVKIENCTIGS 60
           +SDR +I  P    EP  KCGYC G K  N+   FA +SW   + +    ++  NCT+G 
Sbjct: 3   LSDRLIISKPLYFTEPNDKCGYCSGKKS-NLYDYFATESWYKYHEDDAKTLQFNNCTLGL 61

Query: 61  FVEHMDVATYDRMCNMGFRRSGKFLYKVDPLRNCCRLYTIRTAPQELNMTKELKKCISRF 120
            VE + V  YD++CN+GFRRSG FLYK D LRNCCRLYTIRT P++  M+KELK C++RF
Sbjct: 62  QVELIPVDVYDKLCNLGFRRSGNFLYKADMLRNCCRLYTIRTTPEKCQMSKELKSCVTRF 121

Query: 121 ATRITSED-YCPA--------------------AVASSDFVGKIVNAEMNSKTFYTRFEP 159
             RI+S+    P+                      A  D+V +IV AE NS++F+ RFEP
Sbjct: 122 RKRISSQQSQTPSKGQNAGTIAQTARKGQAARNGQARYDYVNEIVQAEKNSESFHARFEP 181

Query: 160 ALYSEEKYHLFVKYQEKVHQDYNNSPKSFKRFLCDTPFGPEAVLGTQESWEQLNNWQRMK 219
           A YS EKY LFV+YQE VH D+NNS K+FKRFLC++PF  + V GTQE W+QLNNW+ MK
Sbjct: 182 ATYSNEKYQLFVRYQENVHGDFNNSVKAFKRFLCESPFPEDVVAGTQEEWDQLNNWRDMK 241

Query: 220 PGEKLKHMGPVHECYYYEGKLIAITVSDILPSGISSVYFIWDPDYSKWSLGKLSALRDLA 279
            GE LK +GP HECYY+EGKLIA+ V+D LPSGISSVYFIWDPD+ KWSLGKLSALR+L+
Sbjct: 242 EGEVLKRVGPAHECYYFEGKLIALAVTDFLPSGISSVYFIWDPDFPKWSLGKLSALRELS 301

Query: 280 IIQRTNLQYYYLGYYIEDCPKMNYKANYGAEVLDVCHSKYIPLKPIQDMISRGKLFVIGE 339
           ++ + N QYYYLGYYI+DCPKM YK  YG ++LDVC+++Y+PL  +   I  GK F++G 
Sbjct: 302 VLSKINRQYYYLGYYIDDCPKMKYKRKYGGDILDVCNNEYVPLDLVAPFIEHGKFFLLGA 361

Query: 340 EETKVTKELYLVDSETGRGEGFPTDNVVKY------KNIAEEIYGVGGCAFKSANESALE 393
            +     +    + +    E  P D+V +        N+ + IYG  G A  SANE+A +
Sbjct: 362 NKENDDDDDDPTEHDC---EELPLDDVPRLHLNASNTNVVDRIYGENGGAELSANEAAEK 418

Query: 394 LKEL--------YGIPYEEEDLDTI------YHLKEHNGHAPN------GIPNVVPGLLP 433
           L E+        +  PY+ ++  ++       H +E +G  P        +PNVVPGLLP
Sbjct: 419 LAEMGIEYTPTIFPDPYKPKEFASLTSSEPEVHYEEDDGDVPGYTNQIYHLPNVVPGLLP 478

Query: 434 LWELLDIMQSGKITDLEGRLFLFEIETEGIRPLINFYSEPPNVKKRICDVIRLFGFETCM 493
           LW++L I++SG+I  L  +L L+   +  I  + +F +E   +K+ IC+VIR+ G +   
Sbjct: 479 LWQILHIIESGEINRLNNKLMLYNTRSGQIHLVNDFQAESKRIKRVICNVIRMIGLKNTA 538

Query: 494 KA 495
           K+
Sbjct: 539 KS 540

>Sklu_1768.2 YGL017W, Contig c1768 1526-3154 reverse complement
          Length = 542

 Score =  492 bits (1266), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 253/538 (47%), Positives = 338/538 (62%), Gaps = 45/538 (8%)

Query: 1   MSDRFVIWAPSMHNEPAAKCGYCHGNKGGNMDQLFALDSWAHRYMNKMDVVKIENCTIGS 60
           +SDR +I  P   N+ ++ CGYC  +K  + D  F  DSW   + + +  ++I NCT+G 
Sbjct: 3   ISDRLIISKPLYINDSSSNCGYCKHSKNNDYD-YFPTDSWYQLHKSHIKDLEINNCTLGL 61

Query: 61  FVEHMDVATYDRMCNMGFRRSGKFLYKVDPLRNCCRLYTIRTAPQELNMTKELKKCISRF 120
            VE   V  YD  CN+GFRRSG FLYK D LRNCCRLYTIRT P++  ++KE K CISRF
Sbjct: 62  QVELFPVEIYDDWCNLGFRRSGNFLYKADMLRNCCRLYTIRTTPKQCKISKEFKSCISRF 121

Query: 121 ATRIT-------SEDYCPAAVASS-------DFVGKIVNAEMNSKTFYTRFEPALYSEEK 166
             RI        S    P A           DFV +I++AE++SK FYTRFEPA+Y+ EK
Sbjct: 122 KKRIAPSSESSLSPGGTPLATGGKGKKQQPYDFVNEIISAELSSKNFYTRFEPAIYTPEK 181

Query: 167 YHLFVKYQEKVHQDYNNSPKSFKRFLCDTPFGPEAVLGTQESWEQLNNWQRMKPGEKLKH 226
           Y LFVKYQEKVH D+NNS KSFK+FLC++PF  + V+GT E W +LNNW+ + P  K++ 
Sbjct: 182 YQLFVKYQEKVHNDHNNSVKSFKKFLCESPFPEDVVIGTPEEWYELNNWKNLPPHSKIQR 241

Query: 227 MGPVHECYYYEGKLIAITVSDILPSGISSVYFIWDPDYSKWSLGKLSALRDLAIIQRTNL 286
           +GPVHECYYYE KLIA+ V+D LPSGISSVYFIWDP+Y++WSLGKLSALR+L+++ + N 
Sbjct: 242 VGPVHECYYYEEKLIALAVTDFLPSGISSVYFIWDPEYARWSLGKLSALRELSLLSKINR 301

Query: 287 QYYYLGYYIEDCPKMNYKANYGAEVLDVCHSKYIPLKPIQDMISRGKLFVIGEEETKV-- 344
            YYYLGYYIEDCPKM YK  YG ++LDVC+++Y+PL  +++ +  GK FV+  E  K   
Sbjct: 302 DYYYLGYYIEDCPKMKYKRKYGGDILDVCNNQYVPLDELENFLEHGKFFVLSNENNKKED 361

Query: 345 TKELYLVDSETGRGEGFPTDNVVKY------KNIAEEIYGVGGCAFKSANESALELKELY 398
             E Y   +E       P D+  K+      KNI E IYG  G A +SAN++  +L +L 
Sbjct: 362 DDEYYEEVNELAPLSELPLDDTKKFSPNKPLKNIVERIYGERGGAVQSANDAVDKLTDL- 420

Query: 399 GIPYEEEDLDTIYHLKEHNGHAPNG---------------------IPNVVPGLLPLWEL 437
           GI Y  +  + +Y LK   G  P                       +PNVVPGLLPLW++
Sbjct: 421 GIEYTPQIFNDLYKLKPLPGMEPPTDEEHYEEDDGDISGYTNEIYHLPNVVPGLLPLWQI 480

Query: 438 LDIMQSGKITDLEGRLFLFEIETEGIRPLINFYSEPPNVKKRICDVIRLFGFETCMKA 495
           L I++SG+I  L  +L L+   T  IR +++F  E    K+ IC+VIR+ G +   K+
Sbjct: 481 LQIVESGEINRLNNKLMLYNTRTGQIRLVVDFQLESKRTKRVICNVIRMIGLKNTAKS 538

>Scas_638.9
          Length = 510

 Score =  476 bits (1224), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 239/501 (47%), Positives = 323/501 (64%), Gaps = 13/501 (2%)

Query: 1   MSDRFVIWAPSMHNEPAAKCGYCHGNKGGNMDQLFALDSWAHRYMNKMDVVKIENCT--I 58
           + DR +I  P    E A++CGYCHG K  N    F LDSW  +Y +  D+      T  +
Sbjct: 3   LQDRLIITKPMYFKESASECGYCHGKKK-NPRNYFPLDSWYEKYKDGFDLDAPNRGTYNL 61

Query: 59  GSFVEHMDVATYDRMCNMGFRRSGKFLYKVDPLRNCCRLYTIRTAPQELNMTKELKKCIS 118
           G   E M V  YD +CN+GFRRSGKF+Y+ D LRNCCRL+TIRT+P +  +TKEL+K + 
Sbjct: 62  GFQAELMTVEMYDTLCNLGFRRSGKFIYRHDMLRNCCRLFTIRTSPDQFQITKELRKTVK 121

Query: 119 RFATRITSEDYCPAAVASS---DFVGKIVNAEMNSKTFYTRFEPALYSEEKYHLFVKYQE 175
           +F   IT+ D      + +   DF+ +I++AE  S  F T FEPA++++EKY LF KYQE
Sbjct: 122 KFKKHITAVDAIEEPSSKNQKFDFIKEIISAEKASPDFKTVFEPAIFTQEKYDLFAKYQE 181

Query: 176 KVHQDYNNSPKSFKRFLCDTPFGPEAVLGTQESWEQLNNWQR--MKPGEKLKHMGPVHEC 233
            VH D+ ++PKSFKRFLCD PF P+ + GT E W+ LN WQ        K+  +GP HEC
Sbjct: 182 NVHNDFKHNPKSFKRFLCDGPFMPQVITGTAEEWKALNEWQDQDFNNSTKITRLGPTHEC 241

Query: 234 YYYEGKLIAITVSDILPSGISSVYFIWDPDYSKWSLGKLSALRDLAIIQRTNLQYYYLGY 293
           YYY+ KLIA+ V D LPSG+SSVYFIWDPD+ KWSLGK+SA+R++AI+ +   +YYY+GY
Sbjct: 242 YYYKDKLIAMAVLDFLPSGVSSVYFIWDPDFKKWSLGKISAMREMAILSKLQRKYYYMGY 301

Query: 294 YIEDCPKMNYKANYGAEVLDVCHSKYIPLKPI--QDMISRGKLFVIGEEETKVTKELYLV 351
           Y+EDCPKMNYK  YG E+LDVC+ +Y+ L  +  + MIS GKLFV+ E ET  + +  L+
Sbjct: 302 YVEDCPKMNYKGAYGGELLDVCNGEYVSLDFLHRKQMISNGKLFVMDESETGTSSDSPLM 361

Query: 352 DSETGRGE-GFPTDNV-VKYKNIAEEIYGVGGCAFKSANESALELKELYGIPYEEEDLDT 409
              +   E  FP+ N  VK KNIAE IYGV G A+    +    L   + +PY  ED D 
Sbjct: 362 RKLSAESENNFPSVNTKVKSKNIAENIYGVNGEAYDDIEQYISGLLN-FDMPYLSEDEDA 420

Query: 410 IYHLKEHNGHAPNGIPNVVPGLLPLWELLDIMQSGKITDLEGRLFLFEIETEGIRPLINF 469
           IY + +  G   + +PNV PGLLPL EL  I++  +ITDL G+L + + +   IRP++N 
Sbjct: 421 IYGVIKAGGDGMSALPNVSPGLLPLQELYFIVELEEITDLNGKLLILDTDDNEIRPMLNI 480

Query: 470 YSEPPNVKKRICDVIRLFGFE 490
           Y E  + K+ ICD++R  G E
Sbjct: 481 YGESESSKRVICDLVRTLGLE 501

>CAGL0A00319g 30978..32507 similar to sp|P16639 Saccharomyces
           cerevisiae YGL017w ATE1 arginyl tRNA transferase, start
           by similarity
          Length = 509

 Score =  464 bits (1195), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 242/511 (47%), Positives = 328/511 (64%), Gaps = 32/511 (6%)

Query: 1   MSDRFVIWAPSMHNEPAAKCGYCHGNKGGNMDQLFALDSWAHRYMNKMDV----VKIENC 56
           M ++ +I  P ++    + CGYCHG K    D  ++L+SW  R     D     + + +C
Sbjct: 1   MENKLIIHRP-LYFSDKSDCGYCHGKKAKGSD-FYSLESWYERIKENADSEVEELPVRSC 58

Query: 57  TIGSFVEHMDVATYDRMCNMGFRRSGKFLYKVDPLRNCCRLYTIRTAPQELNMTKELKKC 116
           T+G   E+M VA YD+MCNMGFRRSG F+YK+D LR+CCRLYTIRT P    +TK+++KC
Sbjct: 59  TVGFQCENMTVAMYDQMCNMGFRRSGLFVYKMDALRSCCRLYTIRTRPDWFKLTKDMRKC 118

Query: 117 ISRFATRITSEDYCPAAVASSD-FVGKIVNAEMNSKT--FYTRFEPALYSEEKYHLFVKY 173
           I+RF   +  E   P A A +  +V  IV+ E  S +  FYTRF PA+Y++EKY LF  Y
Sbjct: 119 INRFRKHVLGE---PVANAKTQGYVEDIVDIEGQSDSINFYTRFGPAVYTDEKYELFSIY 175

Query: 174 QEKVHQDYNNSPKSFKRFLCDTPFGPEAVLGTQESWEQLNNWQRMKPGEKLKHMGPVHEC 233
           QE+VHQD+++S K FKRFLCD PF    ++GT+E WEQLNNW+ MKPGE+L   GPVHE 
Sbjct: 176 QERVHQDFDHSKKGFKRFLCDAPFTQGVIMGTEEEWEQLNNWKSMKPGERLLRTGPVHES 235

Query: 234 YYYEGKLIAITVSDILPSGISSVYFIWDPDYSKWSLGKLSALRDLAIIQRTNLQYYYLGY 293
           YYY+GKLIA+ V+D LPSGISSVYFIW PDY KWSLGKLSALR+L+++ +TNL+YYYLGY
Sbjct: 236 YYYKGKLIALAVTDFLPSGISSVYFIWHPDYHKWSLGKLSALRELSLVSKTNLKYYYLGY 295

Query: 294 YIEDCPKMNYKANYGAEVLDVCHSKYIPLKPIQDMISRGKLFVIGEEETKVTKELYLVDS 353
           YI+DC KMNYKANYG E+LD C  +Y  L  ++DMI  GKLF++G +   +++E+ L D+
Sbjct: 296 YIDDCKKMNYKANYGGELLDSCTERYFKLSQVKDMIRGGKLFMVGTQGHDISREVALSDA 355

Query: 354 ETGRGEGFPTD--NVVKYKNIAEEIYGVGGCAFKSA---------NESALELKELYGIPY 402
              R   + TD  ++    N+AE++YG     ++             S LE    Y  P 
Sbjct: 356 I--RDCIYQTDAFDIASDDNVAEKVYGTSSNIYRPQYLKEVISFLKTSGLE----YDFPI 409

Query: 403 EEEDLDTIYHLK-EHNGHAPN-GIPNVVPGLLPLWELLDIMQSGKIT-DLEGRLFLFEIE 459
             + +   Y  +   +G  P+  IP++ PGL+PLWEL D++ SGK+  +L GR  +F+  
Sbjct: 410 YNDGVFNQYAKRIAKDGEDPDFTIPSICPGLIPLWELKDLLMSGKLQKELTGRTLVFDTS 469

Query: 460 TEGIRPLINFYSEPPNVKKRICDVIRLFGFE 490
              IR L  +  E    K  ICDV+RL G E
Sbjct: 470 FGFIRKLEPWEDEDSTTKTAICDVVRLLGLE 500

>KLLA0A04862g 431710..433221 similar to sp|P16639 Saccharomyces
           cerevisiae YGL017w ATE1 arginyl tRNA transferase
           singleton, start by similarity
          Length = 503

 Score =  438 bits (1127), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 221/506 (43%), Positives = 319/506 (63%), Gaps = 20/506 (3%)

Query: 1   MSDRFVIWAPSMHNEPA-AKCGYCHGNKGGNMDQLFALDSWAHRYMNKMDVVKIENCTIG 59
            +D+ +I  P   ++ A  KCGYC+G K  +    FA   W+  Y    D V++++ T+G
Sbjct: 3   FTDKLIISRPLYISDNADPKCGYCNGKKDSS--HKFASPGWSDFYKGDEDKVELQSSTVG 60

Query: 60  SFVEHMDVATYDRMCNMGFRRSGKFLYKVDPLRNCCRLYTIRTAPQELNMTKELKKCISR 119
              E ++  TYD++CN+GFRRSG F+YK D LRNCCRLYTIRT  + L M+KELK  + R
Sbjct: 61  FNSELVNAETYDKLCNLGFRRSGSFMYKTDMLRNCCRLYTIRTNEKYLTMSKELKTSLKR 120

Query: 120 FATRITSEDYCPAAVASSDFVGKIVNAEMNSKTFYTRFEPALYSEEKYHLFVKYQEKVHQ 179
           F  +ITS ++ P     S ++ ++ + E  S +F   FEPA +++EKY L+V+YQ  +H 
Sbjct: 121 FKKKITSPEFKPQPKYVS-WIDELCDYEPKSTSFKAVFEPAEFTDEKYDLYVRYQHYIHS 179

Query: 180 DYNNSPKSFKRFLCDTPFGPEAVLGTQESWEQLNNWQRMKPGEKLKHMGPVHECYYYEGK 239
           D +N+P  F+ FLCDTPF    + GT++ WEQLNNW  ++PGE++   GP HECYY+ GK
Sbjct: 180 DEDNTPSQFESFLCDTPFTDSEITGTEKEWEQLNNWHNLQPGERVTKNGPAHECYYHNGK 239

Query: 240 LIAITVSDILPSGISSVYFIWDPDYSKWSLGKLSALRDLAIIQRTNLQYYYLGYYIEDCP 299
           LIA++V D LPSG+SSVYFIWDPDY  WSLGK+SALR+LA++ +    YYYLGYYI+DCP
Sbjct: 240 LIALSVLDFLPSGVSSVYFIWDPDYYDWSLGKVSALRELALVSKIGRPYYYLGYYIDDCP 299

Query: 300 KMNYKANYGAEVLDVCHSKYIPLKPIQDMISRGKLFVIGEEETKVTKELYLVDSETGRGE 359
           KMNYKA +G E+LDVC+ KY+PL  I  +I   +LFV G   T  + +  ++ +      
Sbjct: 300 KMNYKAKFGGEILDVCNQKYVPLSKIHQIIKHNELFV-GLNSTVASPDSEILITSASDKI 358

Query: 360 GFPTDNVVKYKNIAEEIYGVGGCAFKSANESALELKELYGIPYEEEDLDTIYHLKEHNGH 419
            F       + N  ++IYG  G A ++A  S  +L++ YGI Y  +   +IY    ++G+
Sbjct: 359 NFDE----PFINAVDDIYGPNGNASQNAITSVAKLRK-YGINYSPDLQRSIYKEIPNDGN 413

Query: 420 APNG----------IPNVVPGLLPLWELLDIMQSGKITDLEGRLFLFEIETEGIRPLINF 469
           + +           IPNVVPGL+PL E++ + +SGK+ +L   + LF+ +   +R + +F
Sbjct: 414 STSSASSDKKDVYRIPNVVPGLVPLMEIVSLFESGKMNELNNNVVLFDTKINALRIVRDF 473

Query: 470 YSEPPNVKKRICDVIRLFGFETCMKA 495
            SE P +K  I DVIRL G +   KA
Sbjct: 474 ISEKPEIKTVITDVIRLIGLDNTKKA 499

>AGR165W [4476] [Homologous to ScYGL017W (ATE1) - SH]
           complement(1054381..1055883) [1503 bp, 500 aa]
          Length = 500

 Score =  417 bits (1072), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 226/509 (44%), Positives = 311/509 (61%), Gaps = 39/509 (7%)

Query: 1   MSDRFVIWAPSMHNEPA-AKCGYCHGNKGGNMDQLFALDSWAHRYMNKMDVVKIENCTIG 59
           ++DR +I  P   +E A  +CGYC G K    +  +A +SW  RY        +   TIG
Sbjct: 3   LNDRLIISKPLYISEAADPQCGYCKGRKDSKNN--YACESWHERYAAGGGAA-LRTATIG 59

Query: 60  SFVEHMDVATYDRMCNMGFRRSGKFLYKVDPLRNCCRLYTIRTAPQELNMTKELKKCISR 119
              E + V  YD +CNMGFRRSG F+YK DPLRNCCR+YTIRT+  +L+ +KEL+ C+ R
Sbjct: 60  LQAELLPVQVYDELCNMGFRRSGDFVYKTDPLRNCCRMYTIRTSMAQLHASKELRSCVKR 119

Query: 120 FATRITSEDYCPAAVASSDFVGKIVNAEMNSKTFYTRFEPALYSEEKYHLFVKYQEKVHQ 179
           F   I +        A    V  +V AE  S  F TRFEPA +++EKY LFV+YQ  VH 
Sbjct: 120 FLRHIGA-------GAGGHGVEALVAAEQASTRFCTRFEPARFTQEKYELFVRYQRAVHH 172

Query: 180 DYNN-SPKSFKRFLCDTPFGPEAVLGTQESWEQLNNWQRMKPGEKLKHMGPVHECYYYEG 238
           D     P  F +FLC++PF  + VLGT E W +LN W+  +PG++ + +GPVHECYY++G
Sbjct: 173 DTGTIEPLQFNKFLCESPFPEDVVLGTAEEWAELNGWRSARPGQRFRRVGPVHECYYFDG 232

Query: 239 KLIAITVSDILPSGISSVYFIWDPDYSKWSLGKLSALRDLAIIQRTNLQYYYLGYYIEDC 298
           KLIA+ VSD LPSG+SSVYFIWDPDYSKWSLGKLSALR++AI++R    YYYLGYYIEDC
Sbjct: 233 KLIALGVSDFLPSGVSSVYFIWDPDYSKWSLGKLSALREMAIVERIGRSYYYLGYYIEDC 292

Query: 299 PKMNYKANYGAEVLDVCHSKYIPLKPIQDMISRGKLFVIGEEETKVTKELYLVDSETGRG 358
           PKM YKA YG E+LDVC+++Y+PL+ ++  I  G+ FV+   E          D E G  
Sbjct: 293 PKMKYKAKYGGELLDVCNNQYLPLRVLEPFIEHGRFFVLDRAEPDAD----CSDDEAGDD 348

Query: 359 --EGFPTDNVVK------YKNIAEEIYGVGGCAFKSANESALELKELYGIPYEEEDLDTI 410
                P D+  +       +++ E IYG  G AF +AN++   L +L G+ Y  + LD  
Sbjct: 349 PLSELPLDDRARLDPAAPLRDVVERIYGASGGAFAAANQAVEGLVDL-GVEYTPQ-LDVG 406

Query: 411 YHLKEHNGHAPN---------GIPNVVPGLLPLWELLDIMQSGKITDLEGRLFLFEIETE 461
               E     P+          +PNVVPGL+PLW++L I++SG+I  +  +L +++    
Sbjct: 407 LFPSE----TPDLRDCLADVYQLPNVVPGLVPLWQILKILKSGEIRHINTKLMIYDTRLG 462

Query: 462 GIRPLINFYSEPPNVKKRICDVIRLFGFE 490
            +R + +F+ E    K+ IC+VIRL G +
Sbjct: 463 RVRLVRDFHQEAKTTKRVICNVIRLIGLK 491

>KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces
           cerevisiae YDR034c LYS14 transcriptional activator of
           lysine pathway genes singleton, start by similarity
          Length = 768

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 4/38 (10%)

Query: 25  GNKGG----NMDQLFALDSWAHRYMNKMDVVKIENCTI 58
           GNKGG    N+D L   DS +  YMNK+   KI+   +
Sbjct: 560 GNKGGMINKNIDYLLFFDSHSEAYMNKLSYFKIQKIIV 597

>ADL126C [1615] [Homologous to ScYFR032C - SH] (469991..471391)
           [1401 bp, 466 aa]
          Length = 466

 Score = 29.6 bits (65), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 31/67 (46%), Gaps = 5/67 (7%)

Query: 361 FPTDNVVKYKNIAEEIYGVGGCAFKSANESALELKELYGIPYEEEDLDTIYHL-----KE 415
            P+ +V  ++  +    G+    FK A+ +A  + EL G+ + + +L   YH+     KE
Sbjct: 79  IPSQSVRGFQKTSVRPLGIAYVEFKDADTAAKVILELNGVTFMDRELRLRYHIPFKSEKE 138

Query: 416 HNGHAPN 422
                PN
Sbjct: 139 KLARGPN 145

>ABR225C [819] [Homologous to ScYLR067C (PET309) - SH]
           (823556..826387) [2832 bp, 943 aa]
          Length = 943

 Score = 29.3 bits (64), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 63/152 (41%), Gaps = 5/152 (3%)

Query: 263 DYSKWSLGKLSALRDLAIIQRTNLQYYYLGYYIEDCPKMNYKANYGAEVLDVCHS---KY 319
           DY +WS+  L  +RD  II   +  Y  +  Y       ++  N    +L   +    K 
Sbjct: 641 DYVEWSINILKRVRDKNIIMENSFLYPAVVAYPVKMLAKHHHPNTAVRLLTEYYEIFGKK 700

Query: 320 IPLKPIQDMISRGKLFVIGEEET-KVTKELYLVDSETGRGEGFPTDNVVKYKNIAEEIYG 378
           IP      ++++  + V GE +  +  +E Y    E       P + V   K I+  ++G
Sbjct: 701 IPRSDESIVVTKALMVVAGEAQNWQEFEEHYSNLMEKISKMKGPENKVQDNKRISNVLFG 760

Query: 379 VGGCAFKSANESALELKELYGIPYEEEDLDTI 410
           V G   +S   +  +++E+  +  E E +  I
Sbjct: 761 VLGYKMESMQATG-KIQEIPSVLQEYEQMGLI 791

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.138    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,768,519
Number of extensions: 816043
Number of successful extensions: 1793
Number of sequences better than 10.0: 15
Number of HSP's gapped: 1811
Number of HSP's successfully gapped: 15
Length of query: 495
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 389
Effective length of database: 12,926,601
Effective search space: 5028447789
Effective search space used: 5028447789
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)