Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL016W (KAP122)1081106255610.0
Scas_638.101081107830180.0
CAGL0A00385g1069108027040.0
KLLA0A04884g1059107622540.0
Kwal_47.1745794797020160.0
AGR166W1013105013951e-176
YHR077C (NMD2)1089131800.26
Scas_645.3708216790.41
Sklu_2347.61176177732.2
Kwal_23.4689416113712.6
Sklu_2435.1344105694.1
CAGL0J05126g44776686.1
CAGL0L12804g39375686.2
CAGL0K03333g60251678.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL016W
         (1062 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL016W (KAP122) [1957] chr7 (461669..464914) Nuclear transport ...  2146   0.0  
Scas_638.10                                                          1167   0.0  
CAGL0A00385g complement(37162..40371) similar to sp|P32767 Sacch...  1046   0.0  
KLLA0A04884g 433581..436760 similar to sp|P32767 Saccharomyces c...   872   0.0  
Kwal_47.17457                                                         781   0.0  
AGR166W [4477] [Homologous to ScYGL016W (KAP122) - SH] complemen...   541   e-176
YHR077C (NMD2) [2366] chr8 complement(252375..255638,255752..255...    35   0.26 
Scas_645.3                                                             35   0.41 
Sklu_2347.6 YML091C, Contig c2347 7585-11115 reverse complement        33   2.2  
Kwal_23.4689                                                           32   2.6  
Sklu_2435.1 YPR127W, Contig c2435 1340-2374                            31   4.1  
CAGL0J05126g complement(484849..486150) highly similar to sp|P47...    31   6.1  
CAGL0L12804g 1369272..1370453 highly similar to sp|P39107 Saccha...    31   6.2  
CAGL0K03333g 302891..304699 similar to sp|Q03162 Saccharomyces c...    30   8.5  

>YGL016W (KAP122) [1957] chr7 (461669..464914) Nuclear transport
            factor, member of karyopherin-beta family [3246 bp, 1081
            aa]
          Length = 1081

 Score = 2146 bits (5561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1048/1062 (98%), Positives = 1048/1062 (98%)

Query: 1    MSSIHEVVALIEELYSPHPKHDVNXXXXXXXXXXXXXXGFHLANELLSDDKYSANVKYFG 60
            MSSIHEVVALIEELYSPHPKHDVN              GFHLANELLSDDKYSANVKYFG
Sbjct: 1    MSSIHEVVALIEELYSPHPKHDVNQIQQSLQSIQKSEQGFHLANELLSDDKYSANVKYFG 60

Query: 61   ALTLTVQLNTRGENDYETLWNVFRSNLLYLTKFSTLYVSNPNMYGQSLIIIKKLMSNLSL 120
            ALTLTVQLNTRGENDYETLWNVFRSNLLYLTKFSTLYVSNPNMYGQSLIIIKKLMSNLSL
Sbjct: 61   ALTLTVQLNTRGENDYETLWNVFRSNLLYLTKFSTLYVSNPNMYGQSLIIIKKLMSNLSL 120

Query: 121  IFTKINDPQLNNAGNENMIKQWNNPINTFIQLMSVQNQNINADQLLLDSINCSLTYEQLS 180
            IFTKINDPQLNNAGNENMIKQWNNPINTFIQLMSVQNQNINADQLLLDSINCSLTYEQLS
Sbjct: 121  IFTKINDPQLNNAGNENMIKQWNNPINTFIQLMSVQNQNINADQLLLDSINCSLTYEQLS 180

Query: 181  QFVSLSQKHNELALTFTEVIVEDLTKFQTKRHSMSQIHEVVHEHLYISTMALINLNLTAQ 240
            QFVSLSQKHNELALTFTEVIVEDLTKFQTKRHSMSQIHEVVHEHLYISTMALINLNLTAQ
Sbjct: 181  QFVSLSQKHNELALTFTEVIVEDLTKFQTKRHSMSQIHEVVHEHLYISTMALINLNLTAQ 240

Query: 241  AVFNPTVFDCITAWINYISLTRSVSSSGRMDLSEIFQNLIDLMYQSTEGSDGYENAEKIL 300
            AVFNPTVFDCITAWINYISLTRSVSSSGRMDLSEIFQNLIDLMYQSTEGSDGYENAEKIL
Sbjct: 241  AVFNPTVFDCITAWINYISLTRSVSSSGRMDLSEIFQNLIDLMYQSTEGSDGYENAEKIL 300

Query: 301  TIFGNVFANDPLLMSYDLRQQIECIFLGVVRPDSGITDISNKNSWMLQYMNYLVTNDFFS 360
            TIFGNVFANDPLLMSYDLRQQIECIFLGVVRPDSGITDISNKNSWMLQYMNYLVTNDFFS
Sbjct: 301  TIFGNVFANDPLLMSYDLRQQIECIFLGVVRPDSGITDISNKNSWMLQYMNYLVTNDFFS 360

Query: 361  ELKELAICIVDFLQINTLSVCNKLFTNIQAADNGQVQDEYIQEYIKVLLQMTNFPLTPVL 420
            ELKELAICIVDFLQINTLSVCNKLFTNIQAADNGQVQDEYIQEYIKVLLQMTNFPLTPVL
Sbjct: 361  ELKELAICIVDFLQINTLSVCNKLFTNIQAADNGQVQDEYIQEYIKVLLQMTNFPLTPVL 420

Query: 421  QEFFSVRMVDFWLDLSDAYTNLASETLRPNSIELSTQIFQQLINIYLPKISLSVKQRIIE 480
            QEFFSVRMVDFWLDLSDAYTNLASETLRPNSIELSTQIFQQLINIYLPKISLSVKQRIIE
Sbjct: 421  QEFFSVRMVDFWLDLSDAYTNLASETLRPNSIELSTQIFQQLINIYLPKISLSVKQRIIE 480

Query: 481  EEGESTSVNEFEDFRNAVSDLAQSLWSILGNDNLTNVLIDGMGQMPAASDETLIIKDTDV 540
            EEGESTSVNEFEDFRNAVSDLAQSLWSILGNDNLTNVLIDGMGQMPAASDETLIIKDTDV
Sbjct: 481  EEGESTSVNEFEDFRNAVSDLAQSLWSILGNDNLTNVLIDGMGQMPAASDETLIIKDTDV 540

Query: 541  LFRIETMCFVLNTILVDMTLSESPWIKNIVDANKFFNQNVISVFQTGFQTSASTKVSQIL 600
            LFRIETMCFVLNTILVDMTLSESPWIKNIVDANKFFNQNVISVFQTGFQTSASTKVSQIL
Sbjct: 541  LFRIETMCFVLNTILVDMTLSESPWIKNIVDANKFFNQNVISVFQTGFQTSASTKVSQIL 600

Query: 601  KLDFVRTSTTLIGTLAGYFKQEPFQLNPYVEALFQGLHTCTNFTSKNEQEKISNDKLEVM 660
            KLDFVRTSTTLIGTLAGYFKQEPFQLNPYVEALFQGLHTCTNFTSKNEQEKISNDKLEVM
Sbjct: 601  KLDFVRTSTTLIGTLAGYFKQEPFQLNPYVEALFQGLHTCTNFTSKNEQEKISNDKLEVM 660

Query: 661  VIKTVSTLCETCREELTPYLMHFISFLNTVIMPDSNVSHFTRTKLVRSIGYVVQCQVSNG 720
            VIKTVSTLCETCREELTPYLMHFISFLNTVIMPDSNVSHFTRTKLVRSIGYVVQCQVSNG
Sbjct: 661  VIKTVSTLCETCREELTPYLMHFISFLNTVIMPDSNVSHFTRTKLVRSIGYVVQCQVSNG 720

Query: 721  PEEQAKYILQLTNLLSGSIEHCLASSVQLQEQQDYINCLLYCISELATSLIQPTEIIEND 780
            PEEQAKYILQLTNLLSGSIEHCLASSVQLQEQQDYINCLLYCISELATSLIQPTEIIEND
Sbjct: 721  PEEQAKYILQLTNLLSGSIEHCLASSVQLQEQQDYINCLLYCISELATSLIQPTEIIEND 780

Query: 781  ALLQRLSEFQSFWSSDPLQIRSKIMCTIDKVLDNSIYCKNSAFVEIGCLIVGKGLNLPDG 840
            ALLQRLSEFQSFWSSDPLQIRSKIMCTIDKVLDNSIYCKNSAFVEIGCLIVGKGLNLPDG
Sbjct: 781  ALLQRLSEFQSFWSSDPLQIRSKIMCTIDKVLDNSIYCKNSAFVEIGCLIVGKGLNLPDG 840

Query: 841  EPYFLKYNMSEVMNFVLRHVPNCELATCLPYFVYLLEKLISEFRKELTPQEFDFMFEKIL 900
            EPYFLKYNMSEVMNFVLRHVPNCELATCLPYFVYLLEKLISEFRKELTPQEFDFMFEKIL
Sbjct: 841  EPYFLKYNMSEVMNFVLRHVPNCELATCLPYFVYLLEKLISEFRKELTPQEFDFMFEKIL 900

Query: 901  LVYYDAYIINDPDLLQMTIGFVNNVLDVKPGLAIGSKHWTSFILPQFLKLIPSREKFTIV 960
            LVYYDAYIINDPDLLQMTIGFVNNVLDVKPGLAIGSKHWTSFILPQFLKLIPSREKFTIV
Sbjct: 901  LVYYDAYIINDPDLLQMTIGFVNNVLDVKPGLAIGSKHWTSFILPQFLKLIPSREKFTIV 960

Query: 961  AVAKFWTKLINNKKYNQEELTTVRQQVSSIGGDLVYQIMYGLFHTQRSDLNSYTDLLRAL 1020
            AVAKFWTKLINNKKYNQEELTTVRQQVSSIGGDLVYQIMYGLFHTQRSDLNSYTDLLRAL
Sbjct: 961  AVAKFWTKLINNKKYNQEELTTVRQQVSSIGGDLVYQIMYGLFHTQRSDLNSYTDLLRAL 1020

Query: 1021 VAKFPIEAREWLVAVLPQICNNPAGHEKFINKLLITRGSRAA 1062
            VAKFPIEAREWLVAVLPQICNNPAGHEKFINKLLITRGSRAA
Sbjct: 1021 VAKFPIEAREWLVAVLPQICNNPAGHEKFINKLLITRGSRAA 1062

>Scas_638.10
          Length = 1081

 Score = 1167 bits (3018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/1078 (54%), Positives = 786/1078 (72%), Gaps = 30/1078 (2%)

Query: 1    MSSIHEVVALIEELYSPHPKHDVNXXXXXXXXXXXXXXGFHLANELLSDDKYSANVKYFG 60
            M+S+ +VV LIEELYSP+P H+VN              GF LANELL    YS NVKYFG
Sbjct: 1    MNSVVDVVKLIEELYSPNPSHNVNEIQQTLQAIQKSNDGFQLANELLEGGDYSPNVKYFG 60

Query: 61   ALTLTVQLNTRGENDYETLWNVFRSNLLYLTKFSTLYVSNPNMYGQSLIIIKKLMSNLSL 120
            ALTLTVQ+N    + YE LW +FR+NL++LTK+   YVSNP  Y   +I IKKLMSNLSL
Sbjct: 61   ALTLTVQINV-NVHSYEDLWRLFRANLIHLTKYCNNYVSNPQQYTPLMITIKKLMSNLSL 119

Query: 121  IFTKINDPQLNNA----GNENMIKQWNNPINTFIQLMSVQNQ------NINADQLLLDSI 170
            IF  IN+              +I  WNNPI+T I L+S  N+      N + D+++ ++I
Sbjct: 120  IFNNINESTFQEVTPTEAAPVVITNWNNPIDTVIFLLSKSNELSDLGMNPHTDEIITEAI 179

Query: 171  NCSLTYEQLSQFVSLSQKHNELALTFTEVIVEDLTKFQTKRHSMSQIHEVVHEHLYISTM 230
            NC++ Y+QL  F+  +  +NEL L FTE+IVEDLTK Q+K+H++++IH  VH +LY+STM
Sbjct: 180  NCTIPYQQLLLFIGSNPAYNELLLIFTEIIVEDLTKLQSKKHAIAKIHTTVHTYLYVSTM 239

Query: 231  ALINLNLTA-QAVFNPTVFDCITAWINYISLTRSVSSSGRMDLSEIFQNLIDLMYQSTEG 289
            ALIN NLT+ Q + + TV++CI +WINYIS++++VS  G+MDL+E+FQNL+ LM QS+E 
Sbjct: 240  ALINANLTSKQNIPSDTVYNCINSWINYISMSQNVSQDGKMDLTEVFQNLLSLMQQSSEQ 299

Query: 290  SDGYENAEKILTIFGNVFANDPLLMSYDLRQQIECIFLGVVRPDSGITDISNKNSWMLQY 349
             D +  AEKIL IF NVF+ DPLLM ++LR+Q+E +FLG+ R  +G T    KN WMLQY
Sbjct: 300  LDNFTMAEKILVIFANVFSQDPLLMGFELREQVEALFLGISRSGNGDTA---KNQWMLQY 356

Query: 350  MNYLVTNDFFSELKELAICIVDFLQINTLSVCNKLFTNIQAADNGQVQDEYIQEYIKVLL 409
            MNYLVTN+  SELK+LAICIVDFLQINTL VCNKLFTNI    N +  +   Q+YIKVLL
Sbjct: 357  MNYLVTNEMVSELKDLAICIVDFLQINTLDVCNKLFTNI---SNDKFNEANSQQYIKVLL 413

Query: 410  QMTNFPLTPVLQEFFSVRMVDFWLDLSDAYTNLASETLRPNSIELSTQIFQQLINIYLPK 469
            Q+TNFPL PVLQEFFSVRM+DFWL+L++ Y+ L++E L+PN+ E+ST+IFQQ+INIYL K
Sbjct: 414  QLTNFPLVPVLQEFFSVRMIDFWLELAECYSVLSNEMLKPNAHEISTEIFQQVINIYLAK 473

Query: 470  ISLSVKQRIIEEEGESTS-VNEFEDFRNAVSDLAQSLWSILGNDNLTNVLIDGMGQMPAA 528
            ISL  KQ+I++++ E  S V+EFEDFR+A SDLAQ+LW ILG+++LTN+LI G+G   A+
Sbjct: 474  ISLINKQKILQDDTEDISAVHEFEDFRSAASDLAQTLWMILGHEHLTNILIAGIGGNDAS 533

Query: 529  SDETLIIKDTDVLFRIETMCFVLNTILVDMTLSESPWIKNIVDANKFFNQNVISVFQTGF 588
            S      KD   LF+IE+M F+LN +L     + S WI N++  N F   N++ + +TG 
Sbjct: 534  SS-----KDMMNLFQIESMSFLLNVLLEGSGDTLSKWICNVIKENAFTIGNILLLLKTGV 588

Query: 589  QTSASTK--VSQILKLDFVRTSTTLIGTLAGYFKQEPFQLNPYVEALFQGLHTCTNFTSK 646
            Q  +  +  V+  L+LD  RTS  L+G  +GYF ++  QL P +E LFQGL +CT   + 
Sbjct: 589  QKLSENEDMVALSLRLDLARTSCHLLGKCSGYFNEDSQQLGPSLETLFQGLESCTAPVNS 648

Query: 647  NEQEKISNDKLEVMVIKTVSTLCETCREELTPYLMHFISFLNTVIMPDSNVSHFTRTKLV 706
             E    SN KLE ++++T++ LCETCR++L+ +L +F + L +++ PD++VS FTR+ LV
Sbjct: 649  LEATA-SNQKLETVIVRTITMLCETCRQQLSSFLGYFFTVLTSIMSPDAHVSTFTRSNLV 707

Query: 707  RSIGYVVQCQVSNGPEEQAKYILQLTNLLSGSIEHCLASSV-QLQEQQD-YINCLLYCIS 764
            RSIGY++Q Q   GPE+QAKYI+Q+ +L+S  IE  +   V Q  +QQ  YI+CLL C+S
Sbjct: 708  RSIGYIIQSQTDGGPEQQAKYIIQVIDLISNFIEQNITLKVGQTPDQQHTYIHCLLECLS 767

Query: 765  ELATSLIQPTEIIENDALLQRLSEFQSFWSSDPLQIRSKIMCTIDKVLDNSIYCKNSAFV 824
            EL ++L+ P E+ ++  +L RL+EFQ FW +DPLQ+R+KI+  I+KVL    + + S F+
Sbjct: 768  ELGSALLDPDELADS-KVLPRLAEFQQFWKNDPLQVRNKILLLIEKVLSVPTFSRKSDFI 826

Query: 825  EIGCLIVGKGLNLPDGEPYFLKYNMSEVMNFVLRHVPNCELATCLPYFVYLLEKLISEFR 884
            E+ CLI+GK L LPD EP+FL+Y+M E++ F+LRHV NCEL+T LPYFVYLLEKL+  F+
Sbjct: 827  EVSCLILGKMLTLPDDEPHFLRYSMQEIIEFILRHVGNCELSTSLPYFVYLLEKLVIHFK 886

Query: 885  KELTPQEFDFMFEKILLVYYDAYIINDPDLLQMTIGFVNNVLDVKPGLAIGSKHWTSFIL 944
            + LT QEFDF+FEKI+LVYY  +I  DPDLLQMTI FVN +LD  P + + S HW SFI 
Sbjct: 887  QTLTSQEFDFLFEKIILVYYSQFIFPDPDLLQMTINFVNTILDTNPSILVHSNHWNSFIF 946

Query: 945  PQFLKLIPSREKFTIVAVAKFWTKLINNKKYNQEELTTVRQQVSSIGGDLVYQIMYGLFH 1004
            P+F+KL+ S+EKFTI+AV KFWTK++NNK+Y +E+L   R Q+ +IG DLVY IMYGL+H
Sbjct: 947  PEFIKLLLSKEKFTIIAVNKFWTKVLNNKRYTKEDLEITRSQIGAIGQDLVYHIMYGLYH 1006

Query: 1005 TQRSDLNSYTDLLRALVAKFPIEAREWLVAVLPQICNNPAGHEKFINKLLITRGSRAA 1062
            TQRSDLNSYTD+LRALVAKFP+E + WL+ VLPQ+ + P  HE+FINKL ITRG+RAA
Sbjct: 1007 TQRSDLNSYTDVLRALVAKFPMETKPWLINVLPQLSDQPVVHERFINKLFITRGNRAA 1064

>CAGL0A00385g complement(37162..40371) similar to sp|P32767
            Saccharomyces cerevisiae YGL016w PDR6, start by
            similarity
          Length = 1069

 Score = 1046 bits (2704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/1080 (50%), Positives = 747/1080 (69%), Gaps = 46/1080 (4%)

Query: 1    MSSIHEVVALIEELYSPHPKHDVNXXXXXXXXXXXXXXGFHLANELLSDDKYSANVKYFG 60
            MSS+ EVV LIEELYSP P  D+N              G  L + LLS   YS NVKYFG
Sbjct: 1    MSSVEEVVNLIEELYSPKPNRDLNEIQQVLQGIQKSGDGLILGSALLSG-PYSTNVKYFG 59

Query: 61   ALTLTVQLNTRGEN--DYETLWNVFRSNLLYLTKFSTLYVSNPNMYGQSLIIIKKLMSNL 118
            ALTL VQ+N   ++    E  + +FR NL +L ++    V++P+      I+IKKLMSNL
Sbjct: 60   ALTLAVQINMHHDDLKKEEFGFTLFRLNLAFLVQYFENVVNDPSALSSYSIVIKKLMSNL 119

Query: 119  SLIFTKINDPQLNNAGNENMIKQWNNPINTFIQL------MSVQ--------NQNINADQ 164
            S++F  IN+   NN    + I  WNNP+NT I L      MS          N N  +D+
Sbjct: 120  SILFVSINN---NNPSENDFIASWNNPLNTLINLSIASSQMSTDQKSHWYGTNNNSESDK 176

Query: 165  LLLDSINCSLTYEQLSQFVSLSQKHNELALTFTEVIVEDLTKFQTKRHSMSQIHEVVHEH 224
            ++LD+IN  + Y QL +F+S S   N+L+L FTE++VEDLTKFQT++H+M+ IH VVHEH
Sbjct: 177  IILDTINSEVPYNQLIEFISSSPVRNQLSLLFTEILVEDLTKFQTQKHAMNSIHGVVHEH 236

Query: 225  LYISTMALINLNLT--AQAVFNPTVFDCITAWINYISLTRSVSSSGRMDLSEIFQNLIDL 282
            LYISTMALI  NL+       +  +F+CI AWINYIS++R VS  GRMDLSE+ ++L+ +
Sbjct: 237  LYISTMALIIFNLSNLDATQLHDNLFNCINAWINYISISRQVSPQGRMDLSELLESLLKV 296

Query: 283  MYQSTEGSDGYENAEKILTIFGNVFANDPLLMSYDLRQQIECIFLGVVRPDSGITDISNK 342
            M QS E ++ Y +AEK+++IF ++F+NDPLLM+++LR ++E IFLGV   D+      ++
Sbjct: 297  MLQSNE-NEQYGSAEKVISIFSHIFSNDPLLMNFELRSRLETIFLGVSHGDTNAD--KSQ 353

Query: 343  NSWMLQYMNYLVTNDFFSELKELAICIVDFLQINTLSVCNKLFTNIQAADNGQVQDEYIQ 402
              WML YMNYLVTN+ +SELK+L+IC+ DFLQINTL +CNKLFT IQ  D  Q   +  Q
Sbjct: 354  YQWMLAYMNYLVTNEMYSELKDLSICVCDFLQINTLDLCNKLFTTIQTQD--QAASDNTQ 411

Query: 403  EYIKVLLQMTNFPLTPVLQEFFSVRMVDFWLDLSDAYTNLASETLRPNSIELSTQIFQQL 462
            EYIKVLLQ+TNFPL PV QE FS++MVDFWLDL++ Y+NLA E+L+PNS +LS +IFQQ+
Sbjct: 412  EYIKVLLQLTNFPLHPVSQESFSLKMVDFWLDLAEGYSNLALESLKPNSQQLSIEIFQQV 471

Query: 463  INIYLPKISLSVKQRIIEEEGESTSVNEFEDFRNAVSDLAQSLWSILGNDNLTNVLIDGM 522
            INIY+PKISLS K+  +E   + T +NEFEDFRNAV+DL QSLW +LGN+NLTNVLI G+
Sbjct: 472  INIYVPKISLSNKKLFLEMGEDKTVLNEFEDFRNAVADLTQSLWLVLGNENLTNVLIAGV 531

Query: 523  GQMPAASDETLIIKDTDVLFRIETMCFVLNTILVDMTLSESPWIKNIVDANKFFNQNVIS 582
            G    AS+  L        F IETM ++L  +L D+ + ES W+ ++++A KF   NV +
Sbjct: 532  GSTEIASETEL--------FNIETMSYLLEKLLKDINIPESLWVLDVLEAAKFLVANVQT 583

Query: 583  VFQTGFQTSASTKVSQILKLDFVRTSTTLIGTLAGYFKQEPFQLNPYVEALFQGLHTCTN 642
            + +TG   S        L +DFVR+STTL+ +L+G++K+ P Q+   +E L QGL  C  
Sbjct: 584  LLRTGLDNSGP------LSIDFVRSSTTLMSSLSGFYKENPEQIGGTIEILVQGLEKCA- 636

Query: 643  FTSKNEQEKISNDKLEVMVIKTVSTLCETCREELTPYLMHFISFLNTVIMPDSNVSHFTR 702
            F++       +  K+E M++KT+STLC  CR+EL PYL +F SFL++++ PD   S FTR
Sbjct: 637  FSTGGAN---AFTKVESMLVKTISTLCSVCRKELYPYLDNFTSFLHSIMSPDKQSSDFTR 693

Query: 703  TKLVRSIGYVVQCQVSNGPEEQAKYILQLTNLLSGSIEHCLASSVQLQEQQDYINCLLYC 762
              L RSIGY++Q Q  NGP+ Q   I +L  + +  IE  L S + +QE+Q+YI C+L C
Sbjct: 694  RSLTRSIGYIIQGQFENGPDAQGGNIDKLVMMFNNLIEQALGSGLSIQEKQNYIQCVLDC 753

Query: 763  ISELATSLIQPTEIIENDALLQRLSEFQSFWSSDPLQIRSKIMCTIDKVLDNSIYCKNSA 822
            ISEL   L+ P E+ ++  ++Q L  ++ +W++DPL IR+KIM  I+KVL N  + K+S+
Sbjct: 754  ISELGNGLVYPQEM-DDPKVIQLLPPYREYWNTDPLGIRAKIMQIIEKVLQNPYFQKSSS 812

Query: 823  FVEIGCLIVGKGLNLPDGEPYFLKYNMSEVMNFVLRHVPNCELATCLPYFVYLLEKLISE 882
             +E  CLI+GK L LP+ EPYFL+Y+M+E++NFV  H+  C++A  LP+FVYLLE L S 
Sbjct: 813  LIEASCLILGKSLTLPEEEPYFLRYSMNEIINFVFTHLQTCDIAPALPFFVYLLENLFSC 872

Query: 883  FRKELTPQEFDFMFEKILLVYYDAYIINDPDLLQMTIGFVNNVLDVKPGLAIGSKHWTSF 942
            ++  +T  EFD +FE++++  Y   I+ DPD LQ  + FVN++LD KPG+A+ S++W+SF
Sbjct: 873  YKATMTSAEFDVIFERVMISNYHQVIVQDPDSLQTCVNFVNSILDTKPGIAVYSQYWSSF 932

Query: 943  ILPQFLKLIPSREKFTIVAVAKFWTKLINNKKYNQEELTTVRQQVSSIGGDLVYQIMYGL 1002
            IL +FL+L+  +EKFTIVAV KFWTK++NNKKY +EEL   RQQV+++G  L   +M GL
Sbjct: 933  ILKEFLQLLTHKEKFTIVAVTKFWTKVVNNKKYTREELEITRQQVAAVGAQLTAHVMAGL 992

Query: 1003 FHTQRSDLNSYTDLLRALVAKFPIEAREWLVAVLPQICNNPAGHEKFINKLLITRGSRAA 1062
            +HTQRSDLN+YT+L+R LVAKFPIE + WLVAVLPQ+ + P  HEKFINKL ITRGSRAA
Sbjct: 993  YHTQRSDLNAYTELIRTLVAKFPIEFKSWLVAVLPQLVDKPQAHEKFINKLFITRGSRAA 1052

>KLLA0A04884g 433581..436760 similar to sp|P32767 Saccharomyces
            cerevisiae YGL016w PDR6 Member of the karyopherin-beta
            family, nuclear import singleton, start by similarity
          Length = 1059

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/1076 (42%), Positives = 687/1076 (63%), Gaps = 56/1076 (5%)

Query: 4    IHEVVALIEELYSPHPKHDVNXXXXXXXXXXXXXXGFHLANELLSDDKYSANVKYFGALT 63
            I+ +V+LIE   + H    +N              G  LAN LLS +  S NVKYFGALT
Sbjct: 3    INHIVSLIETFNNSHDSKVINDIQNVLQQHQKSELGIDLANALLSQENGSTNVKYFGALT 62

Query: 64   LTVQLNTRGENDYETLWNVFRSNLLYLTKFSTLYVSNPNMYGQSLIIIKKLMSNLSLIFT 123
             TVQL T    + + LW++F+ NL++LT+   L+ SNP      L+ I KLMSNLSLIF 
Sbjct: 63   YTVQLTTCLHTESQ-LWSIFQGNLVHLTRMMFLFTSNPAAASNLLVTITKLMSNLSLIFL 121

Query: 124  KINDPQLNNAGNENMIKQWNNPINTFIQLMS-----------VQNQNINADQLLLDSINC 172
             IN   +    + N I  W NP+NT I+L+              N  I A++L+   +N 
Sbjct: 122  TINSDAI--GADSNKIPAWRNPVNTCIKLLQHCNESNLFEWRTDNSEI-AERLVRTCLNE 178

Query: 173  SLTYEQLSQFVSLSQKHNELALTFTEVIVEDLTKFQTKRHSMSQIHEVVHEHLYISTMAL 232
             + Y +L   +S S   N+L L FT+VIVED+ K+Q+K+ S+S ++E+VH HLYISTMA+
Sbjct: 179  DVPYTELIGNISSSAPLNKLLLLFTKVIVEDMNKYQSKKSSLSNVYEMVHNHLYISTMAI 238

Query: 233  INLNLTAQAVFNPT--VFDCITAWINYISLTRSVSSSGRMDLSEIFQNLIDLMYQSTEGS 290
            +N NL        T  VF CIT+WI+YIS+ R+VS+ G MDL+E+F N+I++M  ++ GS
Sbjct: 239  LNFNLENMMSSGATSEVFPCITSWIHYISMARNVSAHGTMDLTEMFNNMINVMCMASNGS 298

Query: 291  DGYENAEKILTIFGNVFANDPLLMSYDLRQQIECIFLGVVRPDSGITDISNKNSWMLQYM 350
              +  ++++++IF ++F+NDP LMS+++R ++E IFLGV R       ++  N WML YM
Sbjct: 299  QEFPYSDEVISIFDDLFSNDPTLMSFEVRAKLEAIFLGVSR-----HSMNTSNDWMLAYM 353

Query: 351  NYLVTNDFFSELKELAICIVDFLQINTLSVCNKLFTNIQAADNGQVQDEYIQEYIKVLLQ 410
            N+LVTN+ + +LK LA C+VDFLQI+ L VCNKLFTNI         D+ +++YI+VLLQ
Sbjct: 354  NHLVTNELYDDLKVLASCVVDFLQISNLDVCNKLFTNIHE----NTGDQSLEDYIRVLLQ 409

Query: 411  MTNFPLTPVLQEFFSVRMVDFWLDLSDAYTNLASETLRPNSIELSTQIFQQLINIYLPKI 470
            +TNFPL P+LQE +S +M++FWLDL++ Y NL  E L+ ++ E++  +F Q++ IYLPKI
Sbjct: 410  LTNFPLIPILQETYSSKMIEFWLDLAEGYGNLPQEALKADANEIAENMFNQVVQIYLPKI 469

Query: 471  SLSVKQRIIEEEGESTSVNEFEDFRNAVSDLAQSLWSILGNDNLTNVLIDGMGQMPAASD 530
            SL  KQ+I+EE+ + + ++EF+DFR+A  DL + LW+ILG+  LT VLI G+GQ    + 
Sbjct: 470  SLMNKQKIMEEDDDQSLLHEFDDFRSATQDLMEILWTILGHSKLTIVLIRGVGQADTNNV 529

Query: 531  ETLIIKDTDVLFRIETMCFVLNTILVDMTLSESPWIKNIVDANKFFNQNVISVFQTGFQT 590
            +         L+++E M F+L  +L  +  S+SP+I + +  N   + N++ + QTG + 
Sbjct: 530  D---------LYQVEAMSFLLAKLLDGVNFSQSPFISDAIGENHLID-NLLFLLQTGCKQ 579

Query: 591  SASTKVSQILKLDFVRTSTTLIGTLAGYFKQEPFQLNPYVEALFQGLHTCTNFTSKNEQE 650
               +K +Q+LKLDFV+ +  L+G +A YF  +   L P VE+LF+ L T   +   N  E
Sbjct: 580  KEHSKTAQVLKLDFVKATCNLLGVMATYFHVDSKPLGPIVESLFECLETSRQY---NPIE 636

Query: 651  KISNDKLEVMVIKTVSTLCETCREELTPYLMHFISFLNTVIMPDSNVSHFTRTKLVRSIG 710
               + K+E+ + +T+S +CE CR+EL P+L +FI  L +++ P+S VSHFTR K V+SIG
Sbjct: 637  Y--SIKMELQLNRTISLICENCRKELIPFLPNFIQVLRSIMRPESPVSHFTREKFVKSIG 694

Query: 711  YVVQCQVSNGPEEQAKYILQLTNLLSGSIEHCLASSVQLQEQQDYINCLLYCISELATSL 770
             ++Q  VS GPE QA +I  + +++ G I+   A S  L         LL C+SEL + L
Sbjct: 695  NIIQMCVSEGPEAQANHISNMVDMIGGLIQTTDAKSDMLS--------LLACLSELGSGL 746

Query: 771  IQ---PTEIIENDAL-LQRLSEFQSFWSSDPLQIRSKIMCTIDKVLDNSIYCKNSAFVEI 826
             Q     E IEN+ + L +L  FQ++W  DP++++ K+M  +   L  S Y  +  FVE+
Sbjct: 747  SQLPNDDEFIENNPMYLAQLPAFQAYWLQDPMRVKDKVMHLVQYAL--SKYGTDPEFVEV 804

Query: 827  GCLIVGKGLNLPDGEPYFLKYNMSEVMNFVLRHVPNCELATCLPYFVYLLEKLISEFRKE 886
             CLI+GK + LPD  P+FL+Y +SE+M+F +  + NC+ A+ LPY  Y LEK+++ F+ +
Sbjct: 805  SCLIIGKAITLPDDIPHFLRYPLSEMMSFYMTCISNCDYASGLPYIEYQLEKIVAGFKDQ 864

Query: 887  LTPQEFDFMFEKILLVYYDAYIINDPDLLQMTIGFVNNVLDVKPGLAIGSKHWTSFILPQ 946
            LT  EFD MF++  L YY ++I +DPDL+Q  + +VN+VL+ KP LA+ S++WT FI+P+
Sbjct: 865  LTSHEFDEMFKQFFLNYYSSHISSDPDLIQSMVSWVNSVLEAKPSLALKSEYWTQFIVPE 924

Query: 947  FLKLIPSREKFTIVAVAKFWTKLINNKKYNQEELTTVRQQVSSIGGDLVYQIMYGLFHTQ 1006
            FLK + ++EKFTI +  KFW K +NN++Y QE+   +     S+G  LVYQ M+ L H Q
Sbjct: 925  FLKYLQAKEKFTISSTTKFWMKTLNNRRYTQEDTEIINALFQSMGKQLVYQTMFSLHHAQ 984

Query: 1007 RSDLNSYTDLLRALVAKFPIEAREWLVAVLPQICNNPA-GHEKFINKLLITRGSRA 1061
            RSD+  Y +L+R L AK+P+  ++WL  +LPQI    A  HE+FINKL +TR SRA
Sbjct: 985  RSDVPQYAELIRTLFAKYPMPMKDWLYELLPQITGKEAIFHERFINKLTVTRASRA 1040

>Kwal_47.17457
          Length = 947

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/970 (42%), Positives = 615/970 (63%), Gaps = 56/970 (5%)

Query: 108  LIIIKKLMSNLSLIFTKINDPQLNNAGNENMIKQWNNPINTFIQLMSVQNQNINA-DQLL 166
            + +IKKLMSN + IF +++DP+      EN I  W NP+ TF+ L S +       D  L
Sbjct: 1    MFVIKKLMSNAARIFFQLHDPK----HQENSIT-WKNPLETFLLLTSQEGVRPEVMDNFL 55

Query: 167  LDSINCSLTYEQLSQFVSLSQKHNELALTFTEVIVEDLTKFQTKRHSMSQIHEVVHEHLY 226
               +  ++ Y+ L Q V+ S   N L L F+EVI+EDL KFQ  +   S +H  V EHLY
Sbjct: 56   QHILAENVPYDNLIQVVNSSTAFNTLLLLFSEVIIEDLIKFQATKVGSSHLHNAVREHLY 115

Query: 227  ISTMALINLNL---TAQAVFNP--------TVFDCITAWINYISLTRSVSSSGRMDLSEI 275
            IS+M+++N NL   +A     P        TVF C+ AWI Y ++ RS  S G +DL+E 
Sbjct: 116  ISSMSIVNYNLQQLSASFQTRPHETPEVADTVFRCVRAWIEYATMARS-GSQGHLDLTEN 174

Query: 276  FQNLIDLMYQSTEGSD-GYENAEKILTIFGNVFANDPLLMSYDLRQQIECIFLGVVRPDS 334
            F+NLI LM       D G+  +E I++I G +F  DP +++Y+LR  +E +FLGV R   
Sbjct: 175  FENLIHLM--CLHNPDFGFPYSETIVSILGEIFGTDPTILNYELRTTLEGVFLGVGRT-- 230

Query: 335  GITDISNKNSWMLQYMNYLVTNDFFSELKELAICIVDFLQINTLSVCNKLFTNIQAADNG 394
               + S  + WMLQYMN+LV N  F +LK+LA+C+VDFLQ++ L VCNKLFT   A+D G
Sbjct: 231  -AQNKSEGHEWMLQYMNHLVVNQMFDDLKDLALCVVDFLQVSNLDVCNKLFT--VASDTG 287

Query: 395  QVQDEYIQEYIKVLLQMTNFPLTPVLQEFFSVRMVDFWLDLSDAYTNLASETLRPNSIEL 454
                  + +YIKVLLQMTNF L PVL+EFFSVRMVDFWLDL D Y NL  ETL+P + EL
Sbjct: 288  SGN---LDQYIKVLLQMTNFTLVPVLEEFFSVRMVDFWLDLCDGYNNLVRETLKPETPEL 344

Query: 455  STQIFQQLINIYLPKISLSVKQRIIEEEGESTSVNEFEDFRNAVSDLAQSLWSILGNDNL 514
            +  IF Q+  IYLPKI+L  KQ+II E  E + ++EF+DFR AV DL +S+WS+LG++ L
Sbjct: 345  AANIFGQVAQIYLPKINLQNKQKIIREGEEDSLLHEFDDFRGAVLDLIESMWSVLGHEKL 404

Query: 515  TNVLIDGMGQMPAASDETLIIKDTDVLFRIETMCFVLNTILVDMTLSESPWIKNIVDANK 574
            T++L+  +GQ+  +S E L        F++E MCF LN +L DM L+ESP +   +  +K
Sbjct: 405  TDILVYSIGQIAPSSAEDL--------FQVEAMCFCLNKLLADMNLAESPSVCESLRNSK 456

Query: 575  FFNQNVISVFQTGFQT--SASTKVSQILKLDFVRTSTTLIGTLAGYFKQEPFQLNPYVEA 632
             F  NV+ + QT  Q   +++ + +QIL  DF++T ++++ T++ YFK++  +L   ++ 
Sbjct: 457  GFLANVLLLIQTSCQQKDASNGREAQILSSDFIKTGSSMLATVSDYFKRDEAELRNCMDT 516

Query: 633  LFQGLHTCTNFTSKNEQEKISNDKLEVMVIKTVSTLCETCREELTPYLMHFISFLNTVIM 692
            LF  L TC+N       +   + K E+++ K  +++CE  R EL  YL  F    + +I 
Sbjct: 517  LFSSLETCSN-------KDAVDTKFELLITKCTTSICEKSRLELGSYLPTFTKIQHAMIQ 569

Query: 693  PDSNVSHFTRTKLVRSIGYVVQCQVSNGPEEQAKYILQLTNLLSGSIEHCLASSVQLQEQ 752
            P SNVS F++    R +GY++Q    +GPE QA+Y+LQ+ N +   +       V     
Sbjct: 570  PSSNVSSFSKQGFTRCLGYIIQAYTRDGPEAQAQYLLQVINSIKSEV-------VNANND 622

Query: 753  QDYINCLLYCISELATSLIQPTEIIENDALLQRLSEFQSFWSSDPLQIRSKIMCTIDKVL 812
            +D I CLL C+SEL ++ IQ  E  E+ A L +LS FQ+FW  DPL +R +I+  ++ +L
Sbjct: 623  RDQILCLLSCLSELGSAFIQSDEF-EDPAYLSQLSHFQTFWQEDPLHLRVQILDMLESIL 681

Query: 813  DNSIYCKNSAFVEIGCLIVGKGLNLPDGEPYFLKYNMSEVMNFVLRHVPNCELATCLPYF 872
              +++ K+  F+E+ CLI+GK LN+ D EP+FL Y+M E+M+F+LR    CE ++ L + 
Sbjct: 682  --ALHGKDPEFIEVACLIMGKKLNVSDDEPHFLGYSMHELMDFLLRRCDTCEPSSGLSFI 739

Query: 873  VYLLEKLISEFRKELTPQEFDFMFEKILLVYYDAYIINDPDLLQMTIGFVNNVLDVKPGL 932
            +YLLEK++ ++R  L+PQ+F+FM     L  +   +  DPDL Q+ + FVN+V+D +PGL
Sbjct: 740  IYLLEKVVIQYRSSLSPQDFNFMLSSFFLEKHRDAVSADPDLTQLMVTFVNSVMDSRPGL 799

Query: 933  AIGSKHWTSFILPQFLKLIPSREKFTIVAVAKFWTKLINNKKYNQEELTTVRQQVSSIGG 992
            A+  + W  F+LP+F++L+ S+E+FTI AV KFWTK+INNKKY + +  TVR+Q+  +G 
Sbjct: 800  AVHCEQWAVFLLPEFMRLLSSKERFTISAVTKFWTKVINNKKYTRHDEVTVREQIFGLGL 859

Query: 993  DLVYQIMYGLFHTQRSDLNSYTDLLRALVAKFPIEAREWLVAVLPQICNNPAGHEKFINK 1052
            +L    M  L   QRS+LN Y+DLLRAL+A++P+++++WL+  LP +C N   H+  + K
Sbjct: 860  ELTNGTMSALLSAQRSELNFYSDLLRALIARYPLQSKQWLLQTLPLLCENHRAHQLLVEK 919

Query: 1053 LLITRGSRAA 1062
            L +TRGSRAA
Sbjct: 920  LFVTRGSRAA 929

>AGR166W [4477] [Homologous to ScYGL016W (KAP122) - SH]
            complement(1056332..1059373) [3042 bp, 1013 aa]
          Length = 1013

 Score =  541 bits (1395), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 350/1050 (33%), Positives = 548/1050 (52%), Gaps = 84/1050 (8%)

Query: 42   LANELLS-DDKYSANVKYFGALTLTVQLNTRGENDYETLWNVFRSNLLYLTKFSTLYVSN 100
            +A+ LLS +D     + YFGALT TVQL    E + +    +   NL++  +    Y++ 
Sbjct: 1    MAHALLSVEDDAQGLINYFGALTYTVQLYRNSETETQQA-ALLEGNLVHFARLLGTYLAA 59

Query: 101  PNMYGQSLIIIKKLMSNLSLIFTKINDPQLNNAGNENMIKQWNNPINTFIQLMSVQNQNI 160
            P    + L +++KLMSNL+ +F K+N      AG+ +    W NP++T + L+    Q  
Sbjct: 60   PE--KRFLQVLRKLMSNLARLFIKVNQ---KTAGSGD--PTWKNPVHTILFLLHAYRQGD 112

Query: 161  NADQLLLD---------SINCSLTYEQLSQFVSLSQKHNELALTFTEVIVEDLTKFQTKR 211
             +   L D         S++  + +E+L  F+  S + N   L    V+ EDLT  Q++R
Sbjct: 113  RSRWHLGDAQLSETVRASLHVEIPFEELIGFLDSSAELNRQMLLCVRVLAEDLTSEQSRR 172

Query: 212  HSMSQIHEVVHEHLYISTMALINLNLTAQ--------AVFNPTVFDCITAWINYISLTRS 263
              +  ++ +V +HLYI+ MA+IN  L           A     VF+ ITAWI Y+SL R+
Sbjct: 173  SPLHDVNALVRKHLYITAMAMINHTLEQSMLPENCLYAAAETVVFEAITAWIEYVSLVRT 232

Query: 264  VSSSGRMDLSEIFQNLIDLMYQSTEGSDGYENAEKILTIFGNVFANDPLLMSYDLRQQIE 323
             +S   MDL+++F++LI LM  S +GS  +  A+ ++ I  +V ++ P LM+ DLR Q+E
Sbjct: 233  -NSPDYMDLTDLFEHLIRLMCISCDGS--FPFADTVIRILSSVLSHHPELMNVDLRVQLE 289

Query: 324  CIFLGVVRPDSGITDISNK-NSWMLQYMNYLVTNDFFSELKELAICIVDFLQINTLSVCN 382
             IFLGV R D     +S + + WML YMN+LV    +  L +LA C+V FL +N L + +
Sbjct: 290  SIFLGVTRSDD--QQVSRQSHEWMLLYMNHLVAAGAYDGLSDLATCVVGFLNLNCLDISS 347

Query: 383  KLFTNIQAADNGQVQDEYIQEYIKVLLQMTNFPLTPVLQEFFSVRMVDFWLDLSDAYTNL 442
            +LFT    A N   Q   IQ+YIKVLLQ+TNFP  PVLQE +SV M  FW DL D+Y  L
Sbjct: 348  RLFTR---AHNDTSQ---IQQYIKVLLQLTNFPAAPVLQEVYSVHMTTFWQDLCDSYYGL 401

Query: 443  ASETLRPNSIELSTQIFQQLINIYLPKISLSVKQRII-----EEEGESTSVNEFEDFRNA 497
            +++ LRP+   ++  +F QL++IYLPK+SL  K +II     + E    S+++FE FRN 
Sbjct: 402  SADVLRPDGPAIAEDVFGQLVDIYLPKVSLINKLKIIDGTIGDAEQTRGSISKFEYFRNE 461

Query: 498  VSDLAQSLWSILGNDNLTNVLIDGMGQMPAASDETLIIKDTDVLFRIETMCFVLNTILVD 557
            V+ L    W ILGN  LTN LI  + +    S           LF++E M F+L  +L  
Sbjct: 462  VATLVAQSWMILGNSKLTNQLILKVCEQQRQSGSV-------DLFQVECMAFLLERLLEG 514

Query: 558  MTLSESPWIKNIVDANKFFNQNVISVFQTGFQTSASTKVSQILKLDFVRTSTTLIGTLAG 617
            + L E+P +  ++  ++   + ++ +   G +    T+  + LKL FV T + L+  L  
Sbjct: 515  VDLEETPQLCELIRESELM-EYIMYLLNAGCKQHMHTEGLEKLKLQFVDTGSALLRNLLT 573

Query: 618  YFKQEPFQLNPYVEALFQGLHTCTNFTSKNEQEKISNDKLEVMVIKTVSTLCETCREELT 677
            YFK     L   V  +F  +  C+ F S ++    +ND +E  +++T + LC  CR E+ 
Sbjct: 574  YFKVNQDSLIHVVGNIFSCMAECSRFNSPDD----TND-IEASLMQTFTALCNQCRHEMV 628

Query: 678  PYLMHFISFLNTVIMPDSNVSHFTRTKLVRSIGYVVQCQVSNGPEEQAKYILQLTNLLSG 737
            P     +  +  ++ P SN S   R  +VRS+ +++Q   S  P    K I  + +L   
Sbjct: 629  PLFPSLLGIMEQMLSPASNTSKSVRRDMVRSVSFIIQAGSSQDPISLGKDINNMLDLF-- 686

Query: 738  SIEHCLASSVQLQEQQDYINCLLYCISELATSLIQPTEIIENDAL-LQRLSEFQSFWSSD 796
                C  + V     +   N LL  I EL   L    E      + +      +    +D
Sbjct: 687  ----CATTDV---ADKKSTNALLTYILELGQGL----EDCSGGGIDVAGHKVLEKHVQAD 735

Query: 797  PLQIRSKIMCTIDKVLDNSIYCK----NSAFVEIGCLIVGKGLNLPDGEPYFLKYNMSEV 852
              QI  K++  I         CK    ++  ++  CLI+  GLN+    P+  ++ + ++
Sbjct: 736  LQQIHDKVLSVI------YAGCKQHNGDTNLIQTSCLIL--GLNVQSKPPHLFRFTVPQI 787

Query: 853  MNFVLRHVPNCELATCLPYFVYLLEKLISEFRKELTPQEFDFMFEKILLVYYDAYIINDP 912
            ++F+   +  C L  CLP+ + LLE+L+       + ++FD +     + +Y A I  DP
Sbjct: 788  LDFLFAQLALCNLGACLPHMIRLLERLLVHQLDAFSQEQFDHLLLSFFVQHY-ALIAEDP 846

Query: 913  DLLQMTIGFVNNVLDVKPGLAIGSKHWTSFILPQFLKLIPSREKFTIVAVAKFWTKLINN 972
            DL+     F    L  KP   + S H  SF+LP+FL  I ++E  TI A  +FW+  + N
Sbjct: 847  DLIHSMGTFFVTALQKKPAFVLRSAHMHSFVLPRFLDYIAAQESLTIRAAVRFWSLFLKN 906

Query: 973  KKYNQEELTTVRQQVSSIGGDLVYQIMYGLFHTQRSDLNSYTDLLRALVAKFPIEAREWL 1032
             +Y  ++   V   +S IG  LV   M  LFH +RS++NSYTD+LRALVA +PI+ + WL
Sbjct: 907  -RYLPDDRAAVTACMSLIGPQLVSNTMRALFHVRRSEINSYTDILRALVASYPIQTKAWL 965

Query: 1033 VAVLPQICNNPAGHEKFINKLLITRGSRAA 1062
             A + ++   P  H +FI  +L+TRGS AA
Sbjct: 966  SATMAKLDGRPEVHARFIESILVTRGSHAA 995

>YHR077C (NMD2) [2366] chr8
           complement(252375..255638,255752..255757) Protein
           involved with Nam7p and Upf3p in decay of mRNA
           containing nonsense codons [3270 bp, 1089 aa]
          Length = 1089

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 60/131 (45%), Gaps = 18/131 (13%)

Query: 394 GQVQDEYIQEYIKVLLQMTNFPLTPV-LQEFFSVRMVDFWLDLSDAYTNLAS-----ETL 447
           G+++DEY++EY K+L     F  + + L EFF + + +     +D     AS     + L
Sbjct: 272 GKLRDEYVEEYDKLLPIFIRFKTSAITLGEFFKLEIPELEGASNDDLKETASPMITNQIL 331

Query: 448 RPNSIELSTQIFQQLINIYLPKISLSVKQRIIEEEGESTSVN-----------EFEDFRN 496
            PN      +  ++   I LP IS +V++    +  + ++VN           E  D ++
Sbjct: 332 PPNQRLWENEDTRKFYEI-LPDISKTVEESQSSKTEKDSNVNSKNINLFFTDLEMADCKD 390

Query: 497 AVSDLAQSLWS 507
            + DL+   WS
Sbjct: 391 IIDDLSNRYWS 401

>Scas_645.3
          Length = 708

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 85/216 (39%), Gaps = 23/216 (10%)

Query: 159 NINADQLLLDSIN---CSLTYEQLSQFVSLS----QKHNELALTF--TEVIVEDLTKFQT 209
           + N D  LLD +N   C+  +++   ++          N + +T    +V +  L +F++
Sbjct: 452 DFNGDVELLDDLNDHWCAKHHKKERNYLIAKLQDFAAENGIRVTILSGDVHLASLGRFKS 511

Query: 210 KRHSMSQIHEVVHEHLYISTM------ALINLNLTAQAVFNPTVFDCITAWINYISLTRS 263
           K H    IHE  HE   ++T+        +  N+ + AV N      +   + + +    
Sbjct: 512 KIHKRHVIHEEEHEKENLATINNPENDVRLMFNVISSAVVNTPPPTAMAKLLQHRAPVHH 571

Query: 264 VSSSGRMDLSEIFQNLIDLMYQSTEGSDGYENAEKILTIFG--NVFANDPLLMSYDLRQQ 321
              S   D   IF+   D   +  E   G+ N      +    N+  ND L   + L+  
Sbjct: 572 FDFSTDEDSVPIFKFDTDGTTKRYEA--GFMNKRNWSDVIPVQNILQNDYLNGVFRLKMG 629

Query: 322 IECIFLGVVRPDSGITDISNKNSWMLQYMNYLVTND 357
            E +  G+VRP+ GI  +        Q   Y VT D
Sbjct: 630 -EMVIPGIVRPNEGILPVKTTEK---QDQGYPVTPD 661

>Sklu_2347.6 YML091C, Contig c2347 7585-11115 reverse complement
          Length = 1176

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 81/177 (45%), Gaps = 23/177 (12%)

Query: 347  LQYMNYLVTNDFFSELKELAICIVD------------FLQINTLS-VCNKLFTNIQAAD- 392
            LQ  NYL +   FS++  L   ++D             +++  LS + N L  ++Q  D 
Sbjct: 998  LQLANYLSSQSSFSDMVSLYRTVMDSNILLEKSKFNTAVKLELLSQMLNNLNDSLQFVDI 1057

Query: 393  -NGQVQDEYIQEYIKVLLQMTNFPLTPVLQEFFSVRMVDFW--LDLS--DAYTNLASETL 447
             N QVQ +Y+++ +K   +   F   P   E    ++++ W  +DL   DA+ N   ET+
Sbjct: 1058 QNEQVQAKYVEK-LKNYYRFRAFTKMPNFSEHEIYQLINIWSSVDLYAVDAFFNNIVETV 1116

Query: 448  RPNSIELSTQIFQQLINIYLPKISLSVKQRIIE---EEGESTSVNEFEDFRNAVSDL 501
              NS      I   L+  + PK   S+ +RI E    E +  S+ + + F++ +  L
Sbjct: 1117 YLNSNTRLLYIQNDLVFEFKPKQMFSLVERIEEFYRSEKDEESLKKVQSFKSVLKTL 1173

>Kwal_23.4689
          Length = 416

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 53/113 (46%), Gaps = 11/113 (9%)

Query: 712 VVQC-QVSNGPEEQAKYILQLTNLLSGSIEHCLASSVQLQEQQDYINCLLYCISELATSL 770
           VVQC +  +  EE  +++   T+L SGS        ++ ++    I   L    E +T+ 
Sbjct: 4   VVQCFEARHSSEELRQFLRYSTSLRSGS---STQKGIRNEKLAQLIQTTLALKQEYSTNC 60

Query: 771 IQPTEIIE-----ND--ALLQRLSEFQSFWSSDPLQIRSKIMCTIDKVLDNSI 816
              +  +E     N+   LL RLSE ++ W +DPL + +  +  +   LD ++
Sbjct: 61  TPSSPSVELFTLCNEQLKLLNRLSEGEAAWITDPLHLSATQLLHVATQLDAAV 113

>Sklu_2435.1 YPR127W, Contig c2435 1340-2374
          Length = 344

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 46/105 (43%), Gaps = 15/105 (14%)

Query: 935  GSKHWTSFILPQFLKLI----PSREKFTIVAVAKFWTKLINNKKYNQEELTTVRQQVSSI 990
            G     + +L QFL+ +    P  EK T   +A  W +   NKKYN  +L  +       
Sbjct: 249  GDSMKQNLVLVQFLQKLLSQRPDSEKITTPQLALAWIRSF-NKKYNSTKLIPIP------ 301

Query: 991  GGDLVYQIMYGL--FHTQRSDLNSYTDLLRALVAKFPIEAREWLV 1033
            GG  V +++  +  F    S+LN   D L+    K   +  EW+V
Sbjct: 302  GGTTVDKVVENMSEFELSDSELNQINDFLKNF--KTQGDRYEWIV 344

>CAGL0J05126g complement(484849..486150) highly similar to sp|P47039
           Saccharomyces cerevisiae YJL060w, hypothetical start
          Length = 447

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 5/76 (6%)

Query: 155 VQNQNINADQLLLDSINCSLTYEQLSQFVSLSQKHNELALTFTEVIVEDLTKFQ--TKRH 212
           ++ +N   D+  +D      T+   ++ V ++  HN +   FTE   ++LTK       H
Sbjct: 163 MKTRNTTGDEWQIDWDALEKTFNNKTKAVIINTPHNPIGKVFTE---QELTKLAQLCVEH 219

Query: 213 SMSQIHEVVHEHLYIS 228
           +   I + V+EHLY +
Sbjct: 220 NTVVISDEVYEHLYFT 235

>CAGL0L12804g 1369272..1370453 highly similar to sp|P39107
           Saccharomyces cerevisiae YPL050c required for complex
           N-glycosylation, start by similarity
          Length = 393

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 5/75 (6%)

Query: 452 IELSTQIFQQLINIYLPKISLSVKQRIIEEEGESTSVNEFEDFRN-AVSDLAQSLWSILG 510
           IE    + Q +  +  P ++ +V QR  +E     S+  + DF N A S +AQ L   +G
Sbjct: 238 IETKPSLIQDMTALNKPVLAANVYQRYFDEAENKPSIRPY-DFNNWADSQIAQELGDKMG 296

Query: 511 NDNLTNVLIDGMGQM 525
           +D    ++++G  ++
Sbjct: 297 DD---EIIVEGYAEI 308

>CAGL0K03333g 302891..304699 similar to sp|Q03162 Saccharomyces
           cerevisiae YMR100w involved in budding, start by
           similarity
          Length = 602

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 4/51 (7%)

Query: 939 WTSFILPQFLKLIPSREKFTIVAVAK----FWTKLINNKKYNQEELTTVRQ 985
           W SFI  Q +   P  EK+TI         +W+ +I      + E+T VRQ
Sbjct: 432 WNSFISKQLINAFPLVEKYTITDKNTHDIIYWSSVIMRNSCRKNEVTGVRQ 482

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 33,990,771
Number of extensions: 1484414
Number of successful extensions: 4835
Number of sequences better than 10.0: 27
Number of HSP's gapped: 4942
Number of HSP's successfully gapped: 27
Length of query: 1062
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 950
Effective length of database: 12,718,893
Effective search space: 12082948350
Effective search space used: 12082948350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)