Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YFR043C23723412471e-177
Sklu_2433.142502403423e-39
Kwal_47.192042502422911e-31
AFR248C3042382592e-26
CAGL0C02079g2652422562e-26
KLLA0A01089g2332062437e-25
Scas_699.392612482342e-23
CAGL0B04169g86184800.032
YDR289C (RTT103)40970643.1
Scas_679.1935236617.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YFR043C
         (234 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YFR043C (YFR043C) [1725] chr6 complement(239101..239814) Protein...   484   e-177
Sklu_2433.14 YFR043C, Contig c2433 23715-24467                        136   3e-39
Kwal_47.19204                                                         116   1e-31
AFR248C [3440] [Homologous to ScYFR043C - SH] (884696..885610) [...   104   2e-26
CAGL0C02079g 213832..214629 similar to sp|P43615 Saccharomyces c...   103   2e-26
KLLA0A01089g 102036..102737 weakly similar to sp|P43615 Saccharo...    98   7e-25
Scas_699.39                                                            95   2e-23
CAGL0B04169g complement(404713..407298) highly similar to tr|Q06...    35   0.032
YDR289C (RTT103) [1118] chr4 complement(1038272..1039501) Protei...    29   3.1  
Scas_679.19                                                            28   7.4  

>YFR043C (YFR043C) [1725] chr6 complement(239101..239814) Protein of
           unknown function [714 bp, 237 aa]
          Length = 237

 Score =  484 bits (1247), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 234/234 (100%), Positives = 234/234 (100%)

Query: 1   MVLQYPQNKILVLSDHPHNFLKTQFLQDLFHCSSTGISIVKDQTWENRYYKVHFDLYIDS 60
           MVLQYPQNKILVLSDHPHNFLKTQFLQDLFHCSSTGISIVKDQTWENRYYKVHFDLYIDS
Sbjct: 1   MVLQYPQNKILVLSDHPHNFLKTQFLQDLFHCSSTGISIVKDQTWENRYYKVHFDLYIDS 60

Query: 61  CKEIPVWVEEFITPECEPLRNVMAGIILITDIRQTKPQELLHQFMIAAHRNTFVVLANVN 120
           CKEIPVWVEEFITPECEPLRNVMAGIILITDIRQTKPQELLHQFMIAAHRNTFVVLANVN
Sbjct: 61  CKEIPVWVEEFITPECEPLRNVMAGIILITDIRQTKPQELLHQFMIAAHRNTFVVLANVN 120

Query: 121 EEVEQDEIDELNEIWSNAFTNVIEFVNWKRSKPTVNHNDYGEKLGLDRIQEIIDTHDWLN 180
           EEVEQDEIDELNEIWSNAFTNVIEFVNWKRSKPTVNHNDYGEKLGLDRIQEIIDTHDWLN
Sbjct: 121 EEVEQDEIDELNEIWSNAFTNVIEFVNWKRSKPTVNHNDYGEKLGLDRIQEIIDTHDWLN 180

Query: 181 CEVQPATKIREEIPNEMPLEQIIRNLQSARLKYKSIENSSEADAFANEMADELS 234
           CEVQPATKIREEIPNEMPLEQIIRNLQSARLKYKSIENSSEADAFANEMADELS
Sbjct: 181 CEVQPATKIREEIPNEMPLEQIIRNLQSARLKYKSIENSSEADAFANEMADELS 234

>Sklu_2433.14 YFR043C, Contig c2433 23715-24467
          Length = 250

 Score =  136 bits (342), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 137/240 (57%), Gaps = 20/240 (8%)

Query: 6   PQNKILVL-SDHPHNFLKTQFLQDLFHCS-STGISIVKDQTWENRYYKVHFDLYIDSCKE 63
           P+NKILV+ S    N  K   +  LF+ +  +G SI+K+ +W+N+YYK + D+YID    
Sbjct: 17  PRNKILVVCSAEIEN--KVSIISSLFNTNVDSGCSILKNLSWQNKYYKTNIDVYIDDYDS 74

Query: 64  IPVWVEEFITPECEPLRNVMAGIILITDIRQTKPQELLHQFMIAAHRN--TFVVLANVNE 121
           +  W  EF   E   LR V+AG+IL+ + R  +        + +  +N   F +  NV+ 
Sbjct: 75  LDEWTREFQQSEYNDLREVLAGVILLFNYRSEQTFSHFLDIINSTSQNDEKFYIACNVSS 134

Query: 122 EVEQDEIDELNEIWSNAFTNVIEFVNWKRSKPTVNHNDYGEKLGLDRIQEIIDTHDWLNC 181
           +++ +E + L++   N   + +E +NW+ S      N +G+KLGL+RI+EIIDTH+W  C
Sbjct: 135 KIDAEEWESLSD---NYIAHGLELINWEES----GKNAFGDKLGLERIREIIDTHEWTQC 187

Query: 182 EV----QPATKIREEIPN---EMPLEQIIRNLQSARLKYKSIENSSEADAFANEMADELS 234
           E+    QP   +   + +   E  LE+++  L  AR +Y+S+ N  EA+ FA E+++EL+
Sbjct: 188 ELDVKEQPTIGVGSLLQDESAEFTLEEVLEKLNEARSRYQSMNNKDEAEMFAQEISEELT 247

>Kwal_47.19204
          Length = 250

 Score =  116 bits (291), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 129/242 (53%), Gaps = 29/242 (11%)

Query: 7   QNKILV-LSDHPHNFLKTQFLQDLFHCSSTGISIVKDQT------WENRYYKVHFDLYID 59
           ++KI+V  S++ H+  + + + DLF     GIS   DQ       W  +YY V  DLYID
Sbjct: 21  RDKIIVCFSNYVHD--QAEVISDLF-----GISFKDDQRIHHDLEWTTKYYSVKIDLYID 73

Query: 60  SCKEIPVWVEEFITPECEPLRNVMAGIILITDIR-QTKPQELLHQFM--IAAHRNTFVVL 116
           S   +  WV++F   EC+ LR+V+AG++L+   + +    E   Q    +A   + FVVL
Sbjct: 74  SFDSLRDWVQQFCNSECDELRDVLAGLVLVVPCKVEDADLETFTQLADCMADAESFFVVL 133

Query: 117 ANVNEEVEQDEIDELNEIWSNAFTNVIEFVNWKRSKPTVNHNDYGEKLGLDRIQEIIDTH 176
              +   E+      N++ +N     +E V     +     N+YGE +G +R++EIIDT+
Sbjct: 134 KARSNPSEECTDSSENKLLANG----VEIV----CRGDSGRNEYGEVIGTNRVREIIDTY 185

Query: 177 DW----LNCEVQPATKIREEIPNEMPLEQIIRNLQSARLKYKSIENSSEADAFANEMADE 232
           DW    L      ATK  E+  + +PL +I+  LQ AR KY ++++S E + FA ++A E
Sbjct: 186 DWQTQLLKLRQPSATKELEDTSSGLPLNEIMTRLQEARTKYLAMDSSEEREIFARDVAHE 245

Query: 233 LS 234
           LS
Sbjct: 246 LS 247

>AFR248C [3440] [Homologous to ScYFR043C - SH] (884696..885610) [915
           bp, 304 aa]
          Length = 304

 Score =  104 bits (259), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/238 (28%), Positives = 121/238 (50%), Gaps = 22/238 (9%)

Query: 6   PQNKILVLSDHPHNFLKTQFLQDLFHC-SSTGISIVKDQTWENRYYKVHFDLYIDSCKEI 64
           P+NKIL+L+     + + + ++DLF+  +S    IV+D  W N+YY+V  DLYIDS + +
Sbjct: 74  PRNKILILAPAGKAY-QAEVIRDLFNIEASESDRIVRDVKWSNKYYEVDLDLYIDSYESL 132

Query: 65  PVWVEEFITPECEPLRNVMAGIILITDIRQTKPQELLHQFMIAAH--RNTFVVLANVNEE 122
             W  EF + EC  LR+V+AGI L+    +T+  E   Q +   H      +V  +++  
Sbjct: 133 QTWGAEFCSDECADLRDVVAGIFLV--FEETEDAETFQQLIEDCHFTDERVLVACDLSSA 190

Query: 123 VEQDEIDELNEIWSNAFTNVIEFVNWKRSKPTVNHNDYGEKLGLDRIQEIIDTHDW---- 178
                ++   E+      + +  V W+        N+ GE+ G +R++E++D H W    
Sbjct: 191 EHPASLERALEV------HDVALVRWRER----GTNELGEQQGRERVRELLDIHPWSERM 240

Query: 179 LNCEVQPATKIREEIP--NEMPLEQIIRNLQSARLKYKSIENSSEADAFANEMADELS 234
           L      A  + E  P   ++PL+ ++  ++ AR +Y  I +   AD +A  +A EL+
Sbjct: 241 LRMHASTAAALAELDPLQADIPLDSVVTRIKQARERYLEITDVHAADEYAARIAHELT 298

>CAGL0C02079g 213832..214629 similar to sp|P43615 Saccharomyces
           cerevisiae YFR043c, hypothetical start
          Length = 265

 Score =  103 bits (256), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/242 (30%), Positives = 126/242 (52%), Gaps = 29/242 (11%)

Query: 8   NKILVLSDHPHNFLKTQFLQDLFHCSSTGISIVKDQTWENRYYKVHFDLYIDSCKEIPVW 67
           NK+LV+ +      + Q L  +F     G +IVK  +W+ +YY V +DLY+D C +I  W
Sbjct: 35  NKVLVVFEGESTLFRDQLLDTVFGVQDQG-NIVKQLSWDTKYYAVEYDLYVDECVDIHGW 93

Query: 68  VEEFITPECEPLRNVMAGIILITDIRQTKPQE----LLHQFMIAAHRNTFVVLANVNEEV 123
           + E  + + E LR+++  II++     T+  +    +L+ F+     +   V  N   +V
Sbjct: 94  LNEVNSDDYEELRDLLTMIIIVRSFDSTQDTKEYNSVLYDFIQGNSVSVISVNTNSARQV 153

Query: 124 EQDEIDELNEIWSNAFTNVIEFVNWKRSKPTVNHNDYGEK-----LGLDRIQEIIDTHDW 178
            +D  DE  E+ +++    IEF+N+        H+D  EK      G+ R++EIIDTH W
Sbjct: 154 -KDTYDEFLELDASS----IEFINY--------HDDRVEKETNECKGMARLKEIIDTHPW 200

Query: 179 LNCEVQPATK-IREEIPNEMPLEQIIRNLQSARLKYKSIENSS-----EADAFANEMADE 232
            +C+V    K    +  N+  LE +I  L+ A++ Y+ + N S     EA+ FA +MA +
Sbjct: 201 TDCKVVLKNKESTSDKVNKPDLEYLIDTLKKAKIHYQKLSNGSDGFSEEAEQFALQMATD 260

Query: 233 LS 234
           ++
Sbjct: 261 IA 262

>KLLA0A01089g 102036..102737 weakly similar to sp|P43615
           Saccharomyces cerevisiae YFR043c hypothetical protein
           singleton, hypothetical start
          Length = 233

 Score = 98.2 bits (243), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 111/206 (53%), Gaps = 21/206 (10%)

Query: 38  SIVKDQTWENRYYKVHFDLYIDSCKEIPVWVEEFITPECEPLRNVMAGIILI-TDIRQTK 96
           SI +D  W+ +YY+   DLYID+   +  WV +F++ EC+ LR+V++GII +  D     
Sbjct: 36  SIARDVQWKTKYYETTLDLYIDTYDVLQEWVNDFVSDECKELRDVISGIIFVFKDEDHKP 95

Query: 97  PQELLHQFM---IAAHRNTFVVLANVNEEV-EQDEIDELNEIWSNAFTNVIEFVNW-KRS 151
           P E L   +   I      F +    NE V E+DE+ ELN   S+      E VNW  + 
Sbjct: 96  PVECLKNLIDERIEDFTAKFFIGCYFNENVIEEDELYELN---SDLLVQNFEIVNWFDKP 152

Query: 152 KPTVNHNDYGEKLGLDRIQEIIDTHDWLNCEVQPAT-KIREEIPNEMP--LEQIIRNLQS 208
            P+++      K+G +RI+EIID H WL+    P T K  +   N  P  L+  +  L+ 
Sbjct: 153 DPSMD------KVGSERIKEIIDVHPWLS---HPETLKKNQGQINISPIDLDSFMTKLEQ 203

Query: 209 ARLKYKSIENSSEADAFANEMADELS 234
           A+ +Y++ ++S EA+ F  ++ DELS
Sbjct: 204 AKERYQTFDDSKEAELFIEKIIDELS 229

>Scas_699.39
          Length = 261

 Score = 94.7 bits (234), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 132/248 (53%), Gaps = 26/248 (10%)

Query: 6   PQNKILVLSDH---PHNFLKTQFLQDLFHC---SSTGISIVKDQTWENRYYKVHFDLYID 59
           PQNKILV+ +    P   L+ +FLQ  F     + +  SI+K   W+N+Y+++  DLYID
Sbjct: 7   PQNKILVVFNKNRIPQT-LQREFLQRTFDLPIENDSSDSIIKGIIWKNKYFELQLDLYID 65

Query: 60  SCKEIPVWVEEFITPECEPLRNVMAGIILITDIRQTKPQELLHQFMIAAHRNT---FVVL 116
             ++   +V E+   E   LR+V+AGII+I D    +  +L+++    +   T   F+V+
Sbjct: 66  EFEDFEEFVYEYCLDEMSELRSVIAGIIIIDDTYHFEDNKLVNKLQTDSGSETSSSFMVI 125

Query: 117 ANVNEEVEQDEIDELNEIW---SNAFTN----VIEFVNWKRSKPTVNHNDYGEKLGLDRI 169
            N   + E+++I +    W   S + TN    + E+V   +    +  N  G+K+G+  I
Sbjct: 126 GNFEGDYEEEDIAQ----WRFPSESMTNDEDIIAEYVPLDKHF-RMEKNSLGDKVGVPGI 180

Query: 170 QEIIDTHDW-LNCEVQPATKIREEIPN---EMPLEQIIRNLQSARLKYKSIENSSEADAF 225
           +E +D H+W  NC +Q   +I+   P    ++ +  II  L+ AR+ +++ ++  EA + 
Sbjct: 181 KEKLDLHEWNPNCNIQKLDQIQPTHPPSNMDVDISAIINQLRDARINFQTHKDQEEAKSI 240

Query: 226 ANEMADEL 233
           A  +A+ +
Sbjct: 241 ATALAESI 248

>CAGL0B04169g complement(404713..407298) highly similar to tr|Q06106
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 861

 Score = 35.4 bits (80), Expect = 0.032,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 44/84 (52%), Gaps = 5/84 (5%)

Query: 143 IEFVNWKRSKPTVNHNDYGEKLGLDRIQEIIDTHDWLNCEVQPATKIREEIPNEMPLEQI 202
           I  ++W + +  V   + GEK+G +    + D     N +  PA +++EEIP+E   EQ 
Sbjct: 262 ISDMDWIKQR-RVRIRENGEKVGEEFATNVQDKESEENSQATPAEELQEEIPDE---EQA 317

Query: 203 IRNLQ-SARLKYKSIENSSEADAF 225
           I  +Q + RL  ++I  SS  D F
Sbjct: 318 IAKIQKTGRLFLRNILYSSTEDDF 341

>YDR289C (RTT103) [1118] chr4 complement(1038272..1039501) Protein
           involved in Ty1 transposition, has similarity to Spt8p
           [1230 bp, 409 aa]
          Length = 409

 Score = 29.3 bits (64), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 34/70 (48%), Gaps = 1/70 (1%)

Query: 57  YIDSCKEIPVWVEEFITPECEPLRNVMAGIILITDIRQTKPQELLHQFMIAAHRNTFVVL 116
           Y D+ K   +W E  + P     R ++   ++   ++Q K Q+++ QF  +  +    VL
Sbjct: 33  YRDAPKVAEMWKEYMLRPSVNTRRKLLGLYLMNHVVQQAKGQKII-QFQDSFGKVAAEVL 91

Query: 117 ANVNEEVEQD 126
             +N+E  +D
Sbjct: 92  GRINQEFPRD 101

>Scas_679.19
          Length = 352

 Score = 28.1 bits (61), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 21/36 (58%)

Query: 139 FTNVIEFVNWKRSKPTVNHNDYGEKLGLDRIQEIID 174
           F  V+ F  +K+ +PT+   + G K  L +++ IID
Sbjct: 95  FQAVVRFKEFKKGRPTLYRMNTGRKYPLLQLESIID 130

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,147,648
Number of extensions: 358703
Number of successful extensions: 1053
Number of sequences better than 10.0: 18
Number of HSP's gapped: 1041
Number of HSP's successfully gapped: 18
Length of query: 234
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 136
Effective length of database: 13,203,545
Effective search space: 1795682120
Effective search space used: 1795682120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)