Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YFR042W2001989491e-132
Kwal_47.192032351935884e-77
Scas_687.172221895311e-68
Sklu_2433.152101955195e-67
CAGL0C02101g1971914924e-63
KLLA0A01111g2091974536e-57
AFR247W2111944397e-55
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YFR042W
         (198 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YFR042W (YFR042W) [1724] chr6 (238445..239047) Protein of unknow...   370   e-132
Kwal_47.19203                                                         231   4e-77
Scas_687.17                                                           209   1e-68
Sklu_2433.15 YFR042W, Contig c2433 24495-25127 reverse complement     204   5e-67
CAGL0C02101g complement(214712..215305) similar to sp|P43614 Sac...   194   4e-63
KLLA0A01111g complement(102802..103431) similar to sp|P43614 Sac...   179   6e-57
AFR247W [3439] [Homologous to ScYFR042W - SH] complement(884059....   173   7e-55

>YFR042W (YFR042W) [1724] chr6 (238445..239047) Protein of unknown
           function [603 bp, 200 aa]
          Length = 200

 Score =  370 bits (949), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 186/198 (93%), Positives = 186/198 (93%)

Query: 1   MAGIKLTHKLYQYYQLATSFLYAALLIRWLILMPLVGSRFLPGGIHEFLIYLMFYSSIME 60
           MAGIKLTHKLYQYYQLATSFLYAALLIRWLILMPLVGSRFLPGGIHEFLIYLMFYSSIME
Sbjct: 1   MAGIKLTHKLYQYYQLATSFLYAALLIRWLILMPLVGSRFLPGGIHEFLIYLMFYSSIME 60

Query: 61  VIWLLRFHGFKYGLLSRTFLKDLNFIYLVSVIHFYDDYEHALILKNAXXXXXXXXXXXXQ 120
           VIWLLRFHGFKYGLLSRTFLKDLNFIYLVSVIHFYDDYEHALILKNA            Q
Sbjct: 61  VIWLLRFHGFKYGLLSRTFLKDLNFIYLVSVIHFYDDYEHALILKNASYSSFIISLSLSQ 120

Query: 121 AYCHWCKLFKRKGVKERTLVWKVNTFVTLPILYLSEFALLLLNIQVKNYHSTPTLDIINR 180
           AYCHWCKLFKRKGVKERTLVWKVNTFVTLPILYLSEFALLLLNIQVKNYHSTPTLDIINR
Sbjct: 121 AYCHWCKLFKRKGVKERTLVWKVNTFVTLPILYLSEFALLLLNIQVKNYHSTPTLDIINR 180

Query: 181 VVLLAYFPVLLTAYKKLL 198
           VVLLAYFPVLLTAYKKLL
Sbjct: 181 VVLLAYFPVLLTAYKKLL 198

>Kwal_47.19203
          Length = 235

 Score =  231 bits (588), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 108/193 (55%), Positives = 141/193 (73%)

Query: 6   LTHKLYQYYQLATSFLYAALLIRWLILMPLVGSRFLPGGIHEFLIYLMFYSSIMEVIWLL 65
           L  +LYQY++L++S L+AAL+ RW +L PLVGS+FLPGGIHEFL YLM Y+   E++W  
Sbjct: 40  LKSRLYQYFRLSSSLLFAALVARWAVLFPLVGSKFLPGGIHEFLCYLMLYAGFFEIVWTY 99

Query: 66  RFHGFKYGLLSRTFLKDLNFIYLVSVIHFYDDYEHALILKNAXXXXXXXXXXXXQAYCHW 125
            F GFK  LLSRT LKD++F+Y V ++HFYDDYEHAL+LKN             Q YCHW
Sbjct: 100 AFRGFKRTLLSRTLLKDVSFLYWVGILHFYDDYEHALVLKNISYSTFIVTLGLSQTYCHW 159

Query: 126 CKLFKRKGVKERTLVWKVNTFVTLPILYLSEFALLLLNIQVKNYHSTPTLDIINRVVLLA 185
           CKLFK       T++WK++TF+TLPILYLSEF LLLLN+Q  N+HS   L+I+N+VVL+ 
Sbjct: 160 CKLFKSPSKNRNTILWKIDTFLTLPILYLSEFYLLLLNVQTPNFHSYHWLEIVNKVVLII 219

Query: 186 YFPVLLTAYKKLL 198
           + P+ L A++K L
Sbjct: 220 FIPISLHAFRKQL 232

>Scas_687.17
          Length = 222

 Score =  209 bits (531), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 117/189 (61%), Positives = 144/189 (76%)

Query: 8   HKLYQYYQLATSFLYAALLIRWLILMPLVGSRFLPGGIHEFLIYLMFYSSIMEVIWLLRF 67
           +KLYQYYQL+TSFL+AALL RWLI+ PL G+RFLPGG+HEFL YLM Y+S+ E+IWL +F
Sbjct: 30  YKLYQYYQLSTSFLFAALLARWLIIFPLAGARFLPGGVHEFLCYLMIYASVGEIIWLFKF 89

Query: 68  HGFKYGLLSRTFLKDLNFIYLVSVIHFYDDYEHALILKNAXXXXXXXXXXXXQAYCHWCK 127
           +  K  + S+T LKDLNFIY V V+HFYDDYEHAL+LKN             QAY HWCK
Sbjct: 90  YPLKSVIFSKTLLKDLNFIYFVLVLHFYDDYEHALVLKNISYSVFIIGLSLNQAYHHWCK 149

Query: 128 LFKRKGVKERTLVWKVNTFVTLPILYLSEFALLLLNIQVKNYHSTPTLDIINRVVLLAYF 187
           LFKR G K+ TLV+KVN  +  P+LYLSE+ LLLLN+Q  N+HSTP LDIINR++L+ YF
Sbjct: 150 LFKRSGRKKNTLVFKVNNLLGSPLLYLSEYYLLLLNVQNPNFHSTPLLDIINRIILIIYF 209

Query: 188 PVLLTAYKK 196
           P+ L  Y+ 
Sbjct: 210 PIALAVYRN 218

>Sklu_2433.15 YFR042W, Contig c2433 24495-25127 reverse complement
          Length = 210

 Score =  204 bits (519), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 135/195 (69%)

Query: 2   AGIKLTHKLYQYYQLATSFLYAALLIRWLILMPLVGSRFLPGGIHEFLIYLMFYSSIMEV 61
           +GI +  +LYQYY+L+ SFL+AALL RWL+L+PLVG++FLPGGIHE+L YL+ Y+S  E+
Sbjct: 11  SGIGIVSRLYQYYRLSASFLFAALLARWLVLLPLVGTKFLPGGIHEYLCYLILYASFGEL 70

Query: 62  IWLLRFHGFKYGLLSRTFLKDLNFIYLVSVIHFYDDYEHALILKNAXXXXXXXXXXXXQA 121
             L  FHG    L S T LK+LN +Y V+V+HFYDDYEHA +LKN+            Q 
Sbjct: 71  FCLFGFHGLFGALTSSTLLKNLNMLYFVAVMHFYDDYEHAPVLKNSSYSSFIIGLSFTQM 130

Query: 122 YCHWCKLFKRKGVKERTLVWKVNTFVTLPILYLSEFALLLLNIQVKNYHSTPTLDIINRV 181
           YCHW KLFK    ++ ++  KV+T   +P+ YLSEF L LLN+Q  N+HST  LD +N+ 
Sbjct: 131 YCHWKKLFKHTHGRKNSIWRKVDTLAMMPLFYLSEFYLFLLNVQNPNFHSTLLLDRLNKF 190

Query: 182 VLLAYFPVLLTAYKK 196
           VL+A+ P+ L  +KK
Sbjct: 191 VLVAFIPLSLHMFKK 205

>CAGL0C02101g complement(214712..215305) similar to sp|P43614
           Saccharomyces cerevisiae YFR042w, hypothetical start
          Length = 197

 Score =  194 bits (492), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 134/191 (70%), Gaps = 2/191 (1%)

Query: 7   THKLYQYYQLATSFLYAALLIRWLILMPLVGSRFLPGGIHEFLIYLMFYSSIMEVIWLLR 66
           THKL+Q YQL T+ LY AL  RWL+LMPLVGSR+LPGGIHE+L YL+   S+ EV+W L 
Sbjct: 3   THKLFQLYQLQTTLLYLALFGRWLVLMPLVGSRYLPGGIHEYLCYLLVIVSVFEVLWSLY 62

Query: 67  FHGFKYGLLSRTFLKDLNFIYLVSVIHFYDDYEHALILKNAXXXXXXXXXXXXQAYCHWC 126
           FHG + G +S+  LK LN++YLV  +HFYDDYEHA +LK +            ++Y HWC
Sbjct: 63  FHGLR-GFISQRVLKSLNYLYLVLNLHFYDDYEHAPLLKTSAYSTFIIGVSLVESYQHWC 121

Query: 127 KLFKR-KGVKERTLVWKVNTFVTLPILYLSEFALLLLNIQVKNYHSTPTLDIINRVVLLA 185
           +LFKR    K  T  WK  ++V LP LYLSEF LLLLN Q+ N+H+T  L+++N VVL+ 
Sbjct: 122 RLFKRGPNYKRETRYWKFISYVMLPCLYLSEFVLLLLNRQLPNHHTTEQLELVNTVVLIL 181

Query: 186 YFPVLLTAYKK 196
           YFP+ LT YK+
Sbjct: 182 YFPMALTVYKR 192

>KLLA0A01111g complement(102802..103431) similar to sp|P43614
           Saccharomyces cerevisiae YFR042w hypothetical protein
           singleton, start by similarity
          Length = 209

 Score =  179 bits (453), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 84/197 (42%), Positives = 130/197 (65%), Gaps = 3/197 (1%)

Query: 5   KLTHKLYQYYQLATSFLYAALLIRWLILMPLVGSRFLPGGIHEFLIYLMFYSSIMEVIWL 64
           +L  KLYQ++ ++++FLY ALL+RWL+L+PLV  ++LPGGIH FL  LM YS++  ++W 
Sbjct: 11  RLVVKLYQFFHISSAFLYCALLVRWLVLLPLVSRKYLPGGIHRFLCCLMVYSAVGNILWW 70

Query: 65  LRFHGFKYGLLSRTFLKDLNFIYLVSVIHFYDDYEHALILKNAXXXXXXXXXXXXQAYCH 124
           ++  G  + + +R  LK++N IYLV+++HFYDD+EH+ +LKN             Q Y H
Sbjct: 71  IKMRGLAWSIFNRHNLKNINLIYLVAILHFYDDFEHSPLLKNTSYSSFIVGLSFTQMYYH 130

Query: 125 WCKLFKRKGVKER---TLVWKVNTFVTLPILYLSEFALLLLNIQVKNYHSTPTLDIINRV 181
           W ++FK    + R   +L  ++N F+ +P+LYLSEF LLLLN ++ NYH+ P   + N+ 
Sbjct: 131 WNRIFKGPSPEPRSSKSLASRLNAFIMIPLLYLSEFYLLLLNTEIDNYHNGPKTVLFNKF 190

Query: 182 VLLAYFPVLLTAYKKLL 198
           VL+ + P+ L  YK  L
Sbjct: 191 VLVVFIPLCLHLYKGFL 207

>AFR247W [3439] [Homologous to ScYFR042W - SH]
           complement(884059..884694) [636 bp, 211 aa]
          Length = 211

 Score =  173 bits (439), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 93/194 (47%), Positives = 130/194 (67%), Gaps = 1/194 (0%)

Query: 5   KLTHKLYQYYQLATSFLYAALLIRWLILMPLVGSRFLPGGIHEFLIYLMFYSSIMEVIWL 64
            +  + YQ+Y+L+  FLYAAL+ RWL L PLVG+R++PGGIH FLIYL+  S+++EV+W+
Sbjct: 17  SMVSRAYQFYRLSCMFLYAALVARWLALFPLVGTRWVPGGIHGFLIYLLGGSAVLEVLWM 76

Query: 65  LRFHGFKYGLLSRTFLKDLNFIYLVSVIHFYDDYEHALILKNAXXXXXXXXXXXXQAYCH 124
           + F+ F  GL +RT LK  N +Y V+V+HFYDDYEHA +LKN             QA  H
Sbjct: 77  IWFYRFTKGLWTRTLLKCANMLYFVAVMHFYDDYEHAPVLKNIGYSIFILSIGMNQALHH 136

Query: 125 WCKLFKRKGVKERTLVWKVNTFVTLPILYLSEFALLLLNIQVKNYHSTPTLDIINRVVLL 184
             +LF+ +  +        +TFV  P LY+S+F LLLLN+Q  ++HSTP LDIINR VL+
Sbjct: 137 GGRLFRGRRRRRSWWWRS-DTFVLQPALYISQFYLLLLNVQNPSFHSTPKLDIINRTVLV 195

Query: 185 AYFPVLLTAYKKLL 198
           AY P+ L  +++ L
Sbjct: 196 AYVPLALQCFRRQL 209

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.333    0.147    0.462 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,016,650
Number of extensions: 225192
Number of successful extensions: 527
Number of sequences better than 10.0: 10
Number of HSP's gapped: 523
Number of HSP's successfully gapped: 10
Length of query: 198
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 102
Effective length of database: 13,272,781
Effective search space: 1353823662
Effective search space used: 1353823662
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 59 (27.3 bits)