Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YFR041C29529113470.0
Scas_687.183132317081e-92
Sklu_2433.162992736991e-91
CAGL0C02123g2972766834e-89
KLLA0A01133g2772476415e-83
Kwal_47.191983002725853e-74
AFR246C2882255382e-67
CAGL0F03729g361741204e-07
KLLA0E01628g231631167e-07
YMR161W (HLJ1)224631151e-06
Scas_669.2224631141e-06
YNL064C (YDJ1)409731152e-06
Kwal_26.9024375741133e-06
CAGL0H04499g232631105e-06
AFL190C235641106e-06
CAGL0J09966g407591116e-06
YMR214W (SCJ1)377741117e-06
KLLA0C07260g368671091e-05
Kwal_23.4830411661072e-05
CAGL0I09526g296861043e-05
Scas_692.34375741053e-05
AER346W367741044e-05
Scas_694.20410661035e-05
Kwal_14.24526071051038e-05
ADL257C41066973e-04
KLLA0E07876g49554974e-04
KLLA0F03333g40973964e-04
YGL128C (CWC23)28374955e-04
KLLA0D04818g35466955e-04
YJL073W (JEM1)64575965e-04
KLLA0E04345g42869948e-04
CAGL0H03707g34952930.001
Sklu_2257.642990930.001
Scas_542.228076920.001
ADR015W43688930.001
AAL008W34952920.001
Scas_471.17937830.002
ADR124C61186890.004
Scas_488.336751880.004
Scas_709.341490880.004
YIR004W (DJP1)43288880.004
CAGL0J02750g38288880.004
YNL007C (SIS1)35252880.005
Kwal_0.20735367870.006
CAGL0J01936g42590870.006
Scas_695.1432751860.006
Kwal_47.1813339388870.007
KLLA0D13464g43390870.007
Sklu_2442.134847860.007
YNL077W (APJ1)52854860.008
ADL327W305112850.010
Kwal_55.2096542188850.012
Sklu_2422.1067867840.016
CAGL0I06226g45598830.019
Scas_711.4063598830.020
AFR507W47464820.023
Kwal_23.306145871820.023
AAL103W669116810.039
KLLA0D06402g63194800.044
KLLA0F19184g51275800.051
Sklu_2174.639388790.060
Scas_715.2938773780.080
AER427W47053780.082
CAGL0J10296g47969770.094
CAGL0L12276g45277770.12
AGR084C42785760.15
Scas_564.1*45760760.15
YER048C (CAJ1)39169750.15
CAGL0H02827g65671750.23
CAGL0L00957g37388730.33
KLLA0C09823g66966730.35
Kwal_56.2378241494720.43
Kwal_33.1345128787710.44
Scas_707.19519102720.46
Scas_532.261651700.73
ABL194C55266700.85
YJR097W17285680.88
CAGL0J07370g62367691.0
Kwal_26.887965665691.2
YNL227C59056681.3
CAGL0G07469g668112681.5
Sklu_1935.146155681.5
AFR659W27359671.7
YLR090W (XDJ1)45959671.7
Sklu_2109.465865671.8
CAGL0J07964g74560671.9
KLLA0D07656g47169672.0
KLLA0C02981g16287642.2
Scas_653.14669116662.8
Scas_674.27106753653.5
Kwal_14.117428469634.7
Scas_651.1749178634.8
Kwal_33.1353316181615.6
Kwal_23.442059257628.0
CAGL0E01881g50849618.9
Sklu_1951.448285619.1
KLLA0C02541g27056619.2
KLLA0D19602g62067619.3
CAGL0G00154g43370619.8
YJL162C48267619.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YFR041C
         (291 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YFR041C (YFR041C) [1723] chr6 complement(237355..238242) Protein...   523   0.0  
Scas_687.18                                                           277   1e-92
Sklu_2433.16 YFR041C, Contig c2433 25259-26158                        273   1e-91
CAGL0C02123g 215564..216457 similar to sp|P43613 Saccharomyces c...   267   4e-89
KLLA0A01133g 103746..104579 similar to sp|P43613 Saccharomyces c...   251   5e-83
Kwal_47.19198                                                         229   3e-74
AFR246C [3438] [Homologous to ScYFR041C - SH] (883075..883941) [...   211   2e-67
CAGL0F03729g complement(362972..364057) similar to sp|P25303 Sac...    51   4e-07
KLLA0E01628g 155088..155783 weakly similar to sp|P48353 Saccharo...    49   7e-07
YMR161W (HLJ1) [4116] chr13 (577717..578391) Endoplasmic reticul...    49   1e-06
Scas_669.2                                                             49   1e-06
YNL064C (YDJ1) [4526] chr14 complement(505866..507095) Protein i...    49   2e-06
Kwal_26.9024                                                           48   3e-06
CAGL0H04499g complement(427509..428207) similar to sp|P48353 Sac...    47   5e-06
AFL190C [3005] [Homologous to ScYMR161W (HLJ1) - SH] (84145..848...    47   6e-06
CAGL0J09966g complement(976568..977791) highly similar to sp|P25...    47   6e-06
YMR214W (SCJ1) [4170] chr13 (695349..696482) Homolog of E. coli ...    47   7e-06
KLLA0C07260g complement(632987..634093) similar to sp|P25303 Sac...    47   1e-05
Kwal_23.4830                                                           46   2e-05
CAGL0I09526g 911127..912017 weakly similar to sp|P52868 Saccharo...    45   3e-05
Scas_692.34                                                            45   3e-05
AER346W [2847] [Homologous to ScYMR214W (SCJ1) - SH] complement(...    45   4e-05
Scas_694.20                                                            44   5e-05
Kwal_14.2452                                                           44   8e-05
ADL257C [1484] [Homologous to ScYNL064C (YDJ1) - SH] (249514..25...    42   3e-04
KLLA0E07876g complement(709306..710793) weakly similar to sp|P53...    42   4e-04
KLLA0F03333g complement(313991..315220) similar to sp|P25491 Sac...    42   4e-04
YGL128C (CWC23) [1858] chr7 complement(269297..270148) Protein p...    41   5e-04
KLLA0D04818g complement(411615..412679) similar to sp|P25294 Sac...    41   5e-04
YJL073W (JEM1) [2839] chr10 (303097..305034) DnaJ-like protein r...    42   5e-04
KLLA0E04345g complement(400495..401781) similar to sp|P39101 Sac...    41   8e-04
CAGL0H03707g complement(341230..342279) highly similar to sp|P25...    40   0.001
Sklu_2257.6 YIR004W, Contig c2257 8880-10169 reverse complement        40   0.001
Scas_542.2                                                             40   0.001
ADR015W [1756] [Homologous to ScYIR004W (DJP1) - SH] complement(...    40   0.001
AAL008W [179] [Homologous to ScYNL007C (SIS1) - SH] complement(3...    40   0.001
Scas_471.1                                                             37   0.002
ADR124C [1865] [Homologous to ScYJL073W (JEM1) - SH] (926131..92...    39   0.004
Scas_488.3                                                             39   0.004
Scas_709.3                                                             39   0.004
YIR004W (DJP1) [2669] chr9 (363218..364516) Protein required for...    39   0.004
CAGL0J02750g complement(270406..271554) highly similar to sp|P39...    39   0.004
YNL007C (SIS1) [4578] chr14 complement(618506..619564) Protein r...    39   0.005
Kwal_0.207                                                             38   0.006
CAGL0J01936g complement(190181..191458) highly similar to sp|P40...    38   0.006
Scas_695.14                                                            38   0.006
Kwal_47.18133                                                          38   0.007
KLLA0D13464g complement(1159251..1160552) similar to sp|P40564 S...    38   0.007
Sklu_2442.1 YNL007C, Contig c2442 2508-3554 reverse complement         38   0.007
YNL077W (APJ1) [4513] chr14 (481390..482976) Protein induced by ...    38   0.008
ADL327W [1414] [Homologous to ScYPR061C - SH] complement(123853....    37   0.010
Kwal_55.20965                                                          37   0.012
Sklu_2422.10 YNL227C, Contig c2422 20011-22047 reverse complement      37   0.016
CAGL0I06226g 597520..598887 some similarities with sp|P46997 Sac...    37   0.019
Scas_711.40                                                            37   0.020
AFR507W [3699] [Homologous to ScYFL016C (MDJ1) - SH] complement(...    36   0.023
Kwal_23.3061                                                           36   0.023
AAL103W [84] [Homologous to ScYOR254C (SEC63) - SH] complement(1...    36   0.039
KLLA0D06402g 547385..549280 weakly similar to sp|P40358 Saccharo...    35   0.044
KLLA0F19184g 1778227..1779765 weakly similar to sp|P39102 Saccha...    35   0.051
Sklu_2174.6 YER048C, Contig c2174 7478-8659                            35   0.060
Scas_715.29                                                            35   0.080
AER427W [2927] [Homologous to ScYNL077W - SH] complement(1456998...    35   0.082
CAGL0J10296g complement(1004500..1005939) similar to sp|P53940 S...    34   0.094
CAGL0L12276g 1327171..1328529 similar to tr|Q12014 Saccharomyces...    34   0.12 
AGR084C [4394] [Homologous to ScYLR090W (XDJ1) - SH] (885026..88...    34   0.15 
Scas_564.1*                                                            34   0.15 
YER048C (CAJ1) [1475] chr5 complement(246981..248156) Homolog of...    33   0.15 
CAGL0H02827g 261006..262976 similar to sp|P40358 Saccharomyces c...    33   0.23 
CAGL0L00957g 110615..111736 similar to sp|P39101 Saccharomyces c...    33   0.33 
KLLA0C09823g 848641..850650 similar to sp|P14906 Saccharomyces c...    33   0.35 
Kwal_56.23782                                                          32   0.43 
Kwal_33.13451                                                          32   0.44 
Scas_707.19                                                            32   0.46 
Scas_532.2                                                             32   0.73 
ABL194C [398] [Homologous to ScYNL227C - SH] (42210..43868) [165...    32   0.85 
YJR097W (YJR097W) [2989] chr10 (612330..612848) Protein containi...    31   0.88 
CAGL0J07370g 711363..713234 similar to sp|P53863 Saccharomyces c...    31   1.0  
Kwal_26.8879                                                           31   1.2  
YNL227C (YNL227C) [4378] chr14 complement(220658..222430) Member...    31   1.3  
CAGL0G07469g complement(708261..710267) similar to sp|P14906 Sac...    31   1.5  
Sklu_1935.1 YNL077W, Contig c1935 224-1609                             31   1.5  
AFR659W [3852] [Homologous to ScYGL128C (CWC23) - NSH] complemen...    30   1.7  
YLR090W (XDJ1) [3505] chr12 (320702..322081) Homolog of E. coli ...    30   1.7  
Sklu_2109.4 YOR254C, Contig c2109 4786-6762                            30   1.8  
CAGL0J07964g 777358..779595 similar to sp|P53847 Saccharomyces c...    30   1.9  
KLLA0D07656g 658179..659594 similar to sp|P35191 Saccharomyces c...    30   2.0  
KLLA0C02981g 268669..269157 similar to sp|P47138 Saccharomyces c...    29   2.2  
Scas_653.14                                                            30   2.8  
Scas_674.27                                                            30   3.5  
Kwal_14.1174                                                           29   4.7  
Scas_651.17                                                            29   4.8  
Kwal_33.13533                                                          28   5.6  
Kwal_23.4420                                                           28   8.0  
CAGL0E01881g 188040..189566 similar to sp|P32329 Saccharomyces c...    28   8.9  
Sklu_1951.4 YMR034C, Contig c1951 4379-5827                            28   9.1  
KLLA0C02541g complement(226721..227533) weakly similar to sp|P52...    28   9.2  
KLLA0D19602g 1653096..1654958 similar to sp|P53863 Saccharomyces...    28   9.3  
CAGL0G00154g 14591..15892 highly similar to sp|P32527 Saccharomy...    28   9.8  
YJL162C (YJL162C) [2759] chr10 complement(114176..115624) Protei...    28   9.9  

>YFR041C (YFR041C) [1723] chr6 complement(237355..238242) Protein
           with weak similarity to dnaJ proteins Sis1p, Mdj1p, and
           Scj1p [888 bp, 295 aa]
          Length = 295

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/291 (88%), Positives = 258/291 (88%)

Query: 1   MNGYWKPALVVLGLVSLSYAFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTK 60
           MNGYWKPALVVLGLVSLSYAFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTK
Sbjct: 1   MNGYWKPALVVLGLVSLSYAFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTK 60

Query: 61  EITKNLRKLSKKYHPDKNPKYRKLYERLNLATQILSNSSNRKIYDYYLQNGFPNYDFHKG 120
           EITKNLRKLSKKYHPDKNPKYRKLYERLNLATQILSNSSNRKIYDYYLQNGFPNYDFHKG
Sbjct: 61  EITKNLRKLSKKYHPDKNPKYRKLYERLNLATQILSNSSNRKIYDYYLQNGFPNYDFHKG 120

Query: 121 GFYFSRMKPKTWFLLAFIWIVVNIGXXXXXXXXXXXXXXXXENFISQCKQQDDTNGLGVK 180
           GFYFSRMKPKTWFLLAFIWIVVNIG                ENFISQCKQQDDTNGLGVK
Sbjct: 121 GFYFSRMKPKTWFLLAFIWIVVNIGQYIISIIQYRSQRSRIENFISQCKQQDDTNGLGVK 180

Query: 181 QLTFKQHEKDEGKSLVVRFSDVYVVEPDGSETLISPDTLDKPSVKNCLFWRIPASVWNMT 240
           QLTFKQHEKDEGKSLVVRFSDVYVVEPDGSETLISPDTLDKPSVKNCLFWRIPASVWNMT
Sbjct: 181 QLTFKQHEKDEGKSLVVRFSDVYVVEPDGSETLISPDTLDKPSVKNCLFWRIPASVWNMT 240

Query: 241 FGKSVGSAGKEEIITDSKKYDGNQTXXXXXXXXXXXXXXXXXMELPNGKVI 291
           FGKSVGSAGKEEIITDSKKYDGNQT                 MELPNGKVI
Sbjct: 241 FGKSVGSAGKEEIITDSKKYDGNQTKKGNKVKKGSAKKGQKKMELPNGKVI 291

>Scas_687.18
          Length = 313

 Score =  277 bits (708), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 123/231 (53%), Positives = 169/231 (73%)

Query: 15  VSLSYAFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYH 74
           +  +Y FTT E EIFQLQ E+  KYG +M+FYKFLKLPK  +S+++EI KNLRKLS+KYH
Sbjct: 22  IPAAYCFTTSEIEIFQLQKELENKYGKEMDFYKFLKLPKSMDSTSREIIKNLRKLSRKYH 81

Query: 75  PDKNPKYRKLYERLNLATQILSNSSNRKIYDYYLQNGFPNYDFHKGGFYFSRMKPKTWFL 134
           PDKN K++KLYERLNLATQ L+N   RK YDYYL+NGFP+YDF KGGF+F+R++PKTWF+
Sbjct: 82  PDKNKKFKKLYERLNLATQFLANDDMRKSYDYYLKNGFPDYDFSKGGFFFTRVQPKTWFI 141

Query: 135 LAFIWIVVNIGXXXXXXXXXXXXXXXXENFISQCKQQDDTNGLGVKQLTFKQHEKDEGKS 194
           L+F+++   +                 E F+ QCK QDDT GLG K+L+FKQHE+DE K 
Sbjct: 142 LSFVFLFTGVIHYLILKVQASSNRRRIEGFVKQCKDQDDTQGLGEKRLSFKQHEEDEAKE 201

Query: 195 LVVRFSDVYVVEPDGSETLISPDTLDKPSVKNCLFWRIPASVWNMTFGKSV 245
           L+V+F  VY++E DG  TL+SPD++ +P++ + + +++P   W  T G+ +
Sbjct: 202 LIVKFGQVYIIESDGMYTLVSPDSITEPTLYDSILFKLPLWFWKQTLGRFI 252

>Sklu_2433.16 YFR041C, Contig c2433 25259-26158
          Length = 299

 Score =  273 bits (699), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 135/273 (49%), Positives = 183/273 (67%), Gaps = 3/273 (1%)

Query: 20  AFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNP 79
            FT+ E EIFQLQ EI+TKYG +++FY+FLKLPKL++S++KEI KN R+LSKKYHPDKN 
Sbjct: 22  CFTSEEVEIFQLQKEINTKYGEEIDFYQFLKLPKLKDSNSKEIVKNFRRLSKKYHPDKNR 81

Query: 80  KYRKLYERLNLATQILSNSSNRKIYDYYLQNGFPNYDFHKGGFYFSRMKPKTWFLLAFIW 139
           KY+KLYERLNL +QIL+N S RK YDYYL+NGFP+YDF KGGF+F R++PKTWF+LAFI+
Sbjct: 82  KYKKLYERLNLVSQILTNDSRRKTYDYYLKNGFPDYDFTKGGFFFKRVQPKTWFILAFIY 141

Query: 140 IVVNIGXXXXXXXXXXXXXXXXENFISQCKQQDDTNGLGVKQLTFKQHEKDE-GKSLVVR 198
           +   +                 ++FI   K+QDDTNGLG K+L FKQ   DE GK ++VR
Sbjct: 142 VACGLIHLVLLRLQNNGNKTRIKSFIRDVKEQDDTNGLGEKRLIFKQSADDEAGKEILVR 201

Query: 199 FSDVYVVEPDGSETLISPDTLDKPSVKNCLFWRIPASVWNMTFGKSVGSAGKEEIITDSK 258
           F DVY V+ DGSE LIS + + +P +++ +  R+P  +W  T G+ + S   ++  +D  
Sbjct: 202 FGDVYAVQADGSEALISVNDIKEPGLRDSMLVRLPTWIWKCTLGRFIVS--NKDTASDLT 259

Query: 259 KYDGNQTXXXXXXXXXXXXXXXXXMELPNGKVI 291
             D ++                  M+LPNGKV+
Sbjct: 260 TQDKDKEVTSTKKKTLKPKSKGQKMKLPNGKVV 292

>CAGL0C02123g 215564..216457 similar to sp|P43613 Saccharomyces
           cerevisiae YFR041c, start by similarity
          Length = 297

 Score =  267 bits (683), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 138/276 (50%), Positives = 174/276 (63%), Gaps = 6/276 (2%)

Query: 19  YAFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKN 78
           Y FT  E EIFQLQ EI+ KYG   +FYKFLKLP  ++S+ K+I KNLRKL++KYHPDKN
Sbjct: 19  YCFTAEEVEIFQLQKEIAKKYG---DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKN 75

Query: 79  PKYRKLYERLNLATQILSNSSNRKIYDYYLQNGFPNYDFHKGGFYFSRMKPKTWFLLAFI 138
           PK++KLY RLNLAT+IL+N S+RK YDYYL+NGFP+YDF KGGF+F R +PKTWF++ F+
Sbjct: 76  PKHKKLYARLNLATKILTNHSSRKTYDYYLKNGFPDYDFSKGGFFFQRAQPKTWFIIGFV 135

Query: 139 WIVVNIGXXXXXXXXXXXXXXXXENFISQCKQQDDTNGLGVKQLTFKQHEKDEGKSLVVR 198
            +V                      FI  CK+QD T+GLG K L FKQHE D GK LV+R
Sbjct: 136 LLVATAFHYIILKLQYNSNRRRIARFIQSCKEQDTTDGLGEKSLFFKQHEDDPGKELVLR 195

Query: 199 FSDVYVVEPDGSETLISPDTLDKPSVKNCLFWRIPASVWNMTFGKSVGSAGK---EEIIT 255
           F DV+V+E DGSE+LIS DT+++P + + L ++   +V N T GK   S  K   EE   
Sbjct: 196 FGDVFVIEEDGSESLISEDTIEEPKLTDALLFKFLNAVKNRTVGKLFKSTTKKLHEETTE 255

Query: 256 DSKKYDGNQTXXXXXXXXXXXXXXXXXMELPNGKVI 291
                + N                   M LPNGKVI
Sbjct: 256 KIDVAEDNSNDDKKPKAEMKIKPGQKKMTLPNGKVI 291

>KLLA0A01133g 103746..104579 similar to sp|P43613 Saccharomyces
           cerevisiae YFR041c singleton, start by similarity
          Length = 277

 Score =  251 bits (641), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 116/247 (46%), Positives = 168/247 (68%), Gaps = 2/247 (0%)

Query: 8   ALVVLGLVSLSYAFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTKEITKNLR 67
           AL +    +++Y FT  E EIFQLQ E+ TKYG +M+FY+FLKLPKL+ S++ EITKN +
Sbjct: 11  ALFLSLFAAVAYCFTRDEIEIFQLQQELHTKYGSNMDFYQFLKLPKLKQSTSAEITKNFK 70

Query: 68  KLSKKYHPDKNPKYRKLYERLNLATQILSNSSNRKIYDYYLQNGFPNYDFHKGGFYFSRM 127
           KL+KKYHPDKNPKYRKLYER+NL T++LS+  +RK YDYYL+NGFP YD+ KGGF+F+R+
Sbjct: 71  KLAKKYHPDKNPKYRKLYERINLITKLLSDEGHRKTYDYYLKNGFPKYDYKKGGFFFNRV 130

Query: 128 KPKTWFLLAFIWIVVNIGXXXXXXXXXXXXXXXXENFISQCKQQDDTNGLGVKQLTFKQH 187
            P  WF   F++++  +                 ENF+++ ++QD TN LG  +L FK+ 
Sbjct: 131 TPSVWFTFFFLYVLAGVIHLVLLKLHNNANKKRIENFVAKVREQDTTNSLGESKLVFKES 190

Query: 188 EKDEGKSLVVRFSDVYVVEPDGSETLISPDTLDKPSVKNCLFWRIPASVWNMTFGK--SV 245
           E  E K L+VRF +V+V++PD S   IS D +  P + + L  ++P  +WN T GK  ++
Sbjct: 191 EDSEDKQLLVRFGEVFVIQPDESLAKISTDDIIDPGINDTLLVKLPKWIWNKTLGKFINI 250

Query: 246 GSAGKEE 252
           G++  ++
Sbjct: 251 GTSKSQQ 257

>Kwal_47.19198
          Length = 300

 Score =  229 bits (585), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 121/272 (44%), Positives = 165/272 (60%)

Query: 20  AFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNP 79
           AFT  E +IFQLQ E+  KYG  ++ YK LKLPKL+ S++++I KN RKLSKKYHPDKN 
Sbjct: 22  AFTPEEVQIFQLQQEVKNKYGDKVDLYKLLKLPKLRESTSQDIRKNFRKLSKKYHPDKNK 81

Query: 80  KYRKLYERLNLATQILSNSSNRKIYDYYLQNGFPNYDFHKGGFYFSRMKPKTWFLLAFIW 139
            Y+K+YE +NLAT+ILS+ S RK YDYYL+NGFP YDF KGGFYFSR++PKTWF+LAFI+
Sbjct: 82  NYKKVYELINLATKILSDDSQRKTYDYYLKNGFPKYDFKKGGFYFSRVQPKTWFILAFIY 141

Query: 140 IVVNIGXXXXXXXXXXXXXXXXENFISQCKQQDDTNGLGVKQLTFKQHEKDEGKSLVVRF 199
           +   +                 E F+ + + QDDTNGLG K+L F+Q  +DEGK ++VR 
Sbjct: 142 VACGLIHYVLLKLQNDANKTRIERFLREVRAQDDTNGLGEKRLLFRQSIEDEGKEIIVRL 201

Query: 200 SDVYVVEPDGSETLISPDTLDKPSVKNCLFWRIPASVWNMTFGKSVGSAGKEEIITDSKK 259
            DV+ V+PDGSE  I+ + L  P + +     +P   W  T G+        +    S  
Sbjct: 202 GDVFAVQPDGSEAQITTEGLKNPGLADSALVSLPLWFWKKTLGRLASGKNDSKKSAPSTD 261

Query: 260 YDGNQTXXXXXXXXXXXXXXXXXMELPNGKVI 291
               ++                 ++LPNG+V+
Sbjct: 262 KGTKKSTTAPKKSGMRARKEGDSLKLPNGQVV 293

>AFR246C [3438] [Homologous to ScYFR041C - SH] (883075..883941) [867
           bp, 288 aa]
          Length = 288

 Score =  211 bits (538), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 103/225 (45%), Positives = 142/225 (63%), Gaps = 1/225 (0%)

Query: 9   LVVLGLVSLSYAFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTKEITKNLRK 68
           L+  GL+++   FT  E EIF LQ  ++ KYG DMN Y+FLKL KL+ S  +EIT+ +R 
Sbjct: 8   LIAAGLLAIVNGFTADEAEIFNLQKVLTDKYGKDMNLYRFLKLEKLEKSDGREITRQMRA 67

Query: 69  LSKKYHPDKNPKYRKLYERLNLATQILSNSSNRKIYDYYLQNGFPNYDFHKGGFYFSRMK 128
           L+KKYHPDKNPKY+KLYERL+LA QIL++   RK YDYYL  GFP Y   K GF F R++
Sbjct: 68  LAKKYHPDKNPKYKKLYERLHLAAQILTDGEKRKTYDYYLDYGFPEYRVDKRGFVFQRVQ 127

Query: 129 PKTWFLLAFIWIVVNIGXXXXXXXXXXXXXXXXENFISQCKQQDDTNGLGVKQLTFKQHE 188
           PKTW +LAF+ +  +                  E F+ + K+QDDT GLG K+L  +  +
Sbjct: 128 PKTWVVLAFVLVATSAIHWTVLKLQHRSRVRRVEGFLREVKEQDDTLGLGEKRLQLQLGD 187

Query: 189 KDEGKSLVVRFSDVYVVEPDGSETLISPDTLDKPSVKNCLFWRIP 233
            D  + +VVRF DV+VV+ + +ET I  + L  P + + L + +P
Sbjct: 188 SDP-QEVVVRFGDVFVVQENNTETRICAEELRAPGLLDTLMFALP 231

>CAGL0F03729g complement(362972..364057) similar to sp|P25303
           Saccharomyces cerevisiae YMR214w SCJ1, hypothetical
           start
          Length = 361

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 5/74 (6%)

Query: 44  NFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKLYER---LNLATQILSNSSN 100
           ++Y  L L K  ++S KEI    R+LSKKYHPDKNP   + + +   +  A  IL +   
Sbjct: 20  DYYAILGLSK--DASDKEIKSAYRQLSKKYHPDKNPGDEEAHHKFIEVGEAYDILGDPEK 77

Query: 101 RKIYDYYLQNGFPN 114
           RK YD +  + F N
Sbjct: 78  RKTYDVHGADAFKN 91

>KLLA0E01628g 155088..155783 weakly similar to sp|P48353
           Saccharomyces cerevisiae YMR161w HLJ1, start by
           similarity
          Length = 231

 Score = 49.3 bits (116), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 43/63 (68%), Gaps = 4/63 (6%)

Query: 45  FYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKN--PKYRKLYERLNLATQILSNSSNRK 102
           FY+ LK+ K  ++S  +I K  RKL+ K HPDKN  P+  + ++++N A ++LS+ S R+
Sbjct: 23  FYEMLKVGK--SASESDIKKAYRKLAIKLHPDKNRHPRASEAFKKINRAFEVLSDDSKRR 80

Query: 103 IYD 105
           I+D
Sbjct: 81  IFD 83

>YMR161W (HLJ1) [4116] chr13 (577717..578391) Endoplasmic reticulum
           membrane protein, member of the DnaJ family of putative
           protein chaperones [675 bp, 224 aa]
          Length = 224

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 45  FYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKN--PKYRKLYERLNLATQILSNSSNRK 102
           FY+ LK+ +   ++  EI K  RKL+ K HPDKN  PK  + ++ +N A ++LSN   R 
Sbjct: 22  FYEILKVDR--KATDSEIKKAYRKLAIKLHPDKNSHPKAGEAFKVINRAFEVLSNEEKRS 79

Query: 103 IYD 105
           IYD
Sbjct: 80  IYD 82

>Scas_669.2
          Length = 224

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 40/63 (63%), Gaps = 4/63 (6%)

Query: 45  FYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKN--PKYRKLYERLNLATQILSNSSNRK 102
           FY+ LK+ K  N +  EI K  RKL+ K HPDKN  PK  + ++ +N A ++LS+   R+
Sbjct: 23  FYEILKVEKTANDN--EIKKAYRKLAVKLHPDKNPHPKASEAFKIINRAFEVLSDVEKRQ 80

Query: 103 IYD 105
           +YD
Sbjct: 81  LYD 83

>YNL064C (YDJ1) [4526] chr14 complement(505866..507095) Protein
           involved in protein import into mitochondria and ER,
           homolog of E. coli DnaJ [1230 bp, 409 aa]
          Length = 409

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 4/73 (5%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNP--KYRKLYERLNLATQILSNSS 99
           +  FY  L +P    ++  EI K  RK + KYHPDKNP  +  + ++  + A +ILS+  
Sbjct: 4   ETKFYDILGVP--VTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDPE 61

Query: 100 NRKIYDYYLQNGF 112
            R IYD + ++G 
Sbjct: 62  KRDIYDQFGEDGL 74

>Kwal_26.9024
          Length = 375

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 5/74 (6%)

Query: 44  NFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKLYER---LNLATQILSNSSN 100
           ++Y  L + K  ++S KEI    R+LSKK+HPDKNP     + +   +  A ++LS+   
Sbjct: 25  DYYGILGVSK--DASDKEIKSAYRQLSKKFHPDKNPGDEDAHHKFIEVGEAYEVLSDDQK 82

Query: 101 RKIYDYYLQNGFPN 114
           R+IYD +      N
Sbjct: 83  RQIYDQHGAEALKN 96

>CAGL0H04499g complement(427509..428207) similar to sp|P48353
           Saccharomyces cerevisiae YMR161w HLJ1, start by
           similarity
          Length = 232

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 40/63 (63%), Gaps = 4/63 (6%)

Query: 45  FYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKN--PKYRKLYERLNLATQILSNSSNRK 102
           FY  L + +  +SS  +I K  RKL+ K HPDKN  PK  + ++ +N A ++LS+S  R+
Sbjct: 22  FYDILNVER--SSSDVDIKKAYRKLAIKLHPDKNPYPKAHEAFKLINRAFEVLSDSQKRQ 79

Query: 103 IYD 105
           IYD
Sbjct: 80  IYD 82

>AFL190C [3005] [Homologous to ScYMR161W (HLJ1) - SH] (84145..84852)
           [708 bp, 235 aa]
          Length = 235

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 42/64 (65%), Gaps = 4/64 (6%)

Query: 44  NFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKN--PKYRKLYERLNLATQILSNSSNR 101
           +FY+ L++   + +S  +I K  RK++ K HPDKN  P+  + ++++N A ++LS+   R
Sbjct: 24  SFYELLQVD--EKASDGDIKKAYRKMAIKLHPDKNRHPRAAEAFKKVNRAFEVLSDEKKR 81

Query: 102 KIYD 105
           ++YD
Sbjct: 82  RVYD 85

>CAGL0J09966g complement(976568..977791) highly similar to sp|P25491
           Saccharomyces cerevisiae YNL064c YDJ1, start by
           similarity
          Length = 407

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 56  NSSTKEITKNLRKLSKKYHPDKNP--KYRKLYERLNLATQILSNSSNRKIYDYYLQNGF 112
            +S  EI K  RK + KYHPDKNP  +  + ++ ++ A +ILS+S  R++YD + + G 
Sbjct: 16  GASDAEIKKAYRKSALKYHPDKNPSEEAAEKFKEVSSAYEILSDSQKREVYDQFGEEGL 74

>YMR214W (SCJ1) [4170] chr13 (695349..696482) Homolog of E. coli
           DnaJ, functions in the endoplasmic reticulum by
           interaction with Kar2p [1134 bp, 377 aa]
          Length = 377

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 43/74 (58%), Gaps = 5/74 (6%)

Query: 44  NFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKLYER---LNLATQILSNSSN 100
           ++Y  L++ K  +++ KEI    R+LSKKYHPDKN    + +++   +  A  +LS+   
Sbjct: 23  DYYAILEIDK--DATEKEIKSAYRQLSKKYHPDKNAGSEEAHQKFIEVGEAYDVLSDPEK 80

Query: 101 RKIYDYYLQNGFPN 114
           +KIYD +  +   N
Sbjct: 81  KKIYDQFGADAVKN 94

>KLLA0C07260g complement(632987..634093) similar to sp|P25303
           Saccharomyces cerevisiae YMR214w SCJ1 homolog of E. coli
           DnaJ, functions in the endoplasmic reticulum by
           interaction with KAR2P, start by similarity
          Length = 368

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 5/67 (7%)

Query: 44  NFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKLYER---LNLATQILSNSSN 100
           ++Y  L + K   +S KEI    R+LSKKYHPDKNP   + +     +  A  +LS+   
Sbjct: 20  DYYAILGVDK--QASEKEIKSAYRQLSKKYHPDKNPGNDEAHHHFIEVGEAYDVLSDPEK 77

Query: 101 RKIYDYY 107
           R+IYD +
Sbjct: 78  RQIYDRH 84

>Kwal_23.4830
          Length = 411

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (54%), Gaps = 4/66 (6%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKL--YERLNLATQILSNSS 99
           D  FY  L +    N +  +I K  RK + K+HPDKNP       ++ L +A +ILS+S 
Sbjct: 4   DTKFYDLLGVSPDANDA--QIKKAYRKQALKFHPDKNPSEEAADKFKELTVAYEILSDSQ 61

Query: 100 NRKIYD 105
            R IYD
Sbjct: 62  KRDIYD 67

>CAGL0I09526g 911127..912017 weakly similar to sp|P52868
           Saccharomyces cerevisiae YGL128c, hypothetical start
          Length = 296

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 8/86 (9%)

Query: 31  LQNEISTKYGPDMNFYKFLKL------PKLQNSSTKEITKNLRKLSKKYHPDKN--PKYR 82
           + + + T  G  ++ YK L+L           ++T  + K  RKLS +YHPDKN  P+Y 
Sbjct: 1   MSDVVKTVIGQRLDLYKLLELNYKDYKGNDDAATTHSLKKQYRKLSLRYHPDKNPGPEYI 60

Query: 83  KLYERLNLATQILSNSSNRKIYDYYL 108
             +  LNLA  +L++ + +  YD ++
Sbjct: 61  DRFHLLNLAITVLADPAKKAEYDQWV 86

>Scas_692.34
          Length = 375

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 43/74 (58%), Gaps = 5/74 (6%)

Query: 44  NFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKLYER---LNLATQILSNSSN 100
           ++Y+ L + K  +++ KEI    R+LSKK+HPDKNP     +++   +  A ++LS+   
Sbjct: 21  DYYQILGIAK--DATDKEIKSAYRQLSKKFHPDKNPGNEDAHQKFIEVGEAYEVLSDPQK 78

Query: 101 RKIYDYYLQNGFPN 114
           R+ +D +  +   N
Sbjct: 79  RQTFDQFGADAVKN 92

>AER346W [2847] [Homologous to ScYMR214W (SCJ1) - SH]
           complement(1271436..1272539) [1104 bp, 367 aa]
          Length = 367

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 38/74 (51%), Gaps = 5/74 (6%)

Query: 44  NFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKLYE---RLNLATQILSNSSN 100
           ++Y  L + +   ++ K+I    R+LSKKYHPDKNP     +     +  A + LS+   
Sbjct: 21  DYYAILGVDR--EATEKDIKSAYRQLSKKYHPDKNPGDTTAHHNFIEVGEAYEALSDPEK 78

Query: 101 RKIYDYYLQNGFPN 114
           R+IYD Y      N
Sbjct: 79  RRIYDQYGAEALKN 92

>Scas_694.20
          Length = 410

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 4/66 (6%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNP--KYRKLYERLNLATQILSNSS 99
           D   Y  L +      S  EI K  RK + KYHPDKNP  +  + ++ ++ A +ILS+S 
Sbjct: 4   DTKLYDVLGVSPTAGDS--EIKKAYRKSALKYHPDKNPTEEGAEKFKEVSAAYEILSDSE 61

Query: 100 NRKIYD 105
            R+IYD
Sbjct: 62  KREIYD 67

>Kwal_14.2452
          Length = 607

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 51/105 (48%), Gaps = 27/105 (25%)

Query: 44  NFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNP--------KYRKLYERLNLATQIL 95
           N+YK L +P  Q ++ K+I K+   +++KYHPDK          K ++    +N A +IL
Sbjct: 505 NYYKVLGVP--QQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEIL 562

Query: 96  SNSSNRKIYDY-------------YLQNGFP----NYDFHKGGFY 123
           S+   RK YD              + Q GFP    N+  + GGF+
Sbjct: 563 SDEGKRKEYDDQRSGRAPQGQGSPFGQGGFPFGSGNFKMNFGGFH 607

>ADL257C [1484] [Homologous to ScYNL064C (YDJ1) - SH]
           (249514..250746) [1233 bp, 410 aa]
          Length = 410

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 4/66 (6%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKL--YERLNLATQILSNSS 99
           D   Y  L +    N +  +I K  RK + KYHPDKNP       ++++  A +ILS+S 
Sbjct: 4   DTKLYDLLGVSPDANDA--QIKKAYRKSALKYHPDKNPSEEAADKFKQITGAYEILSDSQ 61

Query: 100 NRKIYD 105
            R++YD
Sbjct: 62  KREMYD 67

>KLLA0E07876g complement(709306..710793) weakly similar to sp|P53940
           Saccharomyces cerevisiae YNL077w, start by similarity
          Length = 495

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 36/54 (66%), Gaps = 3/54 (5%)

Query: 57  SSTKEITKNLRKLSKKYHPDKN---PKYRKLYERLNLATQILSNSSNRKIYDYY 107
           ++ +EI K  RK + K+HPDKN    +  KL++ ++ A + LSNS+ R++YD Y
Sbjct: 17  ATEQEIKKAYRKKALKHHPDKNNHSAESIKLFQDISHAYETLSNSNKRELYDQY 70

>KLLA0F03333g complement(313991..315220) similar to sp|P25491
           Saccharomyces cerevisiae YNL064c YDJ1 mitochondrial and
           ER import protein, start by similarity
          Length = 409

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNP--KYRKLYERLNLATQILSNSS 99
           D   Y  L +     +   +I K  RK + K+HPDKNP  +  + ++ +  A +ILS+S 
Sbjct: 4   DTKLYDLLGVSP--GADDNQIKKAYRKSALKFHPDKNPSEEAAEKFKEITSAYEILSDSQ 61

Query: 100 NRKIYDYYLQNGF 112
            R++YD +   G 
Sbjct: 62  KREVYDQFGLEGL 74

>YGL128C (CWC23) [1858] chr7 complement(269297..270148) Protein
           possibly involved in pre-mRNA splicing, has similarity
           to E. coli DnaJ and other DnaJ-like proteins [852 bp,
           283 aa]
          Length = 283

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (52%), Gaps = 8/74 (10%)

Query: 43  MNFYKFLKLPKLQNSST-----KEITKNLRKLSKKYHPDKNPKYRKLYERLNL---ATQI 94
           +N Y  L+LP   +  T      +I +  R L+ KYHPDK+P    +  + +L   AT I
Sbjct: 14  LNLYDVLELPTPLDVHTIYDDLPQIKRKYRTLALKYHPDKHPDNPSIIHKFHLLSTATNI 73

Query: 95  LSNSSNRKIYDYYL 108
           L+N+  R  YD +L
Sbjct: 74  LTNADVRPHYDRWL 87

>KLLA0D04818g complement(411615..412679) similar to sp|P25294
           Saccharomyces cerevisiae YNL007c SIS1 heat shock
           protein, start by similarity
          Length = 354

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKLYERLNLATQILSNSSNR 101
           D   Y  L +    ++   EI K  RK + KYHPDK     + ++ ++ A +ILS++  R
Sbjct: 4   DTKLYDLLGISP--SAGEAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDAQKR 61

Query: 102 KIYDYY 107
           ++YD Y
Sbjct: 62  EVYDTY 67

>YJL073W (JEM1) [2839] chr10 (303097..305034) DnaJ-like protein
           required for the nuclear fusion step of karyogamy [1938
           bp, 645 aa]
          Length = 645

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 42/75 (56%), Gaps = 10/75 (13%)

Query: 39  YGPDMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDK-----NPKYRKLYE---RLNL 90
           Y P  ++YK L +    ++S+KEI K    L+KKYHPDK     N K   ++E   ++N 
Sbjct: 533 YDPKKDYYKILGVSP--SASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINE 590

Query: 91  ATQILSNSSNRKIYD 105
           A + LS+   RK YD
Sbjct: 591 AYETLSDDDKRKEYD 605

>KLLA0E04345g complement(400495..401781) similar to sp|P39101
           Saccharomyces cerevisiae YER048c CAJ1 dnaJ homolog,
           start by similarity
          Length = 428

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 40/69 (57%), Gaps = 5/69 (7%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKN---PKYRKLYERLNLATQILSNS 98
           D  +Y  L++    ++S +EI K+ RKL+ K HPDKN   P+ +  ++ L  A Q+L + 
Sbjct: 4   DTTYYDILQVS--VDASPQEIKKSYRKLAIKTHPDKNPDDPQAQTKFQELAKAYQVLIDD 61

Query: 99  SNRKIYDYY 107
             RK YD +
Sbjct: 62  DLRKKYDQF 70

>CAGL0H03707g complement(341230..342279) highly similar to sp|P25294
           Saccharomyces cerevisiae YNL007c SIS1 heat shock
           protein, start by similarity
          Length = 349

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 33/52 (63%)

Query: 56  NSSTKEITKNLRKLSKKYHPDKNPKYRKLYERLNLATQILSNSSNRKIYDYY 107
           +++ +EI K  RK + KYHPDK     + ++ ++ A +ILS+   R++YD Y
Sbjct: 16  SANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQKREVYDQY 67

>Sklu_2257.6 YIR004W, Contig c2257 8880-10169 reverse complement
          Length = 429

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 40/90 (44%), Gaps = 6/90 (6%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKLYER---LNLATQILSNS 98
           D  +Y  L +    N+   EI K  RK S + HPDKNP      ER   ++ A Q+LSN 
Sbjct: 4   DTTYYDLLGVSP--NARPIEIKKAYRKKSVQEHPDKNPNDPSATERFQSISQAYQVLSNE 61

Query: 99  SNRKIYDYY-LQNGFPNYDFHKGGFYFSRM 127
             R  YD +  +   P   F      FS +
Sbjct: 62  ELRTKYDKFGKEEAVPQNGFEDAAEQFSAI 91

>Scas_542.2
          Length = 280

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 42/76 (55%), Gaps = 11/76 (14%)

Query: 43  MNFYKFLKLP------KLQNSSTKEITKNLRKLSKKYHPDKNPK----YRKLYERLNLAT 92
           +N Y  L++P      +L      +I K  R L+ KYHPDK+P       K Y+ L++AT
Sbjct: 13  VNLYSVLEIPTEPRAKELSKILPTDIKKRYRTLALKYHPDKHPNEPEIVHKFYQ-LSVAT 71

Query: 93  QILSNSSNRKIYDYYL 108
            IL+N + +K YD +L
Sbjct: 72  HILTNEALKKRYDTWL 87

>ADR015W [1756] [Homologous to ScYIR004W (DJP1) - SH]
           complement(732201..733511) [1311 bp, 436 aa]
          Length = 436

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 41/88 (46%), Gaps = 6/88 (6%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKLYER---LNLATQILSNS 98
           D  +Y  L +    ++   EI K  RK S + HPDKNP   K  ER   ++ A Q+LS+ 
Sbjct: 4   DTAYYDLLGVSP--DAKAIEIKKAYRKKSVQEHPDKNPNDPKATERFQAISEAYQVLSSD 61

Query: 99  SNRKIYDYY-LQNGFPNYDFHKGGFYFS 125
             R  YD +  +   P   F   G  F+
Sbjct: 62  ELRAKYDKFGKEEAVPQNGFEDAGEQFA 89

>AAL008W [179] [Homologous to ScYNL007C (SIS1) - SH]
           complement(327127..328176) [1050 bp, 349 aa]
          Length = 349

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 33/52 (63%)

Query: 56  NSSTKEITKNLRKLSKKYHPDKNPKYRKLYERLNLATQILSNSSNRKIYDYY 107
           ++S  E+ K  RK + KYHPDK     + ++ ++ A +ILS+ + R++YD Y
Sbjct: 16  SASDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPNKREVYDTY 67

>Scas_471.1
          Length = 79

 Score = 36.6 bits (83), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 26/37 (70%), Gaps = 2/37 (5%)

Query: 43 MNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNP 79
           ++Y+ L + K  +++ KEI    R+LSKK+HPDKNP
Sbjct: 35 QDYYQILGIAK--DATDKEIKSAYRQLSKKFHPDKNP 69

>ADR124C [1865] [Homologous to ScYJL073W (JEM1) - SH]
           (926131..927966) [1836 bp, 611 aa]
          Length = 611

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 45/86 (52%), Gaps = 13/86 (15%)

Query: 44  NFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDK-----NPKYRKLYERL---NLATQIL 95
           N+YK L +    +++ K+I +    L+KKYHPDK     + +  K+ E++   N A ++L
Sbjct: 509 NYYKILGIG--NDANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSSINEAYEVL 566

Query: 96  SNSSNRKIYDYYLQNGFPNYDFHKGG 121
           S+ S RK YD     G      H GG
Sbjct: 567 SDESKRKEYDMLRSGGGSQ---HAGG 589

>Scas_488.3
          Length = 367

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 32/51 (62%)

Query: 57  SSTKEITKNLRKLSKKYHPDKNPKYRKLYERLNLATQILSNSSNRKIYDYY 107
           ++ +E+ K  RK + KYHPDK     + ++ ++ A +IL++   R+IYD Y
Sbjct: 17  ANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDQY 67

>Scas_709.3
          Length = 414

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 6/90 (6%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKLYER---LNLATQILSNS 98
           D  +Y+ L +    +++  EI K  RK S + HPDKNP      ER   ++ A Q+LS+ 
Sbjct: 4   DTAYYELLGISP--SATAIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLSDD 61

Query: 99  SNRKIYDYY-LQNGFPNYDFHKGGFYFSRM 127
           + R  YD Y  +   P   F      FS +
Sbjct: 62  TLRLKYDKYGKKEAVPTGGFEDAAEQFSAI 91

>YIR004W (DJP1) [2669] chr9 (363218..364516) Protein required for
           peroxisomal biogenesis, has similarity to E. coli DnaJ
           and other DnaJ-like proteins [1299 bp, 432 aa]
          Length = 432

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 39/88 (44%), Gaps = 6/88 (6%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKLYER---LNLATQILSNS 98
           D  +Y  L +     +S+ EI K  RK S + HPDKNP      ER   ++ A Q+L + 
Sbjct: 4   DTEYYDLLGVS--TTASSIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLGDD 61

Query: 99  SNRKIYDYY-LQNGFPNYDFHKGGFYFS 125
             R  YD Y  +   P   F      FS
Sbjct: 62  DLRAKYDKYGRKEAIPQGGFEDAAEQFS 89

>CAGL0J02750g complement(270406..271554) highly similar to sp|P39101
           Saccharomyces cerevisiae YER048c CAJ1, start by
           similarity
          Length = 382

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 6/88 (6%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDK---NPKYRKLYERLNLATQILSNS 98
           D  FY  L +     ++  EI K  RK++   HPDK   +P+ +  ++ +  A Q+L++ 
Sbjct: 4   DTEFYDVLGISP--EATPSEIKKAYRKMAMLTHPDKHPDDPEAQAKFQAVGEAYQVLNDP 61

Query: 99  SNRKIYDYYLQ-NGFPNYDFHKGGFYFS 125
           + RK YD + + N  P   F     YF+
Sbjct: 62  ALRKQYDEFGKDNAVPQQGFEDAEEYFT 89

>YNL007C (SIS1) [4578] chr14 complement(618506..619564) Protein
           required for initiation of translation, member of DnaJ
           family of protein chaperones [1059 bp, 352 aa]
          Length = 352

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 33/52 (63%)

Query: 56  NSSTKEITKNLRKLSKKYHPDKNPKYRKLYERLNLATQILSNSSNRKIYDYY 107
           +++ +E+ K  RK + KYHPDK     + ++ ++ A +IL++   R+IYD Y
Sbjct: 16  SANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDQY 67

>Kwal_0.207
          Length = 353

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 4/67 (5%)

Query: 42  DMNFYKFLKL-PKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKLYERLNLATQILSNSSN 100
           D   Y  L + P  Q +   E+ K  RK + KYHPDK     + ++ ++ A +IL++   
Sbjct: 4   DTKLYDLLGVSPSAQET---ELKKGYRKAALKYHPDKPSGDAEKFKEISEAFEILNDPQK 60

Query: 101 RKIYDYY 107
           R++YD Y
Sbjct: 61  REVYDTY 67

>CAGL0J01936g complement(190181..191458) highly similar to sp|P40564
           Saccharomyces cerevisiae YIR004w DJP1, start by
           similarity
          Length = 425

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 6/90 (6%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKLYER---LNLATQILSNS 98
           D  +Y  L +     ++  EI K  RK S + HPDKNP      ER   ++ A Q+LS+ 
Sbjct: 4   DSTYYDLLGIGP--TATAVEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLSSE 61

Query: 99  SNRKIYDYY-LQNGFPNYDFHKGGFYFSRM 127
             R  YD +  Q   P   F      FS +
Sbjct: 62  ELRAKYDKFGKQEAIPKGGFEDAAEQFSAI 91

>Scas_695.14
          Length = 327

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 33/51 (64%)

Query: 57  SSTKEITKNLRKLSKKYHPDKNPKYRKLYERLNLATQILSNSSNRKIYDYY 107
           ++ +E+ K  RK + KYHPDK     + ++ ++ A +IL++ + R++YD Y
Sbjct: 17  ANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNTREVYDQY 67

>Kwal_47.18133
          Length = 393

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 6/88 (6%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDK---NPKYRKLYERLNLATQILSNS 98
           D  +Y  L L    ++S  +I K  RK +   HPDK   +P+ +  ++ +  A Q+LS+ 
Sbjct: 4   DTEYYDLLGLQP--DASATDIKKAYRKKAMLTHPDKHPDDPEAQAKFQAIGEAYQVLSDP 61

Query: 99  SNRKIYDYY-LQNGFPNYDFHKGGFYFS 125
             R  YD +  +N  P   F     +F+
Sbjct: 62  DLRSRYDEFGKENAVPQQGFEDAAEFFT 89

>KLLA0D13464g complement(1159251..1160552) similar to sp|P40564
           Saccharomyces cerevisiae YIR004w DJP1 DnaJ-like protein
           involved specifically in peroxisomal protein import,
           start by similarity
          Length = 433

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 6/90 (6%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKLYER---LNLATQILSNS 98
           D  +Y  L +    ++   +I K  RK S K HPDKNP      ER   ++ A Q+LS+ 
Sbjct: 4   DTTYYDLLGVA--TDAKQIDIKKAYRKKSVKEHPDKNPDDPTATERFQAISEAYQVLSSE 61

Query: 99  SNRKIYDYY-LQNGFPNYDFHKGGFYFSRM 127
             R  YD +  +   P   F   G  F+ +
Sbjct: 62  ELRMKYDKFGKEEAMPKNGFEDAGEQFAAI 91

>Sklu_2442.1 YNL007C, Contig c2442 2508-3554 reverse complement
          Length = 348

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%)

Query: 61  EITKNLRKLSKKYHPDKNPKYRKLYERLNLATQILSNSSNRKIYDYY 107
           E+ K  RK + KYHPDK     + ++ ++ A +IL++   R+IYD Y
Sbjct: 21  ELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDSY 67

>YNL077W (APJ1) [4513] chr14 (481390..482976) Protein induced by
           cell stress, member of the DnaJ family of predicted
           protein chaperones [1587 bp, 528 aa]
          Length = 528

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 57  SSTKEITKNLRKLSKKYHPDKN---PKYRKLYERLNLATQILSNSSNRKIYDYY 107
           +ST EI K  R  + KYHPDKN    + ++ ++ +  A +IL ++  R +YD Y
Sbjct: 17  ASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEILKDNRLRALYDQY 70

>ADL327W [1414] [Homologous to ScYPR061C - SH]
           complement(123853..124770) [918 bp, 305 aa]
          Length = 305

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 51/112 (45%), Gaps = 15/112 (13%)

Query: 5   WKPALVVLGLVSLSYAFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTKEITK 64
           W+ +L   G  ++  A T     +   Q  +S   G     Y+ L L K      +++ K
Sbjct: 57  WRVSLTASGRSTVRCAST-----VAGWQGGLSWPQGKQPTPYEVLGLVK-TGVDARQLKK 110

Query: 65  NLRKLSKKYHPDKNPKYRK---LYERL------NLATQILSNSSNRKIYDYY 107
              +L+K YHPD     ++    +ERL      N A  +LS++S R++YD Y
Sbjct: 111 RYHELAKLYHPDTAGAAQQGLGEHERLRRFKLVNEAYALLSDASRRRMYDMY 162

>Kwal_55.20965
          Length = 421

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 38/88 (43%), Gaps = 6/88 (6%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKLYER---LNLATQILSNS 98
           D  +Y  L +    ++   +I K  RK S + HPDKNP      ER   ++ A Q+LS  
Sbjct: 5   DTTYYDLLGVDP--SAKAIDIKKAYRKKSVQEHPDKNPNDPTATERFQAISQAYQVLSKE 62

Query: 99  SNRKIYDYY-LQNGFPNYDFHKGGFYFS 125
             R  YD Y  +   P   F      FS
Sbjct: 63  DLRAKYDKYGKEEAIPKEGFEDAAEQFS 90

>Sklu_2422.10 YNL227C, Contig c2422 20011-22047 reverse complement
          Length = 678

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 6/67 (8%)

Query: 45  FYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNP----KYRKLYERLNLATQILSNSSN 100
           +Y+ L +  +  +S  E+ K  RK + KYHPDKNP    +  + +  + LA ++LS+   
Sbjct: 5   YYELLGVESI--ASDLELKKAYRKKALKYHPDKNPNNVEEATQAFATIRLAYEVLSDPQE 62

Query: 101 RKIYDYY 107
           R  YD +
Sbjct: 63  RAWYDSH 69

>CAGL0I06226g 597520..598887 some similarities with sp|P46997
           Saccharomyces cerevisiae YJL162c, hypothetical start
          Length = 455

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 46/98 (46%), Gaps = 15/98 (15%)

Query: 45  FYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYR--KLYERLNLATQILSNSSNRK 102
           +Y  L +P   N+ST EI K+  KL+KK HPDK       +L++ +  A  IL+N   R 
Sbjct: 13  YYSILGVPT--NASTNEIRKSYMKLAKKLHPDKTKSEHTAELFKLVVDAHSILNNDQLRA 70

Query: 103 IYDYYL---------QNGF--PNYDFHKGGFYFSRMKP 129
            YD  L         Q+G    N D  KG  +    KP
Sbjct: 71  EYDKKLILEGRFELHQHGAKQKNKDIRKGYTFKRNSKP 108

>Scas_711.40
          Length = 635

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 50/98 (51%), Gaps = 21/98 (21%)

Query: 44  NFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKY-----RKLYERL---NLATQIL 95
           ++YK L + K  ++  K+I K+   L+KK+HPDK  +      +K+ E++   N A ++L
Sbjct: 527 DYYKILDVSK--DAGAKDIRKSYLNLTKKFHPDKQGQLSEKEQKKIQEKMSEINEAYEVL 584

Query: 96  SNSSNRKIYDYYL---QNGFPNYDFHKGG---FYFSRM 127
           S+ + R  YD       NG  N     GG   F F RM
Sbjct: 585 SDETKRNEYDLNRSGNHNGMAN-----GGAQNFDFGRM 617

>AFR507W [3699] [Homologous to ScYFL016C (MDJ1) - SH]
           complement(1347615..1349039) [1425 bp, 474 aa]
          Length = 474

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 4/64 (6%)

Query: 46  YKFLKLPKLQNSSTKEITKNLRKLSKKYHPD--KNPKYRKLYERLNLATQILSNSSNRKI 103
           Y+ L + K  ++S  +I K   KL+K++HPD  K+    K +  L  A +ILS+ + R+ 
Sbjct: 43  YETLGVAK--DASASQIKKAYYKLAKQFHPDINKDEGAEKKFHDLQNAYEILSDENKRRQ 100

Query: 104 YDYY 107
           YD +
Sbjct: 101 YDQF 104

>Kwal_23.3061
          Length = 458

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 3/71 (4%)

Query: 40  GPDMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKN--PKYRKL-YERLNLATQILS 96
           G  MN   +  L    N+S +EI K  R  + K+HPDKN   +  KL ++++  A +IL 
Sbjct: 2   GSAMNNDLYDTLGVAANASRQEIKKAYRLKALKHHPDKNGHSEQSKLKFQQICKAYEILG 61

Query: 97  NSSNRKIYDYY 107
           +   R++YD +
Sbjct: 62  DDKKREMYDRF 72

>AAL103W [84] [Homologous to ScYOR254C (SEC63) - SH]
           complement(161385..163394) [2010 bp, 669 aa]
          Length = 669

 Score = 35.8 bits (81), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 54/116 (46%), Gaps = 8/116 (6%)

Query: 6   KPALVVLGLVSLSYAFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTKEITKN 65
           + AL+++G V +SY    I +    L +     + P    Y+ L++     ++ +EI   
Sbjct: 82  RSALIIVGWVLVSYLVNRIASN-ETLHDSYKNVFDP----YELLQVGS--GATDREIRSA 134

Query: 66  LRKLSKKYHPDKNPKYRKLYERLNLATQ-ILSNSSNRKIYDYYLQNGFPNYDFHKG 120
            RKLS K+HPDK  K  +  ER  L  Q +L   + + + D   ++ F  Y    G
Sbjct: 135 YRKLSVKFHPDKLAKDLQDTERSVLEEQYVLITKAYKALTDDATRDNFLRYGHPDG 190

>KLLA0D06402g 547385..549280 weakly similar to sp|P40358
           Saccharomyces cerevisiae YJL073w JEM1 singleton,
           hypothetical start
          Length = 631

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 50/94 (53%), Gaps = 16/94 (17%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDK----NPKYRKLYE----RLNLATQ 93
           D ++YK L + K  +++ K++ ++  +L+KK+HPDK    N + R+  E     +N A +
Sbjct: 526 DKDYYKILGVDK--SATPKDVRRSYLQLTKKFHPDKQKNLNDEQRQKNEEKMAEINEAYE 583

Query: 94  ILSNSSNRKIYDYYLQN-----GFPNYDFHKGGF 122
           ILS+   R  YD    N     G   ++ H GGF
Sbjct: 584 ILSDDDKRTKYDNARANSRNSRGAHGFEGH-GGF 616

>KLLA0F19184g 1778227..1779765 weakly similar to sp|P39102
           Saccharomyces cerevisiae YLR090w XDJ1, start by
           similarity
          Length = 512

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 13/75 (17%)

Query: 55  QNSSTKEITKNLRKLSKKYHPDK------NPKYRKLYERLNLATQILSNSSNRKIYDYYL 108
           ++++  EI K  RKL+ KYHPDK            +++ +  A +ILS+   +  YD Y 
Sbjct: 81  KDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELKSRYDMYG 140

Query: 109 Q-------NGFPNYD 116
                   NGFP  D
Sbjct: 141 DSAFGSGGNGFPEDD 155

>Sklu_2174.6 YER048C, Contig c2174 7478-8659
          Length = 393

 Score = 35.0 bits (79), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 6/88 (6%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDK---NPKYRKLYERLNLATQILSNS 98
           D  +Y  L +    +++  EI K  RK +   HPDK   +P  +  ++ +  A Q+LS+ 
Sbjct: 4   DTEYYDALGISP--DATPTEIKKAYRKKAMLTHPDKHPNDPDAQAKFQAVGQAYQVLSDP 61

Query: 99  SNRKIYDYYLQ-NGFPNYDFHKGGFYFS 125
             R  YD + + +  P   F   G +F+
Sbjct: 62  GLRSRYDEFGKDDAVPQQGFEDAGEFFT 89

>Scas_715.29
          Length = 387

 Score = 34.7 bits (78), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 4/73 (5%)

Query: 57  SSTKEITKNLRKLSKKYHPDK---NPKYRKLYERLNLATQILSNSSNRKIYDYYLQN-GF 112
           ++  EI K  R+ + + HPDK   +P+ +  ++ +  A Q+LS+   R  YD + ++   
Sbjct: 17  ATPAEIKKAYRRRAMQTHPDKHPDDPEAQAKFQEVGEAYQVLSDPGLRSRYDEFGKDEAV 76

Query: 113 PNYDFHKGGFYFS 125
           P   F     YF+
Sbjct: 77  PQQGFEDANEYFT 89

>AER427W [2927] [Homologous to ScYNL077W - SH]
           complement(1456998..1458410) [1413 bp, 470 aa]
          Length = 470

 Score = 34.7 bits (78), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 58  STKEITKNLRKLSKKYHPDKN---PKYRKLYERLNLATQILSNSSNRKIYDYY 107
           S  E+ K+ +  + +YHPDKN      ++ ++++  A ++L +   RKIYD Y
Sbjct: 18  SAAELKKSYKLAALRYHPDKNGHSEASKQRFQQIADAYRVLGDERLRKIYDRY 70

>CAGL0J10296g complement(1004500..1005939) similar to sp|P53940
           Saccharomyces cerevisiae YNL077w, start by similarity
          Length = 479

 Score = 34.3 bits (77), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 5/69 (7%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKN---PKYRKLYERLNLATQILSNS 98
           D   Y  L +    ++S   I K     + + HPDKN    + +K ++ ++ A ++LS+ 
Sbjct: 4   DTRLYDLLNVE--CDASQVTIKKAFHAAALRCHPDKNNHSEESKKQFQEISKAYEVLSDP 61

Query: 99  SNRKIYDYY 107
            +R++YD Y
Sbjct: 62  KSREMYDRY 70

>CAGL0L12276g 1327171..1328529 similar to tr|Q12014 Saccharomyces
           cerevisiae YLR090w, hypothetical start
          Length = 452

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 13/77 (16%)

Query: 43  MNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKL-----------YERLNLA 91
           M++Y  L +   Q++S  EI +  RKL+ ++HPDK                  ++ +  A
Sbjct: 1   MDYYGLLGVG--QDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAA 58

Query: 92  TQILSNSSNRKIYDYYL 108
            Q+LS++S R  YD  L
Sbjct: 59  YQVLSDASLRAEYDQKL 75

>AGR084C [4394] [Homologous to ScYLR090W (XDJ1) - SH]
           (885026..886309) [1284 bp, 427 aa]
          Length = 427

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 44/85 (51%), Gaps = 10/85 (11%)

Query: 44  NFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDK--NPKYRKLYE----RLNLATQILSN 97
           + Y+ L +    ++S +E+ +  R+L+ +YHPDK  +   R+  E     ++ A  +LS+
Sbjct: 4   DLYEVLGI--ASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSD 61

Query: 98  SSNRKIYDYY--LQNGFPNYDFHKG 120
              R  YD +  +  G+ + +F  G
Sbjct: 62  EQKRAEYDQFGTVDGGYGHDEFGHG 86

>Scas_564.1*
          Length = 457

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 8/60 (13%)

Query: 56  NSSTKEITKNLRKLSKKYHPDK----NPKYRKLYE----RLNLATQILSNSSNRKIYDYY 107
           N++  +I K  RKL+ ++HPDK    N   R+  E     ++ A +ILS+   R  YD Y
Sbjct: 353 NATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDEDKRAHYDLY 412

>YER048C (CAJ1) [1475] chr5 complement(246981..248156) Homolog of E.
           coli DnaJ, has a leucine zipper [1176 bp, 391 aa]
          Length = 391

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 61  EITKNLRKLSKKYHPDK---NPKYRKLYERLNLATQILSNSSNRKIYDYY-LQNGFPNYD 116
           EI K  R+ + + HPDK   +P  +  ++ +  A Q+LS+   R  YD +  ++  P   
Sbjct: 21  EIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSDPGLRSKYDQFGKEDAVPQQG 80

Query: 117 FHKGGFYFS 125
           F     YF+
Sbjct: 81  FEDASEYFT 89

>CAGL0H02827g 261006..262976 similar to sp|P40358 Saccharomyces
           cerevisiae YJL073w JEM, start by similarity
          Length = 656

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 11/71 (15%)

Query: 44  NFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPK---------YRKLYERLNLATQI 94
           N+Y+ L +     +S KEI K    L+KKYHPDK  K           +    +N A ++
Sbjct: 541 NYYQILGIKP--EASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMSEINEAYEV 598

Query: 95  LSNSSNRKIYD 105
           L++   RK YD
Sbjct: 599 LNDEEKRKEYD 609

>CAGL0L00957g 110615..111736 similar to sp|P39101 Saccharomyces
           cerevisiae YER048c CAJ1, start by similarity
          Length = 373

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 6/88 (6%)

Query: 42  DMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDK---NPKYRKLYERLNLATQILSNS 98
           D  +Y  L +     +++ EI K  R+ + + HPDK   +P  +  ++ +  A Q+LS+ 
Sbjct: 4   DTEYYDILGVKP--EATSAEIKKAYRRRAMETHPDKHPNDPNAQAKFQAVGEAYQVLSDD 61

Query: 99  SNRKIYDYY-LQNGFPNYDFHKGGFYFS 125
             RK YD    ++  P   F     YF+
Sbjct: 62  ELRKRYDQLGKESAVPQQGFVDPSEYFT 89

>KLLA0C09823g 848641..850650 similar to sp|P14906 Saccharomyces
           cerevisiae YOR254c SEC63 ER protein-translocation
           complex subunit singleton, start by similarity
          Length = 669

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 56  NSSTKEITKNLRKLSKKYHPDKNPKYRKLYERLNLATQ-ILSNSSNRKIYDYYLQNGFPN 114
           +S+ KEI    RKLS K+HPDK  K     ER  +  Q ++ N + + + D   +  +  
Sbjct: 121 SSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKALTDEITKENYRK 180

Query: 115 YDFHKG 120
           Y    G
Sbjct: 181 YGHPDG 186

>Kwal_56.23782
          Length = 414

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 16/94 (17%)

Query: 56  NSSTKEITKNLRKLSKKYHPDK--NPKYRKLYE----RLNLATQILSNSSNRKIYDYYLQ 109
           +++  EI K  R+L+ ++HPDK  +   R+  E     +  A ++LSN   R+ YD Y  
Sbjct: 12  DATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKRRNYDTYGD 71

Query: 110 --------NGFPNYDFHK--GGFYFSRMKPKTWF 133
                    GF + DF    G F   R + +  F
Sbjct: 72  TNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDF 105

>Kwal_33.13451
          Length = 287

 Score = 32.0 bits (71), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 8/87 (9%)

Query: 34  EISTKYGPDMNFYKFLKL-----PKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKLYER- 87
           E++  +    N Y+ L L       L   S  +  ++ R+ + K+HPDKNP       R 
Sbjct: 27  ELNAIFNSKANLYELLNLQVRNTEDLSRLSPFQFRRSFRQQALKFHPDKNPDNAAAVSRF 86

Query: 88  --LNLATQILSNSSNRKIYDYYLQNGF 112
             LN+A  IL +   R+ Y+ +    F
Sbjct: 87  HDLNVALNILCDPVQREKYNSWFIQTF 113

>Scas_707.19
          Length = 519

 Score = 32.3 bits (72), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 48/102 (47%), Gaps = 11/102 (10%)

Query: 28  IFQLQNEISTKYGPDMNF------YKFLKLPKLQNSSTKEITKNLRKLSKKYHPD--KNP 79
           +FQ  N I+T +   +        YK L + K   SS  EI K   KL+KKYHPD  K P
Sbjct: 29  LFQFSNRIATFHTSAITHQEIKDPYKVLGINKSATSS--EIKKAYYKLAKKYHPDINKEP 86

Query: 80  KYRKLYERLNLATQILSNSSNRKIYDYYLQNGFPNYDFHKGG 121
              K +  L  A +ILS+ + +  YD +    F N D   G 
Sbjct: 87  TAEKKFHDLQNAYEILSDETKKSQYDTFGSAAF-NQDGSGGA 127

>Scas_532.2
          Length = 616

 Score = 31.6 bits (70), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 4/51 (7%)

Query: 61  EITKNLRKLSKKYHPDKNP----KYRKLYERLNLATQILSNSSNRKIYDYY 107
           E+ K  RK + ++HPDKNP    +  +++  +  A ++LS+   R  YD +
Sbjct: 19  ELKKAYRKKALQFHPDKNPDNVDEATEIFATIRSAYEVLSDPQERAWYDAH 69

>ABL194C [398] [Homologous to ScYNL227C - SH] (42210..43868) [1659
           bp, 552 aa]
          Length = 552

 Score = 31.6 bits (70), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 57  SSTKEITKNLRKLSKKYHPDKN----PKYRKLYERLNLATQILSNSSNRKIYDYY----L 108
           +S  ++ K  R+ + +YHPDKN     +  +++  +  A ++LS++  R  YD +    L
Sbjct: 15  ASDTDLKKAYRRKALQYHPDKNIGNVQQATEIFASIRAAYEVLSDAQERAWYDAHREQIL 74

Query: 109 QNGFPN 114
            + F N
Sbjct: 75  NDDFEN 80

>YJR097W (YJR097W) [2989] chr10 (612330..612848) Protein containing
           a DnaJ domain, which are part of a chaperone (protein
           folding) system that mediates interaction with heat
           shock proteins, has moderate similarity to
           uncharacterized C. albicans Orf6.2114p [519 bp, 172 aa]
          Length = 172

 Score = 30.8 bits (68), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 8/85 (9%)

Query: 43  MNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKY------RKLYERLNLATQILS 96
           +  Y+ L++P   +++  EI K  R      HPDK  K            ++  A +ILS
Sbjct: 7   LTHYEILRIPS--DATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAYKILS 64

Query: 97  NSSNRKIYDYYLQNGFPNYDFHKGG 121
           N   R+ YD  +   +    FH  G
Sbjct: 65  NIKTRREYDRLILENYKRQGFHNCG 89

>CAGL0J07370g 711363..713234 similar to sp|P53863 Saccharomyces
           cerevisiae YNL227c, start by similarity
          Length = 623

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 6/67 (8%)

Query: 45  FYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNP----KYRKLYERLNLATQILSNSSN 100
           +Y  L++    ++S  ++ K  R+ + +YHPDKNP    +   ++  +  A ++LS+   
Sbjct: 5   YYDLLEVR--SDASDLDLKKAYRRKALQYHPDKNPDNVEEATTIFAEIRAAYEVLSDPQE 62

Query: 101 RKIYDYY 107
           R  YD +
Sbjct: 63  RAWYDSH 69

>Kwal_26.8879
          Length = 656

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 6/65 (9%)

Query: 56  NSSTKEITKNLRKLSKKYHPDKNPKYRKLYERLNLATQ-ILSNSSNRKIYDY-----YLQ 109
           +S+ +EI    RKLS K+HPDK  K     ER  L  Q ++   + + + D      YL+
Sbjct: 127 SSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKALTDEVTRENYLK 186

Query: 110 NGFPN 114
            G P+
Sbjct: 187 YGHPD 191

>YNL227C (YNL227C) [4378] chr14 complement(220658..222430) Member of
           the DnaJ family of protein chaperones, contains two
           C2H2-type zinc finger domains [1773 bp, 590 aa]
          Length = 590

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 56  NSSTKEITKNLRKLSKKYHPDKNP----KYRKLYERLNLATQILSNSSNRKIYDYY 107
           ++S  E+ K  RK + +YHPDKNP    +  + +  +  A ++LS+   R  YD +
Sbjct: 14  HASDLELKKAYRKKALQYHPDKNPDNVEEATQKFAVIRAAYEVLSDPQERAWYDSH 69

>CAGL0G07469g complement(708261..710267) similar to sp|P14906
           Saccharomyces cerevisiae YOR254c SEC63, start by
           similarity
          Length = 668

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 48/112 (42%), Gaps = 12/112 (10%)

Query: 9   LVVLGLVSLSYAFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTKEITKNLRK 68
           ++ +G VS++     I      +   ++  + P    Y  L +    ++S K+I    R+
Sbjct: 94  MLFIGWVSVALLIQRIAANTETITQSMAQMFDP----YDLLGISP--SASDKDIKSAYRR 147

Query: 69  LSKKYHPDKNPKYRKLYERLNLATQILSNSSNRK------IYDYYLQNGFPN 114
           LS K+HPDK  K     ER  +    +  S   +      + + YL+ G P+
Sbjct: 148 LSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEALTDPIVRENYLKYGHPD 199

>Sklu_1935.1 YNL077W, Contig c1935 224-1609
          Length = 461

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 56  NSSTKEITKNLRKLSKKYHPDKN---PKYRKLYERLNLATQILSNSSNRKIYDYY 107
           +++ +EI K  R  + K HPDKN      ++ ++ +  A +IL ++  + +YD Y
Sbjct: 18  DATPQEIKKAYRLAALKSHPDKNNHSEDSKRKFQEICKAYEILGDAKKKLLYDRY 72

>AFR659W [3852] [Homologous to ScYGL128C (CWC23) - NSH]
           complement(1640183..1641004) [822 bp, 273 aa]
          Length = 273

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 53  KLQNSSTKEITKNLRKLSKKYHPDK---NPKYRKLYERLNLATQILSNSSNRKIYDYYL 108
           +L+     ++    R+L+ +YHPDK   + +    +  +  A  ILSNSS R  Y+ +L
Sbjct: 29  ELEAVDAAQLRAQFRRLALRYHPDKRRDDTQQNDKFVSVQKAYDILSNSSLRATYNRWL 87

>YLR090W (XDJ1) [3505] chr12 (320702..322081) Homolog of E. coli
           DnaJ [1380 bp, 459 aa]
          Length = 459

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 34/59 (57%), Gaps = 6/59 (10%)

Query: 55  QNSSTKEITKNLRKLSKKYHPDK--NPKYRKL----YERLNLATQILSNSSNRKIYDYY 107
           ++++ +EI    RKL+ K+HPDK  +   +++    ++ +  A +ILS+   +  YD Y
Sbjct: 18  RDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKKSHYDLY 76

>Sklu_2109.4 YOR254C, Contig c2109 4786-6762
          Length = 658

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 6/65 (9%)

Query: 56  NSSTKEITKNLRKLSKKYHPDKNPKYRKLYERLNLATQ-ILSNSSNRKIYDY-----YLQ 109
           +++ KE+    RKLS K+HPDK  K     +R  L  Q +L   + + + D      YL+
Sbjct: 126 SATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALTDEITKENYLK 185

Query: 110 NGFPN 114
            G P+
Sbjct: 186 FGHPD 190

>CAGL0J07964g 777358..779595 similar to sp|P53847 Saccharomyces
           cerevisiae YNL258c, hypothetical start
          Length = 745

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 12/60 (20%)

Query: 79  PKYRKLYERLNLATQILSNSSNRKIYDYYLQNGFPNYDFHKGGFY-FSRMKPKTWFLLAF 137
           PKYR+LYER+N+  ++L           +L+       F+ G FY F+  +  TW  L F
Sbjct: 674 PKYRELYERVNIVAKLLP---------LHLKEIMEM--FYNGDFYLFATEEIITWIKLLF 722

>KLLA0D07656g 658179..659594 similar to sp|P35191 Saccharomyces
           cerevisiae YFL016c MDJ1 heat shock protein - chaperone,
           start by similarity
          Length = 471

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 37/69 (53%), Gaps = 4/69 (5%)

Query: 46  YKFLKLPKLQNSSTKEITKNLRKLSKKYHPD--KNPKYRKLYERLNLATQILSNSSNRKI 103
           YK L + K  NSS  +I K   KL+KKYHPD  K    +K +  L  A +ILS+   RK 
Sbjct: 27  YKVLGINK--NSSQSDIKKAYYKLAKKYHPDINKEEDSQKKFHDLQNAYEILSDEDKRKQ 84

Query: 104 YDYYLQNGF 112
           YD +    F
Sbjct: 85  YDQFGAAAF 93

>KLLA0C02981g 268669..269157 similar to sp|P47138 Saccharomyces
           cerevisiae YJR097w singleton, start by similarity
          Length = 162

 Score = 29.3 bits (64), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 34/87 (39%), Gaps = 11/87 (12%)

Query: 44  NFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDK---------NPKYRKLYERLNLATQI 94
           +FY+ L +    ++S  EI +  R +  + HPDK         N         +  A Q 
Sbjct: 4   SFYEILGIES--DASNIEIKRAYRAMLLETHPDKSGLNYNSNGNNTSSHSVTDIQEAYQT 61

Query: 95  LSNSSNRKIYDYYLQNGFPNYDFHKGG 121
           L +   RK YD  L   F    FH  G
Sbjct: 62  LIDQDLRKKYDEELAESFKKLGFHNAG 88

>Scas_653.14
          Length = 669

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 53/116 (45%), Gaps = 13/116 (11%)

Query: 5   WKPALVVLGLVSLSYAFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTKEITK 64
           W+  +V++G     +AF  +  +  ++ N  + K      F  +  L    ++S ++I  
Sbjct: 87  WRNLIVIVG-----WAFVALLVQ--RISNNDAIKQAAVGIFDPYELLGISVSASDRDIKS 139

Query: 65  NLRKLSKKYHPDKNPKYRKLYERLNLA------TQILSNSSNRKIYDYYLQNGFPN 114
             RKLS K+HPDK  K     ER ++       T+     ++  I + +L+ G P+
Sbjct: 140 AYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEALTDEVIKENFLKYGHPD 195

>Scas_674.27
          Length = 1067

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 39  YGPDMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKLYERLNLA 91
           YGP    YK L +P L++     + K +RK+  + H     ++R+L E + LA
Sbjct: 851 YGPTF-IYKILSMPLLEDEIRSHVIKQVRKILME-HGLSQQQHRRLMEEVGLA 901

>Kwal_14.1174
          Length = 284

 Score = 28.9 bits (63), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 8/69 (11%)

Query: 41  PDMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDK----NPKYRKLYERLNLATQILS 96
           PD+N Y+ L++    + S  ++ K+ RK    YHPDK     P+ ++ + ++  A +IL+
Sbjct: 9   PDLNPYEELQVE--TSVSEAQLRKSYRKRMLLYHPDKTKDWTPEAKEKFHKIQFAFEILT 66

Query: 97  NSSNRKIYD 105
               R I+D
Sbjct: 67  KF--RDIFD 73

>Scas_651.17
          Length = 491

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 7/78 (8%)

Query: 45  FYKFLKL-PKLQNSSTKEITKNLRKLSKKYHPD--KNPKYRKLYERLNLATQILSNSSNR 101
           +Y  L L PK   ++  EI K+  KL+++ HPD  K+    +L++ +  A  IL++   +
Sbjct: 8   YYSILGLTPK---ATDNEIRKSYMKLARQLHPDKSKSDSCAELFKLVVHAHSILTDEETK 64

Query: 102 KIYDYYL-QNGFPNYDFH 118
           + YD  L   G   YD H
Sbjct: 65  RKYDTQLVMRGLGAYDPH 82

>Kwal_33.13533
          Length = 161

 Score = 28.1 bits (61), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 5/81 (6%)

Query: 44  NFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPK---YRKLYERLNLATQILSNSSN 100
           +FY+ L +    + +  +I K  +      HPDK  K    + L E +  A ++L  S +
Sbjct: 6   SFYEILGVE--ADCNEVDIKKAYKAKLLSTHPDKVGKDVGNKVLIEEIKEAYRVLIESPS 63

Query: 101 RKIYDYYLQNGFPNYDFHKGG 121
           R+ YD  L   +    FH  G
Sbjct: 64  REKYDKELAESYKKQGFHNAG 84

>Kwal_23.4420
          Length = 592

 Score = 28.5 bits (62), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 57  SSTKEITKNLRKLSKKYHPDKN----PKYRKLYERLNLATQILSNSSNRKIYDYYLQ 109
           +S  ++ K  RK +  YHPDKN     +   ++  +  A ++L++   R  YD + Q
Sbjct: 15  ASDADLKKAYRKKALVYHPDKNRDNVEEATAIFATIRAAYEVLADPQERAWYDSHKQ 71

>CAGL0E01881g 188040..189566 similar to sp|P32329 Saccharomyces
           cerevisiae YLR120c YAP3 or sp|P53379 Saccharomyces
           cerevisiae YDR144c MKC7 or sp|Q12303 Saccharomyces
           cerevisiae YLR121c YPS3, hypothetical start
          Length = 508

 Score = 28.1 bits (61), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 3/49 (6%)

Query: 8   ALVVLGLVSLSYAFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQN 56
            L+ +GL  L    ++I  +  QL N  S K  P MNF + LKL KL N
Sbjct: 185 GLLGIGLPELE---SSITIDTAQLTNTSSVKKNPYMNFPESLKLNKLIN 230

>Sklu_1951.4 YMR034C, Contig c1951 4379-5827
          Length = 482

 Score = 28.1 bits (61), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 3/85 (3%)

Query: 35  ISTKYGPDMNFYKFLKLPKLQNSSTKEITKN-LRKLSKKYHPDKNPKYRKLYERLNLATQ 93
           IS++YG D  +   L +P +   S + IT + L    KK+  D++ K     E ++L T 
Sbjct: 397 ISSQYGDDTPYLGKLLVPLVLYQSEQVITASWLVPFFKKWSQDEDEKAST--ESVDLETG 454

Query: 94  ILSNSSNRKIYDYYLQNGFPNYDFH 118
           + +NS +    DY   N    Y+ H
Sbjct: 455 LSNNSESNIDKDYDASNSSQGYNQH 479

>KLLA0C02541g complement(226721..227533) weakly similar to sp|P52868
           Saccharomyces cerevisiae YGL128c singleton, start by
           similarity
          Length = 270

 Score = 28.1 bits (61), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 7/56 (12%)

Query: 62  ITKNLRKLSKKYHPDKNPK-----YRKLYERLNLATQILSNSSNRKIYDYYLQNGF 112
           I K  RKLS   HPDK+ +      R  ++ L  A +IL  S ++K YD + Q  F
Sbjct: 35  INKQFRKLSLTLHPDKSNESDLNITRDRWDNLQSAYRIL--SEHKKEYDIWYQRTF 88

>KLLA0D19602g 1653096..1654958 similar to sp|P53863 Saccharomyces
           cerevisiae YNL227c, start by similarity
          Length = 620

 Score = 28.1 bits (61), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 36/67 (53%), Gaps = 6/67 (8%)

Query: 45  FYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKN----PKYRKLYERLNLATQILSNSSN 100
           +Y  L +    +++  ++ +  RK +  YHPDKN     +  +++ ++  A ++LS++  
Sbjct: 5   YYDLLDVK--SDATDTDLKRAYRKKALLYHPDKNRNNIEEATEVFAQIRAAYEVLSDAQE 62

Query: 101 RKIYDYY 107
           R  YD +
Sbjct: 63  RAWYDAH 69

>CAGL0G00154g 14591..15892 highly similar to sp|P32527 Saccharomyces
           cerevisiae YGR285c ZUO1, start by similarity
          Length = 433

 Score = 28.1 bits (61), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 7/70 (10%)

Query: 43  MNFYKFLKLPKLQNSSTK-EITKNLRKLSKKYHPDKNPKYRK------LYERLNLATQIL 95
            + Y  + L KL+  +T+ +I K+ RK   KYHPDK   +         ++ +  + + L
Sbjct: 96  ADLYAAMGLSKLRFRATENQIIKSHRKQVVKYHPDKQSAHGAGLDQDGFFKIIQKSFETL 155

Query: 96  SNSSNRKIYD 105
           ++ + R+ YD
Sbjct: 156 TDVTKRRQYD 165

>YJL162C (YJL162C) [2759] chr10 complement(114176..115624) Protein
           that contains a DnaJ chaperonin domain [1449 bp, 482 aa]
          Length = 482

 Score = 28.1 bits (61), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 37/67 (55%), Gaps = 4/67 (5%)

Query: 45  FYKFLKLPKLQNSSTKEITKNLRKLSKKYHPD--KNPKYRKLYERLNLATQILSNSSNRK 102
           +Y  L L    N+++ E+ K+  KL++  HPD  K+ K  +L++ +  A  IL++   + 
Sbjct: 14  YYSILGL--TSNATSSEVHKSYLKLARLLHPDKTKSDKSEELFKAVVHAHSILTDEDQKL 71

Query: 103 IYDYYLQ 109
            YD  L+
Sbjct: 72  RYDRDLK 78

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,650,420
Number of extensions: 415953
Number of successful extensions: 1526
Number of sequences better than 10.0: 127
Number of HSP's gapped: 1476
Number of HSP's successfully gapped: 128
Length of query: 291
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 190
Effective length of database: 13,099,691
Effective search space: 2488941290
Effective search space used: 2488941290
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)