Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YFR039C51050124740.0
Scas_687.205715184119e-44
CAGL0C02167g4804293401e-34
Scas_712.226242673372e-33
Kwal_47.191847122232973e-28
CAGL0I04092g5562322883e-27
AFR244C5722522698e-25
Sklu_2433.186272042699e-25
YGL228W (SHE10)5772152634e-24
KLLA0A01177g6362112272e-19
KLLA0B11143g57181750.38
KLLA0E21340g145767692.6
YJL180C (ATP12)325111672.9
CAGL0C02959g88931649.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YFR039C
         (501 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YFR039C (YFR039C) [1721] chr6 complement(231999..233531) Protein...   957   0.0  
Scas_687.20                                                           162   9e-44
CAGL0C02167g 220619..222061 weakly similar to sp|P43611 Saccharo...   135   1e-34
Scas_712.22                                                           134   2e-33
Kwal_47.19184                                                         119   3e-28
CAGL0I04092g 358219..359889 weakly similar to sp|P53075 Saccharo...   115   3e-27
AFR244C [3436] [Homologous to ScYGL228W (SHE10) - SH; ScYFR039C ...   108   8e-25
Sklu_2433.18 YGL228W, Contig c2433 29391-31274                        108   9e-25
YGL228W (SHE10) [1770] chr7 (67597..69330) Protein of unknown fu...   105   4e-24
KLLA0A01177g 108738..110648 some similarities with sp|P53075 Sac...    92   2e-19
KLLA0B11143g 977257..978972 weakly similar to sp|P48837 Saccharo...    33   0.38 
KLLA0E21340g 1896457..1900830 highly similar to sp|P04051 Saccha...    31   2.6  
YJL180C (ATP12) [2743] chr10 complement(87581..88558) F1-ATP syn...    30   2.9  
CAGL0C02959g complement(291780..294449) similar to sp|P32563 Sac...    29   9.2  

>YFR039C (YFR039C) [1721] chr6 complement(231999..233531) Protein of
           unknown function, has weak similarity to uncharacterized
           S. cerevisiae She10p [1533 bp, 510 aa]
          Length = 510

 Score =  957 bits (2474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/501 (93%), Positives = 468/501 (93%)

Query: 1   MKAVFKVTTALLACVFIARYLVCQQNGLGSFATDLQPICRHTEFSVGSLFDSKLVEGSAV 60
           MKAVFKVTTALLACVFIARYLVCQQNGLGSFATDLQPICRHTEFSVGSLFDSKLVEGSAV
Sbjct: 1   MKAVFKVTTALLACVFIARYLVCQQNGLGSFATDLQPICRHTEFSVGSLFDSKLVEGSAV 60

Query: 61  SDYLVGKYSQSIKPLIERYPNSSLKRIMGYFYRFWYNIFSFLRLNELCCSLHSKLGPLLN 120
           SDYLVGKYSQSIKPLIERYPNSSLKRIMGYFYRFWYNIFSFLRLNELCCSLHSKLGPLLN
Sbjct: 61  SDYLVGKYSQSIKPLIERYPNSSLKRIMGYFYRFWYNIFSFLRLNELCCSLHSKLGPLLN 120

Query: 121 HLRIAWYYLKPYTDNVKNVLENPFNSSTDWMKYGSFSADGTLTKPIFXXXXXXXXXXXXX 180
           HLRIAWYYLKPYTDNVKNVLENPFNSSTDWMKYGSFSADGTLTKPIF             
Sbjct: 121 HLRIAWYYLKPYTDNVKNVLENPFNSSTDWMKYGSFSADGTLTKPIFETDSETEDYEDDE 180

Query: 181 XXXXXXXXXXXXXXXXXXXXNKEYEFDGVQDGHGNSQLVTAAILQDLSKIIIGSNSHAEL 240
                               NKEYEFDGVQDGHGNSQLVTAAILQDLSKIIIGSNSHAEL
Sbjct: 181 NENEDEDEDEDEDDVGIEDENKEYEFDGVQDGHGNSQLVTAAILQDLSKIIIGSNSHAEL 240

Query: 241 ETYEAESLKMEYEAWIKAIDSKIHSAMALLDSEIQSVFEAEVQNKSIEITRNLDDLNTTV 300
           ETYEAESLKMEYEAWIKAIDSKIHSAMALLDSEIQSVFEAEVQNKSIEITRNLDDLNTTV
Sbjct: 241 ETYEAESLKMEYEAWIKAIDSKIHSAMALLDSEIQSVFEAEVQNKSIEITRNLDDLNTTV 300

Query: 301 NEQLVFLDSKIKDINCTSKFDPVQNKIKYFDESGQVELEAYITKSSITSILKNYKIHLLD 360
           NEQLVFLDSKIKDINCTSKFDPVQNKIKYFDESGQVELEAYITKSSITSILKNYKIHLLD
Sbjct: 301 NEQLVFLDSKIKDINCTSKFDPVQNKIKYFDESGQVELEAYITKSSITSILKNYKIHLLD 360

Query: 361 FEKSLFHSLDSFLTEMAKLAESIRLENVEVYEEWGDVMISQWSQRMAYMDVRGLHLEDQY 420
           FEKSLFHSLDSFLTEMAKLAESIRLENVEVYEEWGDVMISQWSQRMAYMDVRGLHLEDQY
Sbjct: 361 FEKSLFHSLDSFLTEMAKLAESIRLENVEVYEEWGDVMISQWSQRMAYMDVRGLHLEDQY 420

Query: 421 DPAYIEENHSNWLRFMELKKKVISERNRLVKHDLDMTLILEWITKLKADFQNTKNNIQDT 480
           DPAYIEENHSNWLRFMELKKKVISERNRLVKHDLDMTLILEWITKLKADFQNTKNNIQDT
Sbjct: 421 DPAYIEENHSNWLRFMELKKKVISERNRLVKHDLDMTLILEWITKLKADFQNTKNNIQDT 480

Query: 481 FLQRMNTADTLFKNRELKEQL 501
           FLQRMNTADTLFKNRELKEQL
Sbjct: 481 FLQRMNTADTLFKNRELKEQL 501

>Scas_687.20
          Length = 571

 Score =  162 bits (411), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 139/518 (26%), Positives = 235/518 (45%), Gaps = 42/518 (8%)

Query: 1   MKAVFKVTTALLACVFIARYLVCQQNGLGSFATD---LQPICR-HTEFSVGSLFDSKLVE 56
           M+   K+  A++  V +  +     N   + A     L P  + +    V SL + K+  
Sbjct: 1   MQISRKILGAIIGLVIVVSHYYISANNDSTNAVSGSLLVPYMKMYKGIVVSSLHNLKIDY 60

Query: 57  GSAVSDYLV------GKYSQSIKPLIERYPNSSLKRIMG---YFYR-----FWYNIFSFL 102
            + +  YL       G++  ++K  I    +S   RI+    YF       F+ N   F+
Sbjct: 61  VTTIEPYLAELVSWTGQFCSNVK--IHPVSHSVWLRILSAYEYFINEILSPFYENTLLFI 118

Query: 103 RLNELCCSLHSKLGPLLNHLRIAWYYLKPYTDNVKNVLENPFNSSTDWMKYGSFSAD--- 159
           R N+LCC +H+KLGP L HLRI  +Y++ Y + +K    + F       KYG FS D   
Sbjct: 119 RRNKLCCKIHAKLGPRLQHLRIILFYIRRYMERLKLESYDEFEDLKS--KYGFFSFDFAS 176

Query: 160 ----GTLTKPIFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNKEYEFDGVQDGHGN 215
               GTL++ +                                  N++ E D ++     
Sbjct: 177 GMLNGTLSESLHQDTLSSARETDNETEIETDTEPESDDIINEEVINQKLE-DSIE----- 230

Query: 216 SQLVTAAILQDLSKIIIGSNSHAELETYEAESLKMEYEAWIKAIDSKIHSAMALLDSEIQ 275
             L    I  D++   + + +   L+   A  L  E+ AWI A++ K  +A+     EI+
Sbjct: 231 --LNNLPINADINGYHLENQADGILDRKVA--LNNEFNAWINAVEGKSSNALLAFQDEIE 286

Query: 276 SVFEAEVQNKSIEITRNLDDLNTTVNEQLVFLDSKIKDINCTSKFDPVQNKIKYFDESGQ 335
              E E +  + E+   L++L   +  Q+  ++  I+DI+C SK+DP  N++ YFD +G 
Sbjct: 287 RSIEREGEYFTNEMEIRLNNLKNEIESQIDKIEKYIQDIDCISKYDPSSNELVYFDSNGT 346

Query: 336 VELEAYITKSSITSILKNYKIHLLDFEKSLFHS-LDSFLTEMAKLAESIRLENVEVYEEW 394
            ++  Y+++  + SI       + +F   +  + ++ F+  M    E+I  ENVEVYEEW
Sbjct: 347 RKILEYVSRPLMDSIFLKAHFQIDEFRNEMEDTVINPFIYSMQYKLETIHQENVEVYEEW 406

Query: 395 GDVMISQWSQRMAYMDVRGLHLEDQYDPAYIEENHSNWLRFMELKKKVISERNRLVKHDL 454
           GD+MIS+WS+RMA  DV    L D  DP + E++   W RF++LK +V+  R+ L   + 
Sbjct: 407 GDIMISEWSRRMAQFDVVSGQLLDD-DPLF-EQSAKKWQRFLDLKHEVVEMRDTLYYSEP 464

Query: 455 DMTLILEWITKLKADFQNTKNNIQDTFLQRMNTADTLF 492
           D T +   I+  +   +   +   + F      AD  F
Sbjct: 465 DSTALEGIISNARIKLEEIIDEANNQFEALGKKADVAF 502

>CAGL0C02167g 220619..222061 weakly similar to sp|P43611
           Saccharomyces cerevisiae YFR039c, hypothetical start
          Length = 480

 Score =  135 bits (340), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 101/429 (23%), Positives = 185/429 (43%), Gaps = 33/429 (7%)

Query: 94  FWYNIFSFLRLNELCCSLHSKLGPLLNHLRIAWYYLKPYTDNVKNVLENPFNSSTDWMKY 153
            W  +  F+  N LCC+LH KLGPLL HLRI  YYLKP+     +   + F      + +
Sbjct: 56  MWGKVVEFVHRNRLCCTLHRKLGPLLQHLRIVLYYLKPFAQQASSSFNDGFAILRGNLDF 115

Query: 154 GSFSADGTLTKPIFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNKEYEFDGVQDGH 213
                  ++   I                                  NK+   +  Q   
Sbjct: 116 SRIDEGYSMLSLI---------NNGRNVIESDEEDEDEEDGDEKSTKNKKQSKNKEQAES 166

Query: 214 GNSQLVTAAILQDLSKIIIGSNSH---------AELETYEAESLKMEYEAWIKAIDSKIH 264
            N   +  A+L D + + +  ++          +EL   E    +  +  W+K+I  K  
Sbjct: 167 SNVDAIVDAVLNDPTDVTLHKDTDDSAVQFPQLSELINTEVLLQEGGFNIWVKSISRKFK 226

Query: 265 SAMALLDSEIQSVFEAEVQNKSIEITRNLDDLNTTVNEQLVFLDSKIKDINCTSKFDPVQ 324
           +    L  E+ +   + V +      +++++L + ++ Q+  L   +++INCT  +D   
Sbjct: 227 AIENELSQEVDNTISSTVVSGVENFQKDIEELRSDMDAQISILKDTVQNINCTMIYDENT 286

Query: 325 NKIKYFDESGQVELEAYITKSSITSILKNYKIHLLDFEKSLFHSLDSFLTEMAKLAESIR 384
           + + Y+D +GQ  L+ Y+T+  I   LK+ +  L    +++   +++ + +     E++R
Sbjct: 287 DSVFYYDHTGQKLLDTYVTRPLIMHHLKSTETRLEQLVEAVKLQVENMVEQSHIALEAVR 346

Query: 385 LENVEVYEEWGDVMISQWSQRMAYMDV--------RGLHL------EDQYDPAYIEENHS 430
            E +E YEEWGD   ++WS+ MAY D+        R L +      EDQ D   + + + 
Sbjct: 347 NETIEAYEEWGDTFYTEWSKYMAYRDIYDEDGEEPRPLAIDGKGKGEDQGDDE-VAKIYE 405

Query: 431 NWLRFMELKKKVISERNRLVKHDLDMTLILEWITKLKADFQNTKNNIQDTFLQRMNTADT 490
           +W  F   KK +I  R++L+   LD   + ++ T L +   + +           + AD 
Sbjct: 406 DWFEFTLHKKDIIQFRDQLLHKQLDTKKLKQFETSLDSQLDSLEKTYTAQIQSLRSQADR 465

Query: 491 LFKNRELKE 499
           L K+R+ KE
Sbjct: 466 LLKDRDHKE 474

>Scas_712.22
          Length = 624

 Score =  134 bits (337), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 79/267 (29%), Positives = 149/267 (55%), Gaps = 17/267 (6%)

Query: 219 VTAAILQDLSKIIIGSNSHA--ELETYEAESLKMEYEAWIKAIDSKIHSAMALLDSEIQS 276
           VT+ I+++    +  ++  A  +L+  E + L+ +++ W   I+ KI S   L D ++  
Sbjct: 251 VTSTIVKNWPGKVATTSGEAVKDLDVDEQQLLQSDFDNWSNTIEQKIASINKLFDKDVAK 310

Query: 277 VFEAEVQNKSIEITRNLDDLNTTVNEQLVF--LDSKIKDINCTSKFDPVQNKIKYFDESG 334
           + + E+++   +    + +LN     +L+F  L+  I+DINCT   DP  N+  YFD +G
Sbjct: 311 LIKKEMKSNEQKFKDKIQNLNQ--ESELLFQDLNKAIQDINCTESLDPQTNETIYFDRNG 368

Query: 335 QVELEAYITKSSITSILKNYKIHLLDFEKSLFHSLDSFLTEMAKLAESIRLENVEVYEEW 394
           + +LE YI +  I  + +  +  L +    + +  +  + ++ K  ESIR E+++VYEEW
Sbjct: 369 ETQLEQYIERPLIRELFEKTRATLNELIADIQNDENVLIEKVNKKVESIRDEHLDVYEEW 428

Query: 395 GDVMISQWSQRMAYMDVRGLHLEDQYDPAYIEENHSNWLRFMELKKKVISERNRLVKHDL 454
           G++M+++WS+RMAY+DV   HL  +   A    +  NW +F+++KK+VI  R+ LV+H  
Sbjct: 429 GEIMVNEWSKRMAYVDVVAAHLNAEEKEAKKTMSEENWKKFLKVKKQVIGARDELVEHVP 488

Query: 455 DMTLILEWITKLKADFQNTKNNIQDTF 481
           ++  + +++           NNIQ+T 
Sbjct: 489 NIKTMEQFL-----------NNIQETL 504

>Kwal_47.19184
          Length = 712

 Score =  119 bits (297), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 125/223 (56%), Gaps = 8/223 (3%)

Query: 233 GSNSH---AELETYEAESLKMEYEAWIKAIDSKIHSAMALLDSEIQSVFEAEVQNKSIEI 289
            S+SH   A LE    + ++ E+EAW  A+  K  + ++  D+EIQ + ++++      +
Sbjct: 250 ASSSHEDDASLEVPLRDLVQDEFEAWSTAVQQKASNTLSQFDAEIQDLVDSKLSEIRPNV 309

Query: 290 TRNLDDLNTTVNEQLVFLDSKIKDINCTSKFDPVQNKIKYFDESGQVELEAYITKSSITS 349
           T  L  ++ +       ++  I D++C  + DPV  +  YF+  G  +L  Y+T+  +  
Sbjct: 310 TTLLQSISDSCQAYYRDINKAILDVDCNMELDPVTGEQLYFNRDG-TQLRKYMTRPLMRE 368

Query: 350 ILKNYKIHLLDFEKSLFHSLDSFLTEMAKLAESIRLENVEVYEEWGDVMISQWSQRMAYM 409
                  H+ +  + +   L+ F+  + K  + IR E++E+YEEWGDVMIS+WS+RMAY 
Sbjct: 369 YFSAAHAHVEERLEFVRAQLEKFVAMVNKEVDEIRQESLELYEEWGDVMISEWSKRMAYG 428

Query: 410 DVRGLHLEDQYDPAYIEENHSNWLRFMELKKKVISERNRLVKH 452
           D+      D +D    ++ H NW +F++LKK+V++ R++L++H
Sbjct: 429 DIFHAIGSDSFD----QQQHDNWKQFLKLKKRVVATRDQLMQH 467

>CAGL0I04092g 358219..359889 weakly similar to sp|P53075
           Saccharomyces cerevisiae YGL228w SHE10, start by
           similarity
          Length = 556

 Score =  115 bits (288), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 123/232 (53%), Gaps = 8/232 (3%)

Query: 248 LKMEYEAWIKAIDSKIHSAMALLDSEIQSVFEAEVQNKSIEITRNLDDLNTTVNEQLVFL 307
           L+ +++ W   ID K+     +L  +++   + ++          L  L+   N+    +
Sbjct: 273 LQRDFDKWTSNIDKKVKMVNKMLVRDVKKHLKPKIDANDKLFKDKLKVLHKEANDNFQLI 332

Query: 308 DSKIKDINCTSKFDPVQNKIKYFDESGQVELEAYITKSSITSILKNYKIHLLDFEKSLFH 367
           +  I+DINCT   DP   K  YFD  G+ ++E YIT+  I ++L + +  L      + +
Sbjct: 333 NKAIQDINCTQGIDPETGKQIYFDSEGKSQIEKYITREMIRTMLNDTQTTLNSLVADIEN 392

Query: 368 SLDSFLTEMAKLAESIRLENVEVYEEWGDVMISQWSQRMAYMDVRGLHLEDQYD-PAYIE 426
            +   L +  K+AE+ R +++  +EEWGD+MI++WS+++AY+DV   H + +++  +  E
Sbjct: 393 DVSKILEDFKKIAENSREQHLTTFEEWGDIMINEWSKKLAYLDVLAPHEDAEHEGKSKTE 452

Query: 427 ENHSNWLRFMELKKKVISERNRLVKHDLDMTLILEWITKLKADFQNTKNNIQ 478
            +  NW +FM +KK+++  R+++ K  +        I++ K    N +N +Q
Sbjct: 453 LSEKNWKKFMAIKKQILDARDKMAKRQIK-------ISEFKLLLDNVQNTLQ 497

>AFR244C [3436] [Homologous to ScYGL228W (SHE10) - SH; ScYFR039C -
           SH] (877997..879715) [1719 bp, 572 aa]
          Length = 572

 Score =  108 bits (269), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 70/252 (27%), Positives = 128/252 (50%), Gaps = 9/252 (3%)

Query: 251 EYEAWIKAIDSKIHSAMALLDSEIQSVFEAEVQNKSIEITRNLDDLNTTVNEQLVFLDSK 310
           E+ AW +AI+ K  S +     E+      + +  + +    L  ++    E    ++  
Sbjct: 251 EFSAWQQAIERKADSVLQAFTEEVGEFEMQQHEAVAPKFRALLKHISAKSQEHYAKINQA 310

Query: 311 IKDINCTSKFDPVQNKIKYFDESGQVELEAYITKSSITSILKNYKIHLLDFEKSLFHSLD 370
           I+DIN T + DP  N+  +FD  G  +L  YIT+  +          L +    +   L 
Sbjct: 311 IRDINSTMELDPATNQTIWFDAHG-TQLHQYITRPLMREYFSQANDELANITNHIRAELR 369

Query: 371 SFLTEMAKLAESIRLENVEVYEEWGDVMISQWSQRMAYMDVRGLHLEDQYDPAYIEENHS 430
             +  +    + IR E++EVYEEW DVM+S+WS+RMAY+DV    LE +       E + 
Sbjct: 370 EVVDSVNGQVDVIRQEHIEVYEEWADVMVSEWSRRMAYIDVVDRDLEAE------AERNR 423

Query: 431 NWLRFMELKKKVISERNRLVKHDLDMTLILEWITKLKADFQN-TKNNIQDTFLQRMNTAD 489
           NW RF++LKK+VI  R++L++H +    +  ++ ++++  +   + N +  ++ R + A+
Sbjct: 424 NWKRFLKLKKRVIKVRDQLLEHPVKFNQLETFLKEIQSTLRILAQENGEYLYILR-SKAN 482

Query: 490 TLFKNRELKEQL 501
             F+ RE  ++L
Sbjct: 483 LSFQEREKNDRL 494

>Sklu_2433.18 YGL228W, Contig c2433 29391-31274
          Length = 627

 Score =  108 bits (269), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 108/204 (52%), Gaps = 8/204 (3%)

Query: 251 EYEAWIKAIDSKIHSAMALLDSEIQSVFEAEVQNKSIEITRNLDDLNTTVNEQLVFLDSK 310
           EY+AW   ++ K ++A+     E+      ++++ S  ++  L +++ T       ++  
Sbjct: 277 EYQAWSNTVERKANTALDAFTKEVHDYEIEQLESVSPLMSSLLQNISNTTQLHFQKINKA 336

Query: 311 IKDINCTSKFDPVQNKIKYFDESGQVELEAYITKSSITSILKNYKIHLLDFEKSLFHSLD 370
           I DINCT +      ++ +FD  G  +L+ YIT+  +  +       L      L   L 
Sbjct: 337 ILDINCTMEIGENGEQL-FFDRHG-TQLKEYITRPLMRGLFTAANEELTAMSDDLRARLK 394

Query: 371 SFLTEMAKLAESIRLENVEVYEEWGDVMISQWSQRMAYMDVRGLHLEDQYDPAYIEENHS 430
            F+  +    + IR E++EVYEEWGDVMIS+WS+RMAY+DV  L  +D        E HS
Sbjct: 395 EFVNTVNDHVDVIRNEHLEVYEEWGDVMISEWSKRMAYVDVVALDEQDD------SEQHS 448

Query: 431 NWLRFMELKKKVISERNRLVKHDL 454
           NW  F++LK+ VI  R+ LV+H +
Sbjct: 449 NWKNFLKLKRNVIKTRDLLVEHPV 472

>YGL228W (SHE10) [1770] chr7 (67597..69330) Protein of unknown
           function, has weak similarity to uncharacterized S.
           cerevisiae Yfr039p [1734 bp, 577 aa]
          Length = 577

 Score =  105 bits (263), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 104/215 (48%), Gaps = 3/215 (1%)

Query: 248 LKMEYEAWIKAIDSKIHSAMALLDSEIQSVFEAEVQNKSIEITRNLDDLNTTVNEQLVFL 307
           L+ +++ W + I  K    + L + ++      ++  ++         L+    +    +
Sbjct: 275 LQEDFDMWSETILQKTQDVIQLFEKDVSKYINGKLVEEANHFKAKFQSLDDKSKKFFSKI 334

Query: 308 DSKIKDINCTSKFDPVQNKIKYFDESGQVELEAYITKSSITSILKNYKIHLLDFEKSLFH 367
              I DI C    D    K  +FD+SG  E+  YIT+  +       +  L +   ++  
Sbjct: 335 SLAINDIECVEGIDSETGKKIFFDKSGSTEISQYITRELVREYFNETRSTLDELTNAMEK 394

Query: 368 SLDSFLTEMAKLAESIRLENVEVYEEWGDVMISQWSQRMAYMDVRGLHLEDQYDPAYIEE 427
            L     E+ K   +IR ENVEV+EEWGD+++++WS+RMAY+DV   H+    D    EE
Sbjct: 395 DLSEITDEIEKKVNAIREENVEVFEEWGDIIVNEWSKRMAYVDVINAHMGADDDTTLDEE 454

Query: 428 NHS---NWLRFMELKKKVISERNRLVKHDLDMTLI 459
                 NW +F++ KK++I  R++L  H  D++ +
Sbjct: 455 KAKSSVNWKKFLKGKKQIIESRDKLAHHSADLSRV 489

>KLLA0A01177g 108738..110648 some similarities with sp|P53075
           Saccharomyces cerevisiae YGL228w SHE10, hypothetical
           start
          Length = 636

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 106/211 (50%), Gaps = 4/211 (1%)

Query: 246 ESLKMEYEAWIKAIDSKIHSAMALLDSEIQSVFEAEVQNKSIEITRNLDDLNTTVNEQLV 305
           E L+ ++ +W   I++K+ + M   +++I    + ++ +    +   L   + T      
Sbjct: 314 EMLRNDFMSWKITIENKLSNTMKDFENDINEFAQEKLDHIQPTLADLLKRASNTSQTNFQ 373

Query: 306 FLDSKIKDINCTSKFDPVQNKIKYFDESGQVELEAYITKSSITSILKNYKIHLLDFEKSL 365
            +   I D+NCT   DP  NK  +FD++   +L  Y+T+  +               + +
Sbjct: 374 IITKAIMDVNCTESVDPKTNKTIWFDQNN-TQLPKYMTRELMREYFSAAHSQFDALSQEI 432

Query: 366 FHSLDSFLTEMAKLAESIRLENVEVYEEWGDVMISQWSQRMAYMDVRGLHLEDQYDPAYI 425
              L     E+    E +R ENVE++EEW DVMI++WS+ +AY+DV  ++ E   D    
Sbjct: 433 RAHLRKLADEVNDHVEVLRQENVELFEEWADVMITEWSKNLAYVDV-AVNEEKLADLE-- 489

Query: 426 EENHSNWLRFMELKKKVISERNRLVKHDLDM 456
           +E   NW  FM+LK++VI  R+ L++H + +
Sbjct: 490 KEQRKNWKDFMKLKRQVIKTRDTLMEHPVKL 520

>KLLA0B11143g 977257..978972 weakly similar to sp|P48837
           Saccharomyces cerevisiae YGR119c NUP57 nuclear pore
           protein, start by similarity
          Length = 571

 Score = 33.5 bits (75), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 39/81 (48%), Gaps = 7/81 (8%)

Query: 416 LEDQYDPAYIEENHSNWLRFMELKKKVISERNRLVKHDLDMTLILEWITKLKADFQNTKN 475
           L++  DPA + +N+  W R       V+ ER + +   LD TL++  I++   +    KN
Sbjct: 472 LQESNDPAGLGKNNELWARL-----SVLKERAKNISEQLDSTLVV--ISENGGNSNGKKN 524

Query: 476 NIQDTFLQRMNTADTLFKNRE 496
           N  +    R+N    +  N++
Sbjct: 525 NQDEELEDRVNKIAEILSNQQ 545

>KLLA0E21340g 1896457..1900830 highly similar to sp|P04051
            Saccharomyces cerevisiae YOR116c RPO31 DNA-directed RNA
            polymerase III, 160 KD subunit, start by similarity
          Length = 1457

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 320  FDPVQNKIKYFDESGQVELEAYITKSSITSILKNYKIHLLDFEKSLFHSLDSFLTEMAKL 379
              P++NK+K +D  GQ EL             K+  I   D E+S + SL  F+TE A  
Sbjct: 965  LQPLENKLKRYDNIGQ-ELRKEDEH-------KDEYIDQFDAERSFYQSLREFMTEKALT 1016

Query: 380  AESIRLE 386
              S+R E
Sbjct: 1017 LASLRGE 1023

>YJL180C (ATP12) [2743] chr10 complement(87581..88558) F1-ATP
           synthase assembly protein [978 bp, 325 aa]
          Length = 325

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 50/111 (45%), Gaps = 12/111 (10%)

Query: 293 LDDLNTTVNEQLVFLDSKIKDINCTSKFDPVQNKIKYFDES------GQVELEAYITKSS 346
           L + ++  N +L  LD+ I  +    + D V+N  K +  S        +E     TKS 
Sbjct: 196 LRNFSSESNIRLQILDADIHGLRGNQQSDIVKNAAKKYMSSLSPWDLAILEKTVLTTKSF 255

Query: 347 ITSILKNYKIHLLDFEKSLFHSLDSFLTEMAKLAESIRLENVEVYEEWGDV 397
           I  +L      LL+ +K   + + +  T+M  +  +  LE +   E+WG+V
Sbjct: 256 ICGVL------LLENKKDTANLIPALKTDMDNIVRAATLETIFQVEKWGEV 300

>CAGL0C02959g complement(291780..294449) similar to sp|P32563
           Saccharomyces cerevisiae YOR270c VPH1 or sp|P37296
           Saccharomyces cerevisiae YMR054w STV1, hypothetical
           start
          Length = 889

 Score = 29.3 bits (64), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 285 KSIEITRNLDDLNTTVNEQLVFLDSKIKDIN 315
           K +EI RNL DLNT +   +V L+S++  I+
Sbjct: 280 KLLEINRNLQDLNTVLQTAMVTLESELYAIS 310

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,543,164
Number of extensions: 660075
Number of successful extensions: 2450
Number of sequences better than 10.0: 69
Number of HSP's gapped: 2519
Number of HSP's successfully gapped: 73
Length of query: 501
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 395
Effective length of database: 12,926,601
Effective search space: 5106007395
Effective search space used: 5106007395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)