Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER169W (RPH1)79678239590.0
Kwal_56.2345382886318330.0
Scas_681.1986484818280.0
AGR117C79982117970.0
CAGL0L11880g98037413731e-176
KLLA0C17710g82136913441e-174
Scas_76.12282246878e-85
YDR096W (GIS1)8944827212e-82
KLLA0D10758g8501783133e-29
Sklu_2303.67951833027e-28
CAGL0H00528g7402342954e-27
ABR167C7761832901e-26
Kwal_55.218555211862861e-26
YJR119C7282492803e-25
Scas_691.277352122525e-22
CAGL0G08107g625651954e-15
Scas_709.32822561696e-12
AGR172W1057781689e-12
CAGL0E04884g1489571633e-11
KLLA0F13046g1379571608e-11
YKL062W (MSN4)630531581e-10
Scas_649.28730561571e-10
ACL057W520911533e-10
AGR031W140541423e-10
Scas_721.921152571544e-10
Scas_602.9547571534e-10
Sklu_2181.1410511498e-10
YDR043C (NRG1)231751449e-10
CAGL0L06072g300561451e-09
Kwal_47.17241403521471e-09
Sklu_2357.7157501381e-09
KLLA0C17072g474971462e-09
YDR216W (ADR1)13231251455e-09
CAGL0K02145g317511406e-09
KLLA0F18524g357931407e-09
Kwal_27.10925264541388e-09
Kwal_26.8351698511428e-09
CAGL0K12078g463501419e-09
ABR089C571561401e-08
Kwal_56.2420615022181411e-08
Sklu_2351.6548501382e-08
KLLA0B04477g13321241392e-08
KLLA0F26961g694511382e-08
CAGL0M13189g541511372e-08
Scas_703.231341601374e-08
Scas_718.44266501324e-08
YJR127C (ZMS1)1380741365e-08
CAGL0H04213g1321941356e-08
Scas_569.2293541308e-08
YMR037C (MSN2)704511339e-08
KLLA0E10989g474501321e-07
CAGL0M00594g1020511331e-07
AER159C1191511331e-07
Kwal_27.11460531931311e-07
Kwal_47.166211178511331e-07
CAGL0F05995g597641321e-07
Scas_717.17525651302e-07
Sklu_2443.22213741252e-07
YBR066C (NRG2)220561252e-07
YER130C443511302e-07
Scas_707.31289571272e-07
AFL127C15212751312e-07
YML081W1251511303e-07
YPL038W (MET31)177521223e-07
YOR113W (AZF1)914511285e-07
Kwal_14.2278463501265e-07
CAGL0K04631g1013551276e-07
AFR471C389521257e-07
CAGL0A01628g424501257e-07
ACR264W769511267e-07
YGL035C (MIG1)504501257e-07
CAGL0L07480g314501239e-07
Scas_575.3455501231e-06
AFR580C838561241e-06
Kwal_47.17888786501241e-06
KLLA0B07909g922561241e-06
CAGL0K09372g396541222e-06
YGL209W (MIG2)382581202e-06
Scas_712.42*290511183e-06
YGR067C794561204e-06
Scas_697.35839511204e-06
KLLA0F23782g782501187e-06
AGL207W277501148e-06
Scas_683.25879511178e-06
Kwal_47.19045266561139e-06
CAGL0M01870g315751149e-06
KLLA0B00605g239511112e-05
YPL230W391571122e-05
Scas_378.1208531082e-05
AGL246W227871093e-05
Scas_693.31635591123e-05
YMR176W (ECM5)14112141123e-05
Scas_719.681350731115e-05
Kwal_26.8021507521096e-05
YDR253C (MET32)191681047e-05
CAGL0L03916g642501097e-05
Scas_687.33288671069e-05
AGL071C396531061e-04
Scas_636.14d275581051e-04
Scas_568.5199531021e-04
KLLA0B03454g472551052e-04
Scas_627.17d275581023e-04
YDR146C (SWI5)709551043e-04
CAGL0J05060g713481033e-04
ADL198W547721033e-04
KLLA0F11682g374721024e-04
KLLA0D16456g854471034e-04
Scas_720.3914552241034e-04
Kwal_56.23925745631024e-04
CAGL0C02519g318501005e-04
AGL197W844541026e-04
KLLA0E08679g596661017e-04
YMR070W (MOT3)490741007e-04
YER028C394691007e-04
CAGL0M06831g645481007e-04
Scas_717.60d16758957e-04
Scas_720.3331653998e-04
KLLA0C16203g14541991018e-04
CAGL0E01331g689721000.001
YJL056C (ZAP1)880481000.001
KLLA0A04609g42358980.001
CAGL0E06116g61343970.002
KLLA0E18645g43169950.003
YMR182C (RGM1)21144920.003
CAGL0K03003g64771960.003
Kwal_23.540042944940.003
KLLA0C16005g33155930.003
AEL174W66149940.004
CAGL0L12562g223148900.005
Scas_711.5683241930.005
YLR131C (ACE2)77059930.006
Sklu_1527.120591890.006
Sklu_2389.276744920.008
AFL136W40955910.008
CAGL0B02651g18952870.010
Kwal_14.220625448880.012
YNL027W (CRZ1)67858900.012
CAGL0G10021g39453890.014
CAGL0M04323g70357890.016
Sklu_2398.2288181870.017
AEL278W47650880.017
Kwal_14.254371151880.020
YPR186C (PZF1)42953880.020
KLLA0F01463g78149880.024
Scas_695.257148870.027
Scas_721.5619954840.030
KLLA0F20636g28561850.032
Kwal_27.1046730250850.035
Kwal_47.1657788150860.041
Scas_631.743353840.051
CAGL0I02838g65539840.057
CAGL0E03762g58473840.071
KLLA0E00726g51757820.097
Sklu_2126.544844820.11
Scas_718.6747379810.13
Scas_718.36d33050800.14
Kwal_27.1182419952780.16
YDL020C (RPN4)53175800.18
CAGL0L00583g38839800.18
KLLA0D11902g289136790.19
Scas_627.6120758800.19
Scas_660.1236764790.22
Sklu_2244.3271138780.25
YGL254W (FZF1)29954770.35
Scas_604.458544770.40
KLLA0B00286g469121770.42
YDR463W (STP1)51988760.50
AFR301C1655132770.53
CAGL0E04312g68872760.53
Scas_641.2453264760.62
Sklu_2289.129150750.63
YHL027W (RIM101)62545760.64
Kwal_56.22497280140740.73
KLLA0A10373g20655730.80
Scas_713.1146574740.82
AFR190C43260740.84
CAGL0K01727g49972741.0
YHR006W (STP2)54164741.1
ADL042W28187731.1
YPR022C113351741.1
CAGL0H07557g47652731.2
Sklu_2436.951775731.2
Kwal_26.930030468721.3
CAGL0K02343g116289731.5
CAGL0I02816g29124711.7
ADL040W33050711.7
Kwal_55.2063441957712.0
KLLA0F13442g58750712.2
KLLA0F10109g62364712.3
Scas_591.868062712.4
Kwal_33.1422755157702.7
AFR461C54464693.5
Scas_712.232752683.7
Kwal_47.1833753680684.6
CAGL0G05423g57855684.8
Sklu_2359.572268685.4
Kwal_27.1016728554675.8
Scas_683.3047860676.1
YLR375W34347667.8
KLLA0C04103g56457659.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER169W
         (782 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsiv...  1529   0.0  
Kwal_56.23453                                                         710   0.0  
Scas_681.19                                                           708   0.0  
AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W (...   696   0.0  
CAGL0L11880g 1272624..1275566 some similarities with sp|P39956 S...   533   e-176
KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces...   522   e-174
Scas_76.1                                                             269   8e-85
YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive...   282   2e-82
KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces c...   125   3e-29
Sklu_2303.6 YJR119C, Contig c2303 8969-11356                          120   7e-28
CAGL0H00528g 52511..54733 similar to sp|P47156 Saccharomyces cer...   118   4e-27
ABR167C [760] [Homologous to ScYJR119C - SH] (714425..716755) [2...   116   1e-26
Kwal_55.21855                                                         114   1e-26
YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protei...   112   3e-25
Scas_691.27                                                           101   5e-22
CAGL0G08107g 768772..770649 weakly similar to tr|Q03833 Saccharo...    80   4e-15
Scas_709.32                                                            70   6e-12
AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH] complement(...    69   9e-12
CAGL0E04884g complement(469295..473764) weakly similar to sp|P07...    67   3e-11
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    66   8e-11
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    65   1e-10
Scas_649.28                                                            65   1e-10
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    64   3e-10
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...    59   3e-10
Scas_721.92                                                            64   4e-10
Scas_602.9                                                             64   4e-10
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            62   8e-10
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...    60   9e-10
CAGL0L06072g complement(679924..680826) some similarities with s...    60   1e-09
Kwal_47.17241                                                          61   1e-09
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement        58   1e-09
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    61   2e-09
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    60   5e-09
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    59   6e-09
KLLA0F18524g complement(1701498..1702571) some similarities with...    59   7e-09
Kwal_27.10925                                                          58   8e-09
Kwal_26.8351                                                           59   8e-09
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...    59   9e-09
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    59   1e-08
Kwal_56.24206                                                          59   1e-08
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       58   2e-08
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    58   2e-08
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    58   2e-08
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    57   2e-08
Scas_703.23                                                            57   4e-08
Scas_718.44                                                            55   4e-08
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    57   5e-08
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    57   6e-08
Scas_569.2                                                             55   8e-08
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    56   9e-08
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    55   1e-07
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    56   1e-07
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    56   1e-07
Kwal_27.11460                                                          55   1e-07
Kwal_47.16621                                                          56   1e-07
CAGL0F05995g complement(598819..600612) some similarities with s...    55   1e-07
Scas_717.17                                                            55   2e-07
Sklu_2443.22 , Contig c2443 45390-46027                                53   2e-07
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...    53   2e-07
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    55   2e-07
Scas_707.31                                                            54   2e-07
AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..19...    55   2e-07
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    55   3e-07
YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protei...    52   3e-07
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    54   5e-07
Kwal_14.2278                                                           53   5e-07
CAGL0K04631g complement(440721..443762) some similarities with s...    54   6e-07
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    53   7e-07
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    53   7e-07
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    53   7e-07
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    53   7e-07
CAGL0L07480g complement(822240..823184) some similarities with s...    52   9e-07
Scas_575.3                                                             52   1e-06
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    52   1e-06
Kwal_47.17888                                                          52   1e-06
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    52   1e-06
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    52   2e-06
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    51   2e-06
Scas_712.42*                                                           50   3e-06
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    51   4e-06
Scas_697.35                                                            51   4e-06
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    50   7e-06
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    49   8e-06
Scas_683.25                                                            50   8e-06
Kwal_47.19045                                                          48   9e-06
CAGL0M01870g complement(219813..220760) some similarities with t...    49   9e-06
KLLA0B00605g complement(46736..47455) some similarities with sp|...    47   2e-05
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    48   2e-05
Scas_378.1                                                             46   2e-05
AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W ...    47   3e-05
Scas_693.31                                                            48   3e-05
YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in...    48   3e-05
Scas_719.68                                                            47   5e-05
Kwal_26.8021                                                           47   6e-05
YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-fing...    45   7e-05
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    47   7e-05
Scas_687.33                                                            45   9e-05
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    45   1e-04
Scas_636.14d                                                           45   1e-04
Scas_568.5                                                             44   1e-04
KLLA0B03454g complement(314015..315433) some similarities with s...    45   2e-04
Scas_627.17d                                                           44   3e-04
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    45   3e-04
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    44   3e-04
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    44   3e-04
KLLA0F11682g complement(1068992..1070116) some similarities with...    44   4e-04
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    44   4e-04
Scas_720.39                                                            44   4e-04
Kwal_56.23925                                                          44   4e-04
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    43   5e-04
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    44   6e-04
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    44   7e-04
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    43   7e-04
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    43   7e-04
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    43   7e-04
Scas_717.60d                                                           41   7e-04
Scas_720.33                                                            43   8e-04
KLLA0C16203g complement(1414169..1418533) weakly similar to sp|Q...    44   8e-04
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    43   0.001
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    43   0.001
KLLA0A04609g complement(411494..412765) some similarities with s...    42   0.001
CAGL0E06116g complement(604708..606549) some similarities with t...    42   0.002
KLLA0E18645g complement(1648263..1649558) some similarities with...    41   0.003
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    40   0.003
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    42   0.003
Kwal_23.5400                                                           41   0.003
KLLA0C16005g 1397274..1398269 some similarities with sgd|S000615...    40   0.003
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    41   0.004
CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041 S...    39   0.005
Scas_711.56                                                            40   0.005
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    40   0.006
Sklu_1527.1 YPL038W, Contig c1527 389-1006                             39   0.006
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            40   0.008
AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -...    40   0.008
CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12...    38   0.010
Kwal_14.2206                                                           39   0.012
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    39   0.012
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    39   0.014
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    39   0.016
Sklu_2398.2 , Contig c2398 2210-3076 reverse complement                38   0.017
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    39   0.017
Kwal_14.2543                                                           39   0.020
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    39   0.020
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    39   0.024
Scas_695.2                                                             38   0.027
Scas_721.56                                                            37   0.030
KLLA0F20636g complement(1914452..1915309) some similarities with...    37   0.032
Kwal_27.10467                                                          37   0.035
Kwal_47.16577                                                          38   0.041
Scas_631.7                                                             37   0.051
CAGL0I02838g complement(248704..250671) similar to sp|P41696 Sac...    37   0.057
CAGL0E03762g complement(351003..352757) weakly similar to sp|P33...    37   0.071
KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyce...    36   0.097
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            36   0.11 
Scas_718.67                                                            36   0.13 
Scas_718.36d                                                           35   0.14 
Kwal_27.11824                                                          35   0.16 
YDL020C (RPN4) [840] chr4 complement(415110..416705) Subunit of ...    35   0.18 
CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces cer...    35   0.18 
KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041 S...    35   0.19 
Scas_627.6                                                             35   0.19 
Scas_660.12                                                            35   0.22 
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                35   0.25 
YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor i...    34   0.35 
Scas_604.4                                                             34   0.40 
KLLA0B00286g complement(15257..16666) gi|1709726|sp|P52289|PPA5_...    34   0.42 
YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription fact...    34   0.50 
AFR301C [3493] [Homologous to ScYIL159W (BNR1) - SH] (981215..98...    34   0.53 
CAGL0E04312g 412563..414629 some similarities with sp|Q00947 Sac...    34   0.53 
Scas_641.24                                                            34   0.62 
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          33   0.63 
YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor...    34   0.64 
Kwal_56.22497                                                          33   0.73 
KLLA0A10373g complement(907244..907864) some similarities with c...    33   0.80 
Scas_713.11                                                            33   0.82 
AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH] (783110.....    33   0.84 
CAGL0K01727g complement(152569..154068) similar to sp|Q03465 Sac...    33   1.0  
YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor...    33   1.1  
ADL042W [1699] [Homologous to ScYPR015C - SH] complement(615818....    33   1.1  
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    33   1.1  
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    33   1.2  
Sklu_2436.9 YDR463W, Contig c2436 18516-20069                          33   1.2  
Kwal_26.9300                                                           32   1.3  
CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces c...    33   1.5  
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    32   1.7  
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    32   1.7  
Kwal_55.20634                                                          32   2.0  
KLLA0F13442g complement(1244416..1246179) similar to sp|P39081 S...    32   2.2  
KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00...    32   2.3  
Scas_591.8                                                             32   2.4  
Kwal_33.14227                                                          32   2.7  
AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH] (1269565..1...    31   3.5  
Scas_712.2                                                             31   3.7  
Kwal_47.18337                                                          31   4.6  
CAGL0G05423g complement(511175..512911) similar to sp|P09932 Sac...    31   4.8  
Sklu_2359.5 YPR022C, Contig c2359 10655-12818                          31   5.4  
Kwal_27.10167                                                          30   5.8  
Scas_683.30                                                            30   6.1  
YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with str...    30   7.8  
KLLA0C04103g complement(372753..374447) weakly similar to sp|Q03...    30   9.9  

>YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsive
           repressor of PHR1, contains two C2H2-type zinc finger
           domains [2391 bp, 796 aa]
          Length = 796

 Score = 1529 bits (3959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 741/782 (94%), Positives = 741/782 (94%)

Query: 1   MTKLIAPSEIVGGVPVFKPTYEQFEDFYAYCKAINKYGMKSGVVKVIPPKEWKDKLDLPY 60
           MTKLIAPSEIVGGVPVFKPTYEQFEDFYAYCKAINKYGMKSGVVKVIPPKEWKDKLDLPY
Sbjct: 1   MTKLIAPSEIVGGVPVFKPTYEQFEDFYAYCKAINKYGMKSGVVKVIPPKEWKDKLDLPY 60

Query: 61  SAETLQKIKIKSPIQQHISGNKGLFMVQNVEKNKTYNIIQWKDLSKDYVPPEDPKARRNS 120
           SAETLQKIKIKSPIQQHISGNKGLFMVQNVEKNKTYNIIQWKDLSKDYVPPEDPKARRNS
Sbjct: 61  SAETLQKIKIKSPIQQHISGNKGLFMVQNVEKNKTYNIIQWKDLSKDYVPPEDPKARRNS 120

Query: 121 RKGSVSKSTKLKLKNFESSFNIDDFEQFRTEYTIDLSDFQNTERLKFLEEYYWKTLNFTT 180
           RKGSVSKSTKLKLKNFESSFNIDDFEQFRTEYTIDLSDFQNTERLKFLEEYYWKTLNFTT
Sbjct: 121 RKGSVSKSTKLKLKNFESSFNIDDFEQFRTEYTIDLSDFQNTERLKFLEEYYWKTLNFTT 180

Query: 181 PMYGADTPGSIFPEGLNVWNVAKLPNILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQD 240
           PMYGADTPGSIFPEGLNVWNVAKLPNILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQD
Sbjct: 181 PMYGADTPGSIFPEGLNVWNVAKLPNILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQD 240

Query: 241 LYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLASPKLLQEN 300
           LYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLASPKLLQEN
Sbjct: 241 LYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLASPKLLQEN 300

Query: 301 GIRCNEIVHHEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKAGKCHCISDSV 360
           GIRCNEIVHHEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKAGKCHCISDSV
Sbjct: 301 GIRCNEIVHHEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKAGKCHCISDSV 360

Query: 361 EIDVKKLAKSWRDNNKESKGTPPLNQLPNPAMPLLHRPTLKEMESSSLRSTSPDVGHXXX 420
           EIDVKKLAKSWRDNNKESKGTPPLNQLPNPAMPLLHRPTLKEMESSSLRSTSPDVGH   
Sbjct: 361 EIDVKKLAKSWRDNNKESKGTPPLNQLPNPAMPLLHRPTLKEMESSSLRSTSPDVGHFSN 420

Query: 421 XXXXXXXXXXXXXXRMKDYSNIVEPTLEDPTLKLKRISSFQEQPLNKLLKRETSQTAMLT 480
                         RMKDYSNIVEPTLEDPTLKLKRISSFQEQPLNKLLKRETSQTAMLT
Sbjct: 421 FKSKSSGVSSPLLSRMKDYSNIVEPTLEDPTLKLKRISSFQEQPLNKLLKRETSQTAMLT 480

Query: 481 DHEDNIVAMSLTSMXXXXXXXXXXXXXXXXXXXXXXXXQPLLDMTNNTLAFPRPNGPSGL 540
           DHEDNIVAMSLTSM                        QPLLDMTNNTLAFPRPNGPSGL
Sbjct: 481 DHEDNIVAMSLTSMANSAASSPRLPLSRLNSSNELSNAQPLLDMTNNTLAFPRPNGPSGL 540

Query: 541 NPLLYISNKNISGISHSAPHSPVNPNISLIKRVKSPNIVTLNISRESSRSPIALNYEARQ 600
           NPLLYISNKNISGISHSAPHSPVNPNISLIKRVKSPNIVTLNISRESSRSPIALNYEARQ
Sbjct: 541 NPLLYISNKNISGISHSAPHSPVNPNISLIKRVKSPNIVTLNISRESSRSPIALNYEARQ 600

Query: 601 QHSQQHSFSTPSTVSNLSTSVLGPLSDTNDIKTPHPERPNHKTANRILKKESPVETSKSN 660
           QHSQQHSFSTPSTVSNLSTSVLGPLSDTNDIKTPHPERPNHKTANRILKKESPVETSKSN
Sbjct: 601 QHSQQHSFSTPSTVSNLSTSVLGPLSDTNDIKTPHPERPNHKTANRILKKESPVETSKSN 660

Query: 661 LILSKVASTRQEDSFTSRNDDLDKEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSS 720
           LILSKVASTRQEDSFTSRNDDLDKEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSS
Sbjct: 661 LILSKVASTRQEDSFTSRNDDLDKEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSS 720

Query: 721 GHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCISNETTVDAPIMNPTVQ 780
           GHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCISNETTVDAPIMNPTVQ
Sbjct: 721 GHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCISNETTVDAPIMNPTVQ 780

Query: 781 PQ 782
           PQ
Sbjct: 781 PQ 782

>Kwal_56.23453
          Length = 828

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/863 (48%), Positives = 510/863 (59%), Gaps = 177/863 (20%)

Query: 5   IAPSEIVGGVPVFKPTYEQFEDFYAYCKAINKYGMKSGVVKVIPPKEWKDKLDLPYSAET 64
           +APS   GGVPVF+P YE+F+DFY Y +A++KYG KSG+VKVIPP+EW D+L++P   ET
Sbjct: 4   VAPSSWEGGVPVFRPNYERFKDFYEYMRAVDKYGKKSGIVKVIPPQEWLDQLEMPPGVET 63

Query: 65  LQKIKIKSPIQQHISGNKGLFMVQNVEKNKTYNIIQWKDLSKDYVPPE-----------D 113
           LQKI+I++PIQQH +G+KG+F+VQNVEK+K+YNIIQWKD+S DY  P+           D
Sbjct: 64  LQKIRIRTPIQQHFNGSKGVFVVQNVEKSKSYNIIQWKDISYDYRLPDGGGEASGSSEAD 123

Query: 114 PKARRNSRKG-SVSKSTKLKLKNFESSFNIDDFEQFRTEYTID-LSDFQNTERLKFLEEY 171
                 +RK  S  KS+K+KL++ ES F+  +FE+F   Y  D L DF++  R +FLE Y
Sbjct: 124 AGDTLGARKSPSPLKSSKIKLRSPES-FSDAEFEKFSAHYNHDNLGDFRDPSRREFLESY 182

Query: 172 YWKTLNFTTPMYGADTPGSIFPEGLNVWNVAKLPNILDHMETKVPGVNDSYLYAGLWKAS 231
           +WKTL FT PMYGAD+ GS+F + L+VWNV+KLPNILDHM TKVPGVN SYLYAGLWKAS
Sbjct: 183 FWKTLAFTPPMYGADSLGSLFQDKLDVWNVSKLPNILDHMNTKVPGVNGSYLYAGLWKAS 242

Query: 232 FSWHLEDQDLYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFL 291
           FSWHLEDQDLYSINYIHFGAPKQWYSIPQED  KFYKFMQEQFPE A  C EFLRHK FL
Sbjct: 243 FSWHLEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHKTFL 302

Query: 292 ASPKLLQENGIRCNEIVHHEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKAG 351
            SPK+L++NGIRCN+IVH++ EF+ITYPYGYHAGFNYGYNLAESVNFALE WL IG KA 
Sbjct: 303 VSPKILEKNGIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLAESVNFALENWLDIGIKAK 362

Query: 352 KCHCISDSVEID---------------------------------VKKLAKSWRD----- 373
           +C CI D+V ID                                 V K AK  +D     
Sbjct: 363 RCLCIDDAVGIDVEKLRDDWLSSKQKAEKPKVKHEIQESQRGSNGVSKKAKFEKDSASTK 422

Query: 374 ------------NNKESKG-------TP----PLNQLPNPAMP-------LLHRPT--LK 401
                       N+K  K        TP    P N+L N   P       LLH  +  L+
Sbjct: 423 QPSEGSKNADVKNDKSDKSNIEVVCPTPGRSLPFNRLTNKENPRMKGFNELLHHSSYELQ 482

Query: 402 EMES----SSLRSTSPDVG-HXXXXXXXXXXXXXXXXXRMKDYSNIVEPTLEDPTLKLKR 456
            ME     S++RST+P+ G +                 RM D SNIVEPTLEDPTLK K+
Sbjct: 483 AMEDNPQQSAIRSTTPNPGQYYSGLSQSISRISSPLLSRMMDLSNIVEPTLEDPTLKFKK 542

Query: 457 ISSFQEQPLNKLLKRETSQT-AMLTDHEDNIVAMSLTSMXXXXXXXXXXXXXXXXXXXXX 515
            S+  +Q          SQT  +L D++DN++A+SL SM                     
Sbjct: 543 SSNLSQQ---------NSQTPQVLEDNDDNMLALSLASMASGASSPRY------------ 581

Query: 516 XXXQPLLDMTNNTLAFPRPNGPSGL-------------NPLLYISNKNISGISHSAPHSP 562
               PL  +       PRP  P+               NP  Y S    S +    P SP
Sbjct: 582 ----PLPPIQ------PRPYSPAVAGDSMLASGPLYEQNPFSYYSTNFKSTMGSPQPSSP 631

Query: 563 VNPNISLIKRVKSPNIVTLNISRESSRSPIALNYEARQQHSQQHSFSTPSTVSNLSTSVL 622
              N+  IKR+KSPN VTLNISRESSRSPI LN E +   S        +  +N +T+V 
Sbjct: 632 ALSNLPFIKRLKSPNRVTLNISRESSRSPILLNSEFKSPLSN-------NIAANGNTAVN 684

Query: 623 GPLSDTNDIKTPHPERPNHKTANRILKKESPVETSKSNLILSKVASTRQEDSFTSRNDDL 682
             LS    ++   P  P        +   S  + SK  +  SK+ S              
Sbjct: 685 SNLSQATTVEHSPPVSPP-------IPNNSIADFSKRPIAPSKINS-------------- 723

Query: 683 DKEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPK 742
                          EEI++S K K+Y+C+EC+R+FSSGHHLTRHKKSVHSGEKPHSCPK
Sbjct: 724 ---------------EEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPK 768

Query: 743 CGKRFKRRDHVLQHLNKKIPCIS 765
           CGK+FKRRDHVLQHLNKKIPC +
Sbjct: 769 CGKKFKRRDHVLQHLNKKIPCTA 791

>Scas_681.19
          Length = 864

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/848 (47%), Positives = 518/848 (61%), Gaps = 106/848 (12%)

Query: 5   IAPSEIVGGVPVFKPTYEQFEDFYAYCKAINKYGMKSGVVKVIPPKEWKDKLDLPYSAET 64
           I P+ I  G+P+FKPT+++F+DFY + +AINK+GM+SG+VKVIPP EW   LD P S E 
Sbjct: 7   IKPALIEDGIPIFKPTFQEFKDFYKFMEAINKFGMQSGIVKVIPPTEWLKLLDNPPSVEA 66

Query: 65  LQKIKIKSPIQQHISGNKGLFMVQNVEKNKTYNIIQWKDLSKDYVPPEDPKARRNSRKGS 124
           LQ IKIK+PI+Q ISG  GLFM  N+E++KTY+IIQWK+LSKDY  P+DP +R  ++   
Sbjct: 67  LQGIKIKNPIEQEISGTHGLFMSNNIERSKTYHIIQWKELSKDYTLPQDPHSRDKNKDPD 126

Query: 125 VSKSTKLKL---------KNFESSFNIDDFEQFRTEYTID---LSDFQNTERLKFLEEYY 172
            +    +++         +  + SF+ +DF+ F+  +      L  F + ERL FLE YY
Sbjct: 127 TNNGKTIEMPSSTSSATHRKRQHSFSKEDFKNFQKNFNESDEILKQFNDKERLNFLENYY 186

Query: 173 WKTLNFTTPMYGADTPGSIFPEGLNVWNVAKLPNILDHMETKVPGVNDSYLYAGLWKASF 232
           WKTLNFT PMYGADT GSIF E LNVWNV+KLPN+LD+++ ++PGVNDS+LYAGLWKASF
Sbjct: 187 WKTLNFTMPMYGADTSGSIFNENLNVWNVSKLPNLLDYLDKEIPGVNDSFLYAGLWKASF 246

Query: 233 SWHLEDQDLYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLA 292
            WHLEDQDLYSIN+IHFGAPKQWYSIPQED   FY FM+EQFPEEAK CPEFLRHK F+A
Sbjct: 247 PWHLEDQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFLRHKTFMA 306

Query: 293 SPKLLQENGIRCNEIVHHEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKAGK 352
           SPKLL ENGIRCN+IVH++ EFMIT+PYGYHAGFNYGYNLAESVNFALEEWL IG++A K
Sbjct: 307 SPKLLSENGIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLEIGERANK 366

Query: 353 CHCISDSVEIDVKKLAKSW-----RDNNKESKG------TPPLN----QLPNPAMPLLHR 397
           C C++DSVEIDV+KLA +W     + N K          T  LN    +L N       +
Sbjct: 367 CLCVNDSVEIDVRKLASNWYIFKNKPNLKNETDLRVRSFTELLNHSSQELQNIQKKQQVQ 426

Query: 398 PTLKEMESS---SLRSTSPDVGHXXXXXXXXXXXXXXXX----XRMKDYSNIVEPTLEDP 450
           P     ES+   SLRSTSP                         RM D SNIVEPTLEDP
Sbjct: 427 PIRTFTESNKDVSLRSTSPTPSQFFTTNETNKPVISRVSSPFLSRMMDLSNIVEPTLEDP 486

Query: 451 TLKLKRI----SSFQEQPLNKLLKRETSQTAMLTDHEDNIVAMSLTSMXXXXXXXXXXXX 506
           TLK KR     S  Q   L  +      Q+ +L D+EDN++A+SL +M            
Sbjct: 487 TLKFKRKLNAPSVSQNNTLPPISMPPLFQSPLLEDNEDNMIALSLANM-----ANSGTSS 541

Query: 507 XXXXXXXXXXXXQPLLDMTNN------TLAFPRPNGPSG-------LNPLLYISNKNISG 553
                        P+   ++N      ++  P+P+  S         NP+ Y S  +   
Sbjct: 542 PRLIIPALNSSIDPINSSSSNGNDRISSILAPKPSLSSSPYVTSNNNNPMTYNSTFSNHN 601

Query: 554 ISHSAPHSPVNP----NISLIKRVKSPNIVTLNISRESSRSPI---------------AL 594
            +      P++P    N+S IKR+KSPNIVTLNISRE+SRSPI                L
Sbjct: 602 NNIQNNVVPLSPGGRSNLSFIKRIKSPNIVTLNISRETSRSPILTSVPDFRSNNNNTGTL 661

Query: 595 NYEARQQHS-QQHSFSTP--------STVSNLSTSVLGPLSDTNDIKTPH-PERPNHKTA 644
            Y A  Q S  Q   + P        +TV+N   S+L         + P   +R  + T 
Sbjct: 662 PYSAIPQSSLNQMELNNPLGNDDTNNNTVTNSELSILN--------QPPQKKQRLTNGTR 713

Query: 645 NRILKKESPVETSKSNLILSKVASTRQEDSFTSRNDDLDKEQGSSPLNSKFAPEEIVLSG 704
           +   K E  VE    + +L   +S+   ++  ++          +P   KF  +EI++S 
Sbjct: 714 SNQRKMELGVEQPSGDGVLIGNSSSNNNNNTNAQ----------AP---KFTSDEIIMSE 760

Query: 705 KNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCI 764
             K+Y+C EC+R+F+SGHHLTRHKKSVHSGEKPHSCPKCGK+FKRRDHVLQHLNKKIPC+
Sbjct: 761 TGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCV 820

Query: 765 SNETTVDA 772
             E + +A
Sbjct: 821 PEEGSSNA 828

>AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W
           (GIS1) - SH] (964417..966816) [2400 bp, 799 aa]
          Length = 799

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/821 (47%), Positives = 504/821 (61%), Gaps = 99/821 (12%)

Query: 7   PSEIVGGVPVFKPTYEQFEDFYAYCKAINKYGMKSGVVKVIPPKEWKDKLDLPYSAETLQ 66
           P    GGVPVF+P++E+F+DFY Y   I++YGMKSGVVK+IPP+EW ++L      E L+
Sbjct: 5   PDHFEGGVPVFRPSWEEFQDFYKYMFLIDEYGMKSGVVKIIPPREWVERLGERPGVEQLR 64

Query: 67  KIKIKSPIQQHISGNKGLFMVQNVEKNKTYNIIQWKDLSKDYVPPE-----DPKARRNSR 121
           +I I+SPIQQH+SG+KG+F+VQNVE+ K+YNIIQWKDL++DY  P+        +R  + 
Sbjct: 65  RIHIRSPIQQHVSGSKGVFVVQNVERQKSYNIIQWKDLAQDYQLPDMRGYGGSLSRSAAA 124

Query: 122 KGSVSKSTKLKLKNFESSFNIDDFEQFRTEYTID-LSDFQNTERLKFLEEYYWKTLNFTT 180
            G+  + + ++ +  + SF+ +DF +F+  Y ++ L+ + +   L+ LE YYWKTLNFT 
Sbjct: 125 GGARPRPSNIRTRT-QDSFSDEDFREFQEHYNVEGLAQYDDESFLRGLENYYWKTLNFTE 183

Query: 181 PMYGADTPGSIFPEGLNVWNVAKLPNILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQD 240
           PMYGADT G++FP+ L+ WNV++LPN+LDH+E KVPGVN SYLYAGLWKASF+WHLEDQD
Sbjct: 184 PMYGADTLGTLFPDSLHQWNVSRLPNLLDHLEEKVPGVNQSYLYAGLWKASFAWHLEDQD 243

Query: 241 LYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLASPKLLQEN 300
           LYSINY+HFGAPKQWYSIPQED  KF+KFMQEQFPEE+  C EFLRHKMF+ SPK+L+ N
Sbjct: 244 LYSINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVSPKVLERN 303

Query: 301 GIRCNEIVHHEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKAGKCHCISDSV 360
           GIRCN IVH + EFM+TYPYGYH+GFNYGYNLAESVNFALE WLPIG+KA KC C+ DSV
Sbjct: 304 GIRCNSIVHRQHEFMVTYPYGYHSGFNYGYNLAESVNFALESWLPIGEKAKKCMCVDDSV 363

Query: 361 EIDVKKLAKSWRDNNKESKGT-----PP---LNQLPNPA----MPLLHRPT--------- 399
            ID++KL  ++  + +E +       PP   L Q PN +     P+L             
Sbjct: 364 GIDIQKLKSAYFRSLQEDRAGSADPEPPRKRLKQEPNTSSFVQAPILDTGDSLKSFNELI 423

Query: 400 ------LKEMESS----SLRSTSPDVGHXXXXXXXXXXXXXXXXXRMKDYSNIVEPTLED 449
                 L+ ME +    S+RST+P+                    RM D SNIVEPTLED
Sbjct: 424 NHSAYELQAMEDNPNQRSIRSTTPN---QYFSNPSISRMSSPLLSRMMDLSNIVEPTLED 480

Query: 450 PTLKLKRISSFQE-------QPLNKLLKRETSQT----AMLTDHEDNIVAMSLTSMXXXX 498
           PTLK KR    Q+        P++ +    TS      A+   HE++++A+SL SM    
Sbjct: 481 PTLKFKRKVVAQDTSNAMAPNPVSGVGAPVTSVCVGPPALNNLHEESVLALSLASMANSG 540

Query: 499 XXXXXXXXXXXXXXXXXXXXQPLLDMTNNTLAFPRPNGPSG---LNPLLYISNKNISGIS 555
                                  L   N+ +   RP  P+G   L P        +S  S
Sbjct: 541 NSSPRNA----------------LPPLNSAVGNSRPYTPTGDAILAPRPSYDQNPLSYYS 584

Query: 556 HSAPHSPVNPNISLIKRVKSPNIVTLNISRESSRSPIALNYE-ARQQHSQQHSFSTPSTV 614
                SP    + L KR+ SPN VTLNISRESSRSPI+   E  +   S+ H  +  +  
Sbjct: 585 TQTTKSP----MPLFKRINSPNRVTLNISRESSRSPISFGSEYGKPPLSKPHPLNAGAVN 640

Query: 615 SNLSTSVLGPLSDTNDIKTPHPERPNHKTANRILKKESPVETSKSNLILSKVASTRQEDS 674
                     L+  N + T     P+H+  +R  K     + +   +   K    +  DS
Sbjct: 641 ----------LTSLNQVSTIERNIPSHR--DRSAKAYHGDKVNIHGVSSGKFVGHQINDS 688

Query: 675 FTSRNDDL----------DKEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHL 724
               NDD             E+ +SP  SK + EEI++S K K Y+C+ECQR+FSSGHHL
Sbjct: 689 LALLNDDALTNSVLPGAGRPERATSP-TSKISAEEIIISDKGKAYVCQECQRQFSSGHHL 747

Query: 725 TRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCIS 765
           TRHKKSVHSGEKPHSCPKCGK+FKRRDHVLQHLNKKIPC++
Sbjct: 748 TRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCVT 788

>CAGL0L11880g 1272624..1275566 some similarities with sp|P39956
           Saccharomyces cerevisiae YER169w, hypothetical start
          Length = 980

 Score =  533 bits (1373), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 238/374 (63%), Positives = 299/374 (79%), Gaps = 12/374 (3%)

Query: 9   EIVGGVPVFKPTYEQFEDFYAYCKAINKYGMKSGVVKVIPPKEWKDKLDLPYSAETLQKI 68
           E+V GVPVF+P +E+F+DF  Y + I  +GM SG+VKVIPP+EW D+       + L+++
Sbjct: 2   EVVDGVPVFRPAWEEFKDFMGYMEKIRPHGMASGIVKVIPPREWLDRAGREPREDLLREV 61

Query: 69  KIKSPIQQHISGNKGLFMVQNVEKNKTYNIIQWKDLSKDYVPPEDPKARRNSRKGSVSKS 128
           +I++PIQQH+SG+KG++M+ NVEKNKTYN+IQWKDLS D+  P+DP + +N  + S+  +
Sbjct: 62  RIRNPIQQHVSGSKGVYMISNVEKNKTYNMIQWKDLSYDFRVPDDPSSLKNKSEESIQDN 121

Query: 129 ----------TKLKLKNFESSFNIDDFEQFRTEYTID-LSDFQNTERLKFLEEYYWKTLN 177
                     + +KLKN +S+   +DF+ F  EY  + + DF + ERLKFLE YYWKTLN
Sbjct: 122 ERSQQRRRSSSGIKLKNCDSATE-EDFQNFMKEYNAENIRDFDDEERLKFLESYYWKTLN 180

Query: 178 FTTPMYGADTPGSIFPEGLNVWNVAKLPNILDHMETKVPGVNDSYLYAGLWKASFSWHLE 237
           FTTP+YGAD+ GSIFP  L  WNVAKLPN+L H++  +PGVN +YLYAGLWKASF+WHLE
Sbjct: 181 FTTPLYGADSSGSIFPSDLEEWNVAKLPNVLSHIDQDIPGVNQAYLYAGLWKASFTWHLE 240

Query: 238 DQDLYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLASPKLL 297
           DQDLYSINYIHFGAPKQWYSIPQED  KFY+FM+E+FPEEA  C EFLRHKMFL SPK+L
Sbjct: 241 DQDLYSINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFLVSPKVL 300

Query: 298 QENGIRCNEIVHHEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKAGKCHCIS 357
           +EN I+CN++ H+E EF+ITYPYGYHAGFNYGYNLAESVNFALE+WL IGKKAGKC CIS
Sbjct: 301 KENNIKCNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALEDWLEIGKKAGKCRCIS 360

Query: 358 DSVEIDVKKLAKSW 371
           DSVE+DV KLA++W
Sbjct: 361 DSVEVDVDKLAENW 374

 Score =  185 bits (470), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 145/412 (35%), Positives = 193/412 (46%), Gaps = 85/412 (20%)

Query: 435 RMKDYSNIVEPTLEDPTLKLKRISSFQEQ------------------------------- 463
           +M D SNIVEPTL+DPTLK KR ++   Q                               
Sbjct: 549 KMIDLSNIVEPTLDDPTLKFKRKTNLPSQLIGNSNISSPLLQNIQDQQNQQQQQQRSQNG 608

Query: 464 -PLNKL-----LKRETSQTAMLTDHEDNIVAMSLTSMXXXXXXXXXXXXXXXXXXXXXXX 517
            PL+ L          S   +L +++DN++A+SLTSM                       
Sbjct: 609 TPLSNLSFGPMRSGLGSNPVLLDNNDDNMLALSLTSMANSRPSSPRLHHINIPNEANSKM 668

Query: 518 XQPLLDMTNNTLAF--PRPNGPSGLN-----PLLYISN---KNISGISHSAPHSPVNPNI 567
                D  N    F     N   G++     P+ Y  N   +  + +    P SP   N+
Sbjct: 669 KSGSNDTVNAASNFVTSGSNVQQGMSVVSPKPVPYYGNQFERTFNSMPSPIPMSPGGSNM 728

Query: 568 SLIKRVKSPNIVTLNISRESSRSPIALNYEARQQHSQQHSFSTP-STVSNLSTSVLGPLS 626
             IKR+KSPNIVTLNISRE S+SP++L  E R       + S P  T   LS   L P++
Sbjct: 729 PFIKRLKSPNIVTLNISREGSKSPVSLQNEVRSPLGLNTTLSYPIPTEKQLSN--LNPVN 786

Query: 627 DTNDIKTPHPERPNHKTANRILK---------------------KESPVETSKSNLILSK 665
           ++N  +   P   + K      +                     ++   ET +S+ ++S 
Sbjct: 787 NSN-YQAASPALMDDKNNINPNQNMNSLLDMGLSAFQNSPSNGLRQISSETYESSPLMSL 845

Query: 666 VASTRQEDSFT------SRNDD---LDKEQGSS----PLNSKFAPEEIVLSGKNKIYICK 712
            A+  ++   T      SR+      DK +  S        KF   E++LS   KIY+C+
Sbjct: 846 AAAANKDIELTNSMMRPSRSKTKLPTDKARSKSKSVEAQGPKFEKGEVILSDSGKIYVCQ 905

Query: 713 ECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCI 764
           EC+R+FSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCI
Sbjct: 906 ECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCI 957

>KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces
           cerevisiae YER169w RPH1, start by similarity
          Length = 821

 Score =  522 bits (1344), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 239/369 (64%), Positives = 292/369 (79%), Gaps = 5/369 (1%)

Query: 7   PSEIVGGVPVFKPTYEQFEDFYAYCKAINKYGMKSGVVKVIPPKEWKDKLDLPYSAETLQ 66
           P    G VPVFKP YE F DFY +   +NKYGMKSG++K++PP++W DK+  P SAETLQ
Sbjct: 5   PDHYEGSVPVFKPDYETFRDFYKFMCEVNKYGMKSGIIKIVPPEQWVDKVAFPPSAETLQ 64

Query: 67  KIKIKSPIQQHISGNKGLFMVQNVEKNKTYNIIQWKDLSKDYVPPEDPKARRNSRKGSV- 125
           KIKIK+PIQQHISG+KG+F+VQNVEK K+YN+IQWK LS DY  PE   + +N     + 
Sbjct: 65  KIKIKTPIQQHISGSKGVFVVQNVEKPKSYNVIQWKHLSHDYKLPEGRHSAKNEDSSGIE 124

Query: 126 --SKSTKLKLKNFESSFNIDDFEQFRTEYTID-LSDFQNTERLKFLEEYYWKTLNFTTPM 182
              +S K++ K  +S F +DDFE+FR  +  D L  F + +R++FLE YYWKTLNFT PM
Sbjct: 125 PHQQSNKVRSKCLDS-FTLDDFEKFRENFNCDHLEQFDDEQRVEFLESYYWKTLNFTEPM 183

Query: 183 YGADTPGSIFPEGLNVWNVAKLPNILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQDLY 242
           YGAD+ GS+F + +  WN++ LP+IL++++ KVPGVN+SYLYAGLWKASF+WHLEDQDLY
Sbjct: 184 YGADSLGSLFEDSVKEWNISSLPSILEYLDEKVPGVNESYLYAGLWKASFAWHLEDQDLY 243

Query: 243 SINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLASPKLLQENGI 302
           SINYIHFGAPKQWYSIPQED  KFY FM+EQFPEE+KNC EFLRHKMFL SPKLLQ NGI
Sbjct: 244 SINYIHFGAPKQWYSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVSPKLLQSNGI 303

Query: 303 RCNEIVHHEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKAGKCHCISDSVEI 362
           RCN IVH + EF++TYP+GYHAGFNYGYNLAESVNFAL  WL IG KA KC CI D+V I
Sbjct: 304 RCNHIVHRQQEFIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKAKKCLCIDDAVGI 363

Query: 363 DVKKLAKSW 371
           +V+KL  ++
Sbjct: 364 NVQKLRSNY 372

 Score =  184 bits (466), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 138/364 (37%), Positives = 188/364 (51%), Gaps = 71/364 (19%)

Query: 435 RMKDYSNIVEPTLEDPTLKLKR-------ISSFQEQ-------------PLNKLLKRETS 474
           RM D S+IVEPTLEDPTLK K+       +S  Q+Q             P  ++   E +
Sbjct: 496 RMMDLSHIVEPTLEDPTLKFKKKQSQFMPLSMAQQQAIFPPPAQNPLPAPSGQMSPSENA 555

Query: 475 QTAMLTDHEDNIVAMSLTSMXXXXXXXXXXXXXXXXXXXXXXXXQPLLDMTNNTLAFPRP 534
             +   DHEDN++A+SL  M                        +P   +  +++  PRP
Sbjct: 556 FFSPSHDHEDNMIALSLALMANSSPAFNQLPPLNISNP------RPYSPILQDSILSPRP 609

Query: 535 NGPSGLNPLLYISNKN----ISGISHSAPHSPVNPNISLIKRVKSPNIVTLNISRESSRS 590
           +  S  N L Y    N    + G S S         +  IKR++SPN VTLNISRESSRS
Sbjct: 610 SYNS--NVLSYGQAGNTKSPLGGFSSST-------QLPFIKRIQSPNRVTLNISRESSRS 660

Query: 591 PIALNYEARQQHSQQHSFSTPSTVSNLSTSVLGPLSDTNDIKTPHPERPNH-KTANRILK 649
           P++L                 S +     +++ P+        PHP + +   T N++  
Sbjct: 661 PVSL-----------------SGMYGNPNAMMVPI--------PHPYQSSQTSTLNQVST 695

Query: 650 KE-SPVETSKSNLILSKVASTRQEDSFTSRNDDLDKEQGSSPL-NSKFAPEEIV-LSGKN 706
            E SP  T  ++   +K A   ++ +       +D E  +S L  SK   EEI+ L   +
Sbjct: 696 AERSPAVTPPTSPSKNKPA---RKKAPKQPKAKIDPESPTSALAQSKINDEEIMFLDDGS 752

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCISN 766
           K+Y+C+EC R+FSSGHHLTRHKKSVHSGEKPHSCPKCGK+FKRRDHVLQHLNKKIPC+ +
Sbjct: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCVPD 812

Query: 767 ETTV 770
           + T 
Sbjct: 813 QDTA 816

>Scas_76.1
          Length = 228

 Score =  269 bits (687), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 160/224 (71%), Gaps = 33/224 (14%)

Query: 87  VQNVEKNKTYNIIQWKDLSKDYVPPE-----DPKAR---RNSRKGSVS------------ 126
           VQNVEKNK YNIIQWKDLS DY PPE     DP  +     SR  SV             
Sbjct: 1   VQNVEKNKIYNIIQWKDLSHDYKPPEGSSSTDPSTKGMNTRSRNASVGEEDAEHETNSEH 60

Query: 127 -----------KSTKLKLKNFESSFNIDDFEQFRTEYTID-LSDFQNTERLKFLEEYYWK 174
                      KS+K+KL+N E+ F ++DFE+F   Y  + LS      RL+FLE YYW+
Sbjct: 61  VTQKKKSQSPMKSSKIKLRNHEN-FTLEDFEEFLPSYNCENLSQLTEPSRLEFLESYYWR 119

Query: 175 TLNFTTPMYGADTPGSIFPEGLNVWNVAKLPNILDHMETKVPGVNDSYLYAGLWKASFSW 234
           TLNFTTPMYGADT GS+F + L+ WNV++LPN+LDHM+ ++PGVNDSYLYAGLWKASF+W
Sbjct: 120 TLNFTTPMYGADTLGSLFNDKLDTWNVSRLPNLLDHMDRRLPGVNDSYLYAGLWKASFAW 179

Query: 235 HLEDQDLYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEA 278
           HLEDQDLYSINY+HFGAPKQWYSIPQ+D  KFYKFMQ+QFPE+A
Sbjct: 180 HLEDQDLYSINYLHFGAPKQWYSIPQQDSHKFYKFMQDQFPEDA 223

>YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive
           repressor of PHR1, has two tandem C2H2-type zinc finger
           domains [2685 bp, 894 aa]
          Length = 894

 Score =  282 bits (721), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 166/482 (34%), Positives = 244/482 (50%), Gaps = 63/482 (13%)

Query: 5   IAPSEIVGGVPVFKPTYEQFEDFYAYCKAINKYGMKSGVVKVIPPKEWKDKLDLPYSAET 64
           I P E++ GVPVFKP+  +F +F  +   I K+G+++G+VKVIPPKEW + L+    AE+
Sbjct: 3   IKPVEVIDGVPVFKPSMMEFANFQYFIDEITKFGIENGIVKVIPPKEWLELLEGSPPAES 62

Query: 65  LQKIKIKSPIQQHISG----NKGLFMVQNVEKNKTYNIIQWKDLSKDYVPPEDPKARRNS 120
           L+ I++ SPIQQ          G+F ++N   NK+YN+ QWK+L++           R S
Sbjct: 63  LKTIQLDSPIQQQAKRWDKHENGVFSIENEYDNKSYNLTQWKNLAESL-------DSRIS 115

Query: 121 RKGSVSKSTKLKLKNFESSFNIDDFEQFRTEYTIDLSDFQNTERLKFLEEYYWKTLNFTT 180
           +     K+ K               E  R +   D  D     +L+ LE  +WKT+ F+ 
Sbjct: 116 QGDFNDKTLK---------------ENCRVDSQQDCYDL---AQLQILESDFWKTIAFSK 157

Query: 181 PMYGADTPGSIFPEGLNVWNVAKLPNILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQD 240
           P Y  D   SIFP  L +WN+  LP+ ++    +        L  G  K  F WHL++Q+
Sbjct: 158 PFYAVDENSSIFPYDLTLWNLNNLPDSINSSNRR--------LLTGQSKCIFPWHLDEQN 209

Query: 241 LYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLASPKLLQEN 300
             SINY+HFGAPKQWYSIP  +  +F K + ++     +NCP F+RH+  + SP  L++N
Sbjct: 210 KCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCPAFIRHQNIITSPDFLRKN 269

Query: 301 GIRCNEIVHHEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKAGKCHCISDSV 360
            I+ N +V  + EF+IT+PY  ++GFNYGYN  ES+ F L++   + K+  KC C +   
Sbjct: 270 NIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEFILDQQAVVRKQPLKCGCGNKKE 329

Query: 361 EIDVKKLAK-SWRDNNKESKG-----------------------TPPLNQLPNPAMPLLH 396
           E      +  S+  N  E +G                       +  L  L +   PL  
Sbjct: 330 ERKSGPFSNLSYDSNESEQRGSITDNDNDLFQKVRSFDELLNHSSQELQNLEDNKNPLFS 389

Query: 397 RPTLKEMESSSLRSTSPDVGHXXXXXXXXXXXXXXX--XXRMKDYSNIVEPTLEDPTLKL 454
              +   +SSSLRST+P+  +                   RM D SNIVEPTL+DP  K 
Sbjct: 390 NINMNRPQSSSLRSTTPNGVNQFLNMNQTTISRISSPLLSRMMDLSNIVEPTLDDPGSKF 449

Query: 455 KR 456
           KR
Sbjct: 450 KR 451

 Score =  156 bits (395), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 106/253 (41%), Positives = 139/253 (54%), Gaps = 25/253 (9%)

Query: 529 LAFPRPNGPSGLNPL-LYISNKNISGISHSAPHSPVNPNISLIKRVKSPNIVTLNISRES 587
           L+   PN     NPL LY++N      S  AP SP   NI  +KR    N+VTLNISRE+
Sbjct: 637 LSIVSPNPTYSPNPLSLYLTNSKNPLNSGLAPLSPSTSNIPFLKRN---NVVTLNISREA 693

Query: 588 SRSPIA-LNYEARQQHSQQHSFSTPSTVSNLS--TSVLGPLSDTNDIKTPHPERPNHKTA 644
           S+SPI+    + R      +     ST+++ S  T +    ++ N +       P HK  
Sbjct: 694 SKSPISSFVNDYRSPLGVSNPLMYSSTINDYSNGTGIRQNSNNINPLDAGPSFSPLHKKP 753

Query: 645 NRILKKESPVETSKSNLILSKVASTRQED--------------SFTSRNDDLDKEQGSSP 690
            +IL          +N   S   + ++ +                +S N++ +  Q  S 
Sbjct: 754 -KILNGNDNSNLDSNNFDYSFTGNKQESNPSILNNNTNNNDNYRTSSMNNNGNNYQAHS- 811

Query: 691 LNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRR 750
             SKF   E+++S   KIYIC+EC R+FSSGHHLTRHKKSVHSGEKPHSCP+CGKRFKRR
Sbjct: 812 --SKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRR 869

Query: 751 DHVLQHLNKKIPC 763
           DHVLQHLNKKIPC
Sbjct: 870 DHVLQHLNKKIPC 882

>KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces
           cerevisiae YJR119c, start by similarity
          Length = 850

 Score =  125 bits (313), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 67/178 (37%), Positives = 96/178 (53%), Gaps = 10/178 (5%)

Query: 180 TPMYGADTPGSIFPEGLNV----WNVAKLP----NILDHMETKVPGVNDSYLYAGLWKAS 231
            P +  D     F + L V    WN+  LP    ++L  +  K+ G+   ++Y G   ++
Sbjct: 427 VPPFITDKESDEFKQFLKVSSHPWNLINLPRARGSLLSIINRKISGMTIPWIYVGSTFST 486

Query: 232 FSWHLEDQDLYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFL 291
           F WHLEDQ   S NY H G+ K WYSIP+     F + M+   P+  +  P+ L   + L
Sbjct: 487 FCWHLEDQYTLSANYQHIGSQKIWYSIPERSTSAFDEMMKNISPDLFERQPDLLHQLITL 546

Query: 292 ASP--KLLQENGIRCNEIVHHEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWLPIG 347
            SP  K   E GI C + + + GE+++TYP  YHAGFN G+N  E+VNF L+ WLP G
Sbjct: 547 VSPYSKRFVEAGIDCYKAIQNPGEYIVTYPKCYHAGFNSGFNFNEAVNFTLDLWLPYG 604

 Score = 36.6 bits (83), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 2/42 (4%)

Query: 14 VPVFKPTYEQFEDFYAYCKA--INKYGMKSGVVKVIPPKEWK 53
          +P  +P+ EQF D   +  +  + K GMK G++K+IPP+ +K
Sbjct: 4  IPTLRPSEEQFLDPIGFLSSNEVKKLGMKYGMIKLIPPESFK 45

>Sklu_2303.6 YJR119C, Contig c2303 8969-11356
          Length = 795

 Score =  120 bits (302), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 99/183 (54%), Gaps = 14/183 (7%)

Query: 200 NVAKLP----NILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQDLYSINYIHFGAPKQW 255
           N+  LP    ++L     K+ G+   ++Y G   ++F WHLEDQ   S NY H G PK W
Sbjct: 411 NLLNLPQAKGSLLPVFGKKISGMTVPWIYIGSTFSTFCWHLEDQYTLSANYQHEGDPKVW 470

Query: 256 YSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLASP--KLLQENGIRCNEIVHHEGE 313
           YSIP+    KF + M++  P+  +  P+ L   + L SP  K  Q+  I C + +   GE
Sbjct: 471 YSIPEHSCDKFNRLMKDIAPDLFEKQPDLLHQLITLISPYDKRFQQAKISCYKALQKPGE 530

Query: 314 FMITYPYGYHAGFNYGYNLAESVNFALEEWLPIG-------KKAGKCHCISDSVEIDVKK 366
           ++IT+P  YHAGFN GYN  E+VNF L+ WLP G       K  GK  C+ D  E+ +  
Sbjct: 531 YIITFPKCYHAGFNTGYNFNEAVNFTLDTWLPYGIEACQDYKDTGK-QCVFDMWELMLNV 589

Query: 367 LAK 369
           L +
Sbjct: 590 LIQ 592

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 14 VPVFKPTYEQFEDFYAYCKA--INKYGMKSGVVKVIPPKEWKDKLDLPYSAETLQKIKIK 71
          VPV  PT ++FED  +Y     + + G   G++K++PP+E++  L +  S      ++++
Sbjct: 7  VPVLYPTLQEFEDPISYLSQPQVQRQGHICGMIKLVPPREFQPPLSIKESTFKFN-VRLQ 65

Query: 72 SPIQQHISGNKGLFMVQNV 90
             + +I     LF ++ +
Sbjct: 66 RLSELNILNRSRLFFLKQL 84

>CAGL0H00528g 52511..54733 similar to sp|P47156 Saccharomyces
           cerevisiae YJR119c, hypothetical start
          Length = 740

 Score =  118 bits (295), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 79/234 (33%), Positives = 117/234 (50%), Gaps = 27/234 (11%)

Query: 168 LEEYYWKTLNF----TTPMYGADT----PGSI--FPEGLNVW-----NVAKLP----NIL 208
           LE+ +W  +      TT  YGAD     P  +  FP     +     N+  LP    ++L
Sbjct: 343 LEKEFWDLVGNQDVKTTVPYGADIHSEDPAELTGFPTNDKTYSTHPMNLLNLPQASSSLL 402

Query: 209 DHMETKVPGVNDSYLYAGLWKASFSWHLEDQDLYSINYIHFGAPKQWYSIPQEDRFKFYK 268
             +   + G+   ++Y G   ++F WHLEDQ   S NY H G+PK WYSIP      F+K
Sbjct: 403 PFLNRNISGMTIPWIYVGSKFSTFCWHLEDQYTLSANYQHEGSPKVWYSIPDNSCDNFHK 462

Query: 269 FMQEQFPEEAKNCPEFLRHKMFLASPK--LLQENGIRCNEIVHHEGEFMITYPYGYHAGF 326
            + +  P+  +  P+ L   + L SP   L ++  ++  + V H  E+++T+P  YHAGF
Sbjct: 463 LLHDLTPDLFEKQPDLLHQLVSLISPYDPLFKKYNVKWYKAVQHPNEYIVTFPKCYHAGF 522

Query: 327 NYGYNLAESVNFALEEWLPIGKKA------GKCHCISDSVEIDVKKLAKSWRDN 374
           N GYN+ E+VNF  E WLP G +A       K   + D  E+ V  L   +RDN
Sbjct: 523 NTGYNINEAVNFTSESWLPYGLEAISDYQLTKKMPVFDMYELMVNILVMYYRDN 576

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 3/79 (3%)

Query: 14 VPVFKPTYEQFEDFYAYCK--AINKYGMKSGVVKVIPPKEWKDKLDLPYSAETLQKIKIK 71
          VPV  PT E+F D   Y    A+ + G   G+V+++PP  +   L L   A    K++ +
Sbjct: 6  VPVVYPTEEEFADPIDYLNQPALRRLGKVYGMVRIVPPAGFNPPLALD-KARFKFKVRWQ 64

Query: 72 SPIQQHISGNKGLFMVQNV 90
          +  +  +     LF + N+
Sbjct: 65 NLNELQLLNRARLFFINNL 83

>ABR167C [760] [Homologous to ScYJR119C - SH] (714425..716755) [2331
           bp, 776 aa]
          Length = 776

 Score =  116 bits (290), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 97/183 (53%), Gaps = 14/183 (7%)

Query: 200 NVAKLP----NILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQDLYSINYIHFGAPKQW 255
           N+  LP    ++L      + G+   +LY G   ++F WHLEDQ   S NY H G PK W
Sbjct: 394 NLLNLPMARGSLLPVFGRSISGMTVPWLYIGSTFSTFCWHLEDQYTLSANYQHEGDPKVW 453

Query: 256 YSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLASP--KLLQENGIRCNEIVHHEGE 313
           YSIP++    F K M+   P+  +  P+ +   + L SP  +  +   I C + V + GE
Sbjct: 454 YSIPEQSATAFNKLMKNIAPDLFEKQPDLMHQLVTLISPYDEKFEAANIACYKAVQYPGE 513

Query: 314 FMITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKA-------GKCHCISDSVEIDVKK 366
           ++ITYP  YHAGFN GYN  E+VNF L+ W+P G  A       GK  C+ D  E+ +  
Sbjct: 514 YIITYPKCYHAGFNTGYNFNEAVNFTLDLWVPYGLSASEDYRLTGK-RCVFDMWELMLNV 572

Query: 367 LAK 369
           L +
Sbjct: 573 LLQ 575

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 10 IVGGVPVFKPTYEQFEDFYAYC--KAINKYGMKSGVVKVIPPKEWK 53
          ++  VPV  PT ++F D   Y    A+ + G   G+VK++PP+ ++
Sbjct: 5  MLQNVPVLHPTEDEFRDPIGYLSKAAVQRLGHVYGMVKLVPPRGFQ 50

>Kwal_55.21855
          Length = 521

 Score =  114 bits (286), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 65/186 (34%), Positives = 98/186 (52%), Gaps = 12/186 (6%)

Query: 200 NVAKLPN----ILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQDLYSINYIHFGAPKQW 255
           N+  LP+    +L     K+ G+   ++Y G   ++F WHLEDQ   S N+ H G PK W
Sbjct: 140 NLVNLPSAKGSLLSVFGKKISGMTVPWIYIGSTFSTFCWHLEDQYTLSANFQHEGDPKVW 199

Query: 256 YSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLASP--KLLQENGIRCNEIVHHEGE 313
           YSIP     KF   M++  P+  +  P+ L   + L +P     ++  I C + + + GE
Sbjct: 200 YSIPGSSCDKFNTLMRQMAPDLFQKQPDLLHQLVTLIAPYDSAFKDAKISCYKAIQYPGE 259

Query: 314 FMITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKA------GKCHCISDSVEIDVKKL 367
           ++IT+P  YH+GFN GYN  E+VNF L+ WLP G +A       K  C+ D  E+ +  L
Sbjct: 260 YIITFPKCYHSGFNTGYNFNEAVNFTLDLWLPYGIEATHDYIESKKRCVFDMWELMLTVL 319

Query: 368 AKSWRD 373
            +   D
Sbjct: 320 VEYLED 325

>YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protein
           containing a PHD-finger and jumonji (jmjN) and jumonji
           (jmjC) domains, has low similarity to a region of
           selected mouse cDNA on the Y homolog (human SMCY), which
           is a male-specific protein that elicits transplant
           rejection in female recipients [2187 bp, 728 aa]
          Length = 728

 Score =  112 bits (280), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 116/249 (46%), Gaps = 43/249 (17%)

Query: 168 LEEYYWKTL------NFTTPMYGADT----PGSI--------FPEGLNV----------- 198
           LEE +W  +      + TT  YGAD     PG I         P+ +N            
Sbjct: 325 LEEMFWSLVTKNRRSSLTTVKYGADIHNELPGQITGFPTREFIPKNINGDELIDYLKYCD 384

Query: 199 --WNVAKLP----NILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQDLYSINYIHFGAP 252
              N+  LP    ++L   +  + G+   ++Y G   ++F WH+EDQ   S NY H G P
Sbjct: 385 HPMNLTNLPMAHNSLLPLFKRNISGMTIPWIYIGSLFSTFCWHMEDQYTLSANYQHEGDP 444

Query: 253 KQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLASPKL--LQENGIRCNEIVHH 310
           K WYSIP+    KF   + +  P+     P+ L   + L SP     +++GI   + V  
Sbjct: 445 KVWYSIPESGCTKFNDLLNDMSPDLFIKQPDLLHQLVTLISPYDPNFKKSGIPVYKAVQK 504

Query: 311 EGEFMITYPYGYHAGFNYGYNLAESVNFALEEWLPIG------KKAGKCHCISDSVEIDV 364
             E++IT+P  YHAGFN GYN  E+VNF ++ WLP G       K  +  C+ D  ++ +
Sbjct: 505 PNEYIITFPKCYHAGFNTGYNFNEAVNFTIDFWLPYGFGAITDYKLTQKACVFDMFDLMI 564

Query: 365 KKLAKSWRD 373
             L K  +D
Sbjct: 565 NVLDKYNKD 573

>Scas_691.27
          Length = 735

 Score =  101 bits (252), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 99/212 (46%), Gaps = 30/212 (14%)

Query: 168 LEEYYWKTLN--------FTTPMYGADTPGSIFPEGLNV----------------WNVAK 203
           LE+ +W+ +N         +  MYGAD   S    G  +                 N+  
Sbjct: 334 LEKEFWEKVNDNSISNNPSSLIMYGADIHNSEQISGFPLSNHALEKGSSKYVSHPMNLVN 393

Query: 204 LPNILDHM-----ETKVPGVNDSYLYAGLWKASFSWHLEDQDLYSINYIHFGAPKQWYSI 258
           LPN L  +        + G+   ++Y G   ++F WH+EDQ   S NY H GA K WYSI
Sbjct: 394 LPNALGSLLPLLSNKTISGMTIPWIYVGSTFSTFCWHMEDQYTLSANYQHEGASKIWYSI 453

Query: 259 PQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLASPKLLQENGIRCNEIVHHEGEFMITY 318
           P      F K +    P+      + +   + L SP  L ++ I C + + +  E++IT+
Sbjct: 454 PASSCEPFQKLLHSMTPDLFIKQQDLIHQLVSLVSPYDLPKS-INCYKAIQNPNEYIITF 512

Query: 319 PYGYHAGFNYGYNLAESVNFALEEWLPIGKKA 350
           P  +H+GFN GYNL E+VNF    WLP G +A
Sbjct: 513 PKCFHSGFNTGYNLNEAVNFTTPFWLPFGVEA 544

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 2/41 (4%)

Query: 14 VPVFKPTYEQFEDFYAYC--KAINKYGMKSGVVKVIPPKEW 52
          +P   PT EQF+D  +Y   + +   G + G++K++PPK +
Sbjct: 14 IPTLYPTEEQFQDPLSYLSQQDVLLAGTQFGMIKLVPPKSF 54

>CAGL0G08107g 768772..770649 weakly similar to tr|Q03833
           Saccharomyces cerevisiae YDR096w GIS1 DNA
           damage-responsive repressor of PHR1, hypothetical start
          Length = 625

 Score = 79.7 bits (195), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 43/65 (66%)

Query: 699 EIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLN 758
           +I  S   K + C+ C   F S +HL RH+ SVHS EKP++CP C K FKR+DHV QHL 
Sbjct: 552 KIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611

Query: 759 KKIPC 763
           KK PC
Sbjct: 612 KKTPC 616

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 47/100 (47%)

Query: 234 WHLEDQDLYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLAS 293
           W ++  + Y + +  FG P QWY +   +R     ++++  P+ ++ C  F  HK +   
Sbjct: 194 WRIDTVNQYHLIFNLFGTPIQWYIVEGCNRDSLISYLKKLEPKGSETCNAFYIHKKYCFG 253

Query: 294 PKLLQENGIRCNEIVHHEGEFMITYPYGYHAGFNYGYNLA 333
           P  L+   I    +V   G+  I+ P      F+YGY++ 
Sbjct: 254 PDFLERANIPYKTMVQESGKLFISKPGTCFFVFHYGYSIV 293

>Scas_709.32
          Length = 822

 Score = 69.7 bits (169), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%)

Query: 702 LSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
            S +NK + C+ C + F    HL RH +SVHS E+P +CP C K+F R D++ QH+
Sbjct: 758 FSDENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHI 813

>AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH]
           complement(1071491..1074664) [3174 bp, 1057 aa]
          Length = 1057

 Score = 69.3 bits (168), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 49/78 (62%), Gaps = 8/78 (10%)

Query: 689 SPLNSKFA--PEEIVL-----SGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP 741
           S +N +FA  PE + L     SGK ++++C  C R F+   HL RHK+S H+ EKP+ C 
Sbjct: 22  SKINKRFAQLPENLRLNGVTPSGKPRLFVCHTCTRAFARQEHLIRHKRS-HTNEKPYICG 80

Query: 742 KCGKRFKRRDHVLQHLNK 759
            C +RF RRD +L+H +K
Sbjct: 81  ICDRRFSRRDLLLRHAHK 98

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 15/28 (53%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSG 734
           K YIC  C R+FS    L RH   +H G
Sbjct: 75  KPYICGICDRRFSRRDLLLRHAHKLHGG 102

>CAGL0E04884g complement(469295..473764) weakly similar to sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1489

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 41/57 (71%), Gaps = 1/57 (1%)

Query: 703 SGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNK 759
           SGK ++++C+ C R F+   HLTRH++S H+ EKP+ C  C +RF RRD +L+H +K
Sbjct: 24  SGKPRLFVCQTCTRAFARQEHLTRHERS-HTKEKPYCCGICDRRFTRRDLLLRHAHK 79

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 7/46 (15%)

Query: 705 KNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRR 750
           K K Y C  C R+F+    L RH   VH G        CG+   R+
Sbjct: 54  KEKPYCCGICDRRFTRRDLLLRHAHKVHGG-------NCGESLLRK 92

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 66.2 bits (160), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 1/57 (1%)

Query: 703 SGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNK 759
           SGK ++++CK C R F+   HLTRH++S H+ EKP+ C  C +RF RRD +++H  K
Sbjct: 119 SGKPRLFVCKVCTRAFARQEHLTRHERS-HTKEKPYVCGICERRFTRRDLLIRHCQK 174

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 705 KNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK---- 760
           K K Y+C  C+R+F+    L RH + +H G        CG   +R    ++  +KK    
Sbjct: 149 KEKPYVCGICERRFTRRDLLIRHCQKLHGG-------NCGDYIRRTSRKVRRDSKKDNGA 201

Query: 761 --IPCISNETTVDAPIMNPTVQP 781
              P  S+ET  D P  N TV P
Sbjct: 202 VLDPSSSSET--DTP-NNSTVSP 221

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (67%)

Query: 705 KNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           KNK + CK+C++ F    HL RH +SVHS E+P +C  C K+F R D++ QHL
Sbjct: 569 KNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHL 621

>Scas_649.28
          Length = 730

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (62%)

Query: 702 LSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           L  KNK + C EC + F    HL RH +SVHS E+P +C  C K+F R D++ QHL
Sbjct: 666 LDDKNKPFKCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHL 721

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (53%), Gaps = 6/91 (6%)

Query: 671 QEDSFTSRNDDLD----KEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTR 726
           Q  SF+S  D LD    K++   P      P   +     K + C+ C+R+F    HL R
Sbjct: 420 QMSSFSSAPDPLDPGITKKRAGMPKTRGRKPSPAL--DATKPFGCEYCERRFKRQEHLKR 477

Query: 727 HKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           H +S+H GEKP+ C  CGK+F R D++ QH+
Sbjct: 478 HIRSLHMGEKPYGCDICGKKFSRSDNLNQHI 508

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score = 59.3 bits (142), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 37/54 (68%), Gaps = 3/54 (5%)

Query: 705 KNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 756
           K + ++C+ C + F++  HL RH + +H+GEK H+C  P CG+RF R D+ LQH
Sbjct: 76  KRRKHLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQH 128

>Scas_721.92
          Length = 1152

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 1/57 (1%)

Query: 703 SGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNK 759
           SGK ++++C  C R F+   HL RH +S H+ EKP+ C  C K+F RRD +L+H  K
Sbjct: 72  SGKPRLFVCDVCSRAFARQEHLDRHARS-HTNEKPYQCGICTKKFTRRDLLLRHAQK 127

>Scas_602.9
          Length = 547

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%)

Query: 701 VLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           +L    K + C  C+R+F    HL RH +S+H GEKP++C  C K F R D++ QH+
Sbjct: 487 LLPDATKQFACDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHI 543

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           K + C+ C R+F    HL RH +S+H GEKP+ C  CGK+F R D++ QH+
Sbjct: 352 KQFGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHI 402

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score = 60.1 bits (144), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 6/75 (8%)

Query: 684 KEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP-- 741
           ++Q + P N+    E++    + + YICK C R F++  HL RH + +H+GEK H CP  
Sbjct: 152 RKQRTDPRNTLSDEEDL---EQRRKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYK 207

Query: 742 KCGKRFKRRDHVLQH 756
            C +RF R D+ LQH
Sbjct: 208 GCTQRFSRHDNCLQH 222

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%)

Query: 701 VLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           +L    KI+ C  C+R+F    HL RH  S+H GE+P+SC  C K F R D++ QH
Sbjct: 210 LLFDDAKIFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQH 265

>Kwal_47.17241
          Length = 403

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 33/52 (63%)

Query: 706 NKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           +K + C  C R+F    HL RH +S+H GEKP  C  CGK+F R D++ QH+
Sbjct: 343 SKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHI 394

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score = 57.8 bits (138), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 3/50 (6%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQH 756
           Y+CK C R F++  HL RH + +H+GEK H CP   CG+RF R D+ +QH
Sbjct: 100 YVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQH 148

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 54/97 (55%), Gaps = 8/97 (8%)

Query: 661 LILSKVASTRQEDSFTSRNDDLDKEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSS 720
           L L+KV S++  DS ++    + K+Q   P      P  I+    +K + C+ C R+F  
Sbjct: 378 LSLAKVISSK--DSIST----IIKKQQGVPKTRGRKPSPIL--DASKPFGCEYCDRRFKR 429

Query: 721 GHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
             HL RH +S+H  EKP+ C  CGK+F R D++ QHL
Sbjct: 430 QEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHL 466

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 6/65 (9%)

Query: 701 VLSGKNKIYICKECQRKFSSGHHLTRHKKS--VHSGEKPHSCPKCGKRFKRRDHVLQHLN 758
           V+S K+ I    + Q+    G   TR +K   +    KP  C  C +RFKR++H+ +H+ 
Sbjct: 383 VISSKDSISTIIKKQQ----GVPKTRGRKPSPILDASKPFGCEYCDRRFKRQEHLKRHIR 438

Query: 759 KKIPC 763
               C
Sbjct: 439 SLHIC 443

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 64/125 (51%), Gaps = 15/125 (12%)

Query: 649 KKESPVETSKSNLILSKVASTRQED---SFTSRNDDLDKEQGSSPLNSKF------APEE 699
           K+E  +ET  S ++L   +++R+     S   R  D      ++ +NSK        PE 
Sbjct: 30  KQEIEMETDDSPILLMSSSASRENSNTFSVIQRTPDGKIITTNNNMNSKINKQLDKLPEN 89

Query: 700 IVL-----SGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVL 754
           + L     SGK + ++C+ C R F+   HL RH +S H+ EKP+ C  C + F RRD ++
Sbjct: 90  LRLNGRTPSGKLRSFVCEVCTRAFARQEHLKRHYRS-HTNEKPYPCGLCNRCFTRRDLLI 148

Query: 755 QHLNK 759
           +H  K
Sbjct: 149 RHAQK 153

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 58.5 bits (140), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (64%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           K + C+ C R+F    HL RH +S+H GEKP+ C  C K+F R D++ QH+
Sbjct: 262 KQFGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHI 312

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 50/93 (53%), Gaps = 4/93 (4%)

Query: 666 VASTRQEDSFTSRNDDLDKEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLT 725
           +AS  +  S   R     ++   S    +   +++ L+ + K YICK C R F++  HL 
Sbjct: 242 IASKSKRSSRQDRKPKASQQHKISNTGKQSNTKDLPLAERRK-YICKICSRGFTTSGHLA 300

Query: 726 RHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 756
           RH + +H+GEK H C  P C +RF R D+ +QH
Sbjct: 301 RHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQH 332

>Kwal_27.10925
          Length = 264

 Score = 57.8 bits (138), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 36/54 (66%), Gaps = 3/54 (5%)

Query: 705 KNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQH 756
           + + Y+CK C + F++  HL RH + +H+GEK H CP   CG+RF R D+ +QH
Sbjct: 197 QRRRYVCKICVKGFTTSGHLARHNR-IHTGEKNHVCPHEGCGQRFSRHDNCVQH 249

>Kwal_26.8351
          Length = 698

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (62%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           K + C+EC + F    HL RH +SVHS E+P  C  C K+F R D++ QHL
Sbjct: 639 KPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHL 689

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 3/50 (6%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQH 756
           Y+CK C + F++  HL RH + +H+GEK H CP   CG+RF R D+ LQH
Sbjct: 402 YLCKVCGKGFTTSGHLARHNR-IHTGEKRHVCPYEGCGQRFNRHDNCLQH 450

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%)

Query: 702 LSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           L  + K + C+EC + F    HL RH +SVHS ++P  C  C K+F R D++ QHL
Sbjct: 497 LEEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHL 552

>Kwal_56.24206
          Length = 1502

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 89/218 (40%), Gaps = 51/218 (23%)

Query: 184 GADTPGSIFPEGLNVWNVAKLPN-ILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQDLY 242
           G   PG++ P  LN  NVA   N +L +++       D+ L  G+  +   W +ED  L 
Sbjct: 499 GDSLPGALSPWNLN--NVATSENSMLRYLDADFGNHLDTKLDIGMLFSVKGWSIEDNFLA 556

Query: 243 SINYIHFGAPKQWYSIPQEDRFKFYKFMQ--EQFPEEAKNC-PEFLRHKMFLAS------ 293
           SI+Y H G+ K WY IP +D  KF + ++  E  P++ ++  P  +  K F  S      
Sbjct: 557 SIHYHHVGSSKLWYVIPPQDMEKFERLIEFYESQPQDVESSYPNGVETKQFEKSEFYQSF 616

Query: 294 ---------------------------------------PKLLQENGIRCNEIVHHEGEF 314
                                                  P+ L+++GI   ++V     F
Sbjct: 617 LDTTPSRPTSMRPHRVNTHTLNKNFQSSNSTLANDWNFHPETLKDHGITVYKVVQDPRSF 676

Query: 315 MITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKAGK 352
           +  +P  Y +  + G++++E   FA   WL I  +  K
Sbjct: 677 IFRFPKSYSSNISSGFSVSEFALFAPTSWLGIAIEGEK 714

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 756
           Y+C  C R F    H TRH ++ H+GEKPH+C  P CGKRF R D + +H
Sbjct: 34  YVCPICSRAFHRLEHQTRHIRT-HTGEKPHACEFPGCGKRFSRSDELTRH 82

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 61/124 (49%), Gaps = 5/124 (4%)

Query: 637 ERPNHKTANRILKKESPVETSKSNLILSKVASTRQEDSFTSRNDDLDKEQ-GSSPLNSKF 695
           E+P+   A+       PV  +++   LS+  S   +D       D D E  GSS L    
Sbjct: 13  EKPSSSLASVPATSHHPVVKNETVNTLSEAGS---DDKEADTELDQDSEHAGSSGLVPIP 69

Query: 696 APEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQ 755
               ++ + + + ++C  C R F+   HL RH++S H+ EKP  C  CG+ F RRD VL+
Sbjct: 70  KKSRLIKTDRPRPFLCPICTRGFARQEHLRRHERS-HTNEKPFLCAFCGRCFARRDLVLR 128

Query: 756 HLNK 759
           H  K
Sbjct: 129 HQQK 132

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (60%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           K + C +C + F    HL RH +SVHS E+P  C  C K+F R D++ QHL
Sbjct: 619 KPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHL 669

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (60%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           K + C +C + F    HL RH +SVHS E+P  C  C K+F R D++ QHL
Sbjct: 482 KPFQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHL 532

>Scas_703.23
          Length = 1341

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 37/60 (61%), Gaps = 1/60 (1%)

Query: 700 IVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNK 759
           ++ + K + ++C  C R F    HL RH++S H+ EKP  C  CG+ F RRD VL+H +K
Sbjct: 63  VIKTDKPRPFLCPTCTRGFVRQEHLKRHQRS-HTNEKPFLCVFCGRCFARRDLVLRHQHK 121

>Scas_718.44
          Length = 266

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 3/50 (6%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQH 756
           ++CK C   F++  HL+RH + +H+GEK HSCP   C ++F R D+ LQH
Sbjct: 210 HVCKICSTGFTTSGHLSRHNR-IHTGEKNHSCPFEGCNQKFSRHDNCLQH 258

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 41/74 (55%), Gaps = 4/74 (5%)

Query: 686 QGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGK 745
           QG  P+  K     I+ + K + ++C  C R F    HL RH+ S H+ EKP+ C  CG+
Sbjct: 131 QGILPIPKK---SRIIKTDKPRPFLCPTCTRGFVRQEHLKRHQHS-HTREKPYLCIFCGR 186

Query: 746 RFKRRDHVLQHLNK 759
            F RRD VL+H  K
Sbjct: 187 CFARRDLVLRHQQK 200

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 10/94 (10%)

Query: 687 GSSPLN--SKFAP----EEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSC 740
           GS P++  + FAP       + + K + ++C  C R F    HL RH+++ H+ EKP  C
Sbjct: 5   GSVPVDNGANFAPIPKKSRTIKTDKPRPHLCPICTRGFVRLEHLKRHQRA-HTNEKPFLC 63

Query: 741 PKCGKRFKRRDHVLQHLNKKIPCI---SNETTVD 771
             CG+ F RRD VL+H  K  P +   +NE ++D
Sbjct: 64  VFCGRCFARRDLVLRHQYKLHPTLVSKNNEGSLD 97

>Scas_569.2
          Length = 293

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (62%), Gaps = 3/54 (5%)

Query: 705 KNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 756
           K + YICK C + F++  HL RH + +H+GEK H C  P C  +F R D+ +QH
Sbjct: 224 KRRKYICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQH 276

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (60%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           K + C  C + F    HL RH +SVHS E+P +C  C K+F R D++ QH+
Sbjct: 645 KPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHI 695

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 756
           Y+C  CQR F    H TRH +  H+GE+PH+C  P C KRF R D + +H
Sbjct: 26  YVCPICQRGFHRLEHQTRHIR-THTGERPHACDFPGCSKRFSRSDELTRH 74

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 4/35 (11%)

Query: 727 HKKSVHS----GEKPHSCPKCGKRFKRRDHVLQHL 757
           HKKS++     G +P+ CP C + F R +H  +H+
Sbjct: 11  HKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHI 45

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNK 759
           ++C  C R F    HL RH+ S H+ EKP  C  CGK F R+D VL+HL K
Sbjct: 27  FLCPICSRGFVRQEHLKRHQNS-HTHEKPFLCLICGKCFARKDLVLRHLQK 76

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (62%), Gaps = 1/51 (1%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNK 759
           ++C  C R F+   HL RH++S H+ EKP  C  CG+ F RRD VL+H  K
Sbjct: 80  FLCPVCTRGFARQEHLKRHQRS-HTNEKPFLCAFCGRCFARRDLVLRHQQK 129

>Kwal_27.11460
          Length = 531

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 50/93 (53%), Gaps = 1/93 (1%)

Query: 664 SKVASTRQEDSFTSRNDDLDKEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHH 723
           SK  + R +D+F   ++    ++G+SPLN+        L     +Y C+ C +KF+  ++
Sbjct: 368 SKSHNDRSDDTFEDSSNYESADEGTSPLNATGIIRRKSLQKNASVYACELCDKKFTRPYN 427

Query: 724 LTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           L  H ++ H+ E+P SC  CGK F R+    +H
Sbjct: 428 LKSHLRT-HTDERPFSCAICGKAFARQHDRKRH 459

>Kwal_47.16621
          Length = 1178

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 1/51 (1%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNK 759
           ++C  C R F+   HL RH+++ H+ EKP  C  CG+ F RRD VL+H  K
Sbjct: 78  FLCSICTRGFARQEHLKRHQRA-HTNEKPFLCAFCGRCFARRDLVLRHQQK 127

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 35/64 (54%)

Query: 706 NKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCIS 765
           +K + C  C + F    HL RH +SVHS ++P SC  C K+F R D++ QH+       S
Sbjct: 532 DKPFGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHIKTHKKSGS 591

Query: 766 NETT 769
             TT
Sbjct: 592 TSTT 595

>Scas_717.17
          Length = 525

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 696 APEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQ 755
           +P       +N +YIC  C + F     L RH  S HS E+ + CP C  R KRRD++LQ
Sbjct: 375 SPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQ 433

Query: 756 HLNKK 760
           H+  K
Sbjct: 434 HMKLK 438

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 4/74 (5%)

Query: 686 QGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGK 745
           QG  P+  K      + + K + ++C  C R F+   HL RH++S H+ EKP  C  CG+
Sbjct: 28  QGIMPIPRK---SRTIKTDKPRPFLCPICTRGFARQEHLKRHQRS-HTNEKPFLCAFCGR 83

Query: 746 RFKRRDHVLQHLNK 759
            F RRD VL+H  K
Sbjct: 84  CFARRDLVLRHQQK 97

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 703 SGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPK--CGKRFKRRDHVLQH 756
           +G+   + CK C   F++  HL+RH + +H+GEK H CP   CG+RF R D+  QH
Sbjct: 147 AGQRTRHFCKICSTGFTTSGHLSRHNR-IHTGEKNHICPHEGCGQRFSRHDNCNQH 201

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (60%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           K + C+ C R+F    HL RH +S+H  EKP +C  C K F R D++ QH+
Sbjct: 387 KQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHV 437

>Scas_707.31
          Length = 289

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%)

Query: 701 VLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           +L   +K Y C  C+++F    HL RH +++H   +P  C  C KRF R D++ QH+
Sbjct: 215 ILPDDSKQYFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHV 271

>AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH]
           (193474..198039) [4566 bp, 1521 aa]
          Length = 1521

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/275 (22%), Positives = 103/275 (37%), Gaps = 75/275 (27%)

Query: 145 FEQFRTEYTI---DLSDFQNTERLKFLEEYYWKTL----NFTTPMYGADTPGSIFPEG-- 195
           F+  +T+Y+     ++ + +   L+  E+ Y+  L    N      G D PG I   G  
Sbjct: 469 FDLIQTQYSDIIPQVTSWTDKIELQQFEDLYFSILADPTNSLDIDSGIDLPGIIHGSGFR 528

Query: 196 ------------LNVWNVAKLP----NILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQ 239
                       L+ WN+  +P    ++L +++     +    ++ G+  ++  W L DQ
Sbjct: 529 TISRNSDNTAELLDPWNINNVPLAANSLLSYLDIDYGCLTRPKMHVGMTFSTRGWSLGDQ 588

Query: 240 DLYSINYIHFGAPKQWYSIPQEDRFKFYKFMQE-------QFPEEAKNCPEF-------- 284
            L +I Y H G    WY I  E +  F K ++E          +E    PEF        
Sbjct: 589 YLPTIEYNHLGCSLLWYFIAPESQEAFEKLVEEINLGKRDHPTDELDVDPEFKKSEFYNS 648

Query: 285 ---------------LRHK----MFLAS----------------PKLLQENGIRCNEIVH 309
                          LR K    MF  +                P+ LQ+ GI+    + 
Sbjct: 649 YLETNMRNRLNDTHKLRSKNGSHMFGQAARGPKSYLLPNDIQIHPEELQKRGIKFYNAIQ 708

Query: 310 HEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWL 344
               F+I YP  Y+     G++++ES   A E WL
Sbjct: 709 EAKTFIIKYPRAYNTSIAAGFHVSESCYLAPESWL 743

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 1/51 (1%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNK 759
           ++C  C R F    HL RH+++ H+ EKP  C  CG+ F RRD VL+H +K
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRA-HTNEKPFLCVFCGRCFARRDLVLRHQHK 110

>YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protein
           involved in transcriptional regulation of methionine
           metabolism, has two tandem C2H2-type zinc fingers [534
           bp, 177 aa]
          Length = 177

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLN 758
           ++Y C +CQ KFS    L RH+K VHS   PH C  CGK F R+D + +H N
Sbjct: 93  QLYSCAKCQLKFSRSSDLRRHEK-VHSLVLPHICSNCGKGFARKDALKRHSN 143

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 35/51 (68%), Gaps = 1/51 (1%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           K ++C  C ++F+ G +L  H++ +H+GEKP+SC  C K+F R+ ++  HL
Sbjct: 619 KPFVCDYCGKRFTQGGNLRTHER-LHTGEKPYSCDICDKKFSRKGNLAAHL 668

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           K + C  C R FS   HL  H +S H G KP  C  CGKRF +  ++  H
Sbjct: 591 KKHECPYCHRLFSQATHLEVHVRS-HIGYKPFVCDYCGKRFTQGGNLRTH 639

>Kwal_14.2278
          Length = 463

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 756
           YIC  C R F    H TRH ++ H+GEKPH+C    C KRF R D + +H
Sbjct: 23  YICPICSRAFHRLEHQTRHIRT-HTGEKPHACDFAGCTKRFSRSDELTRH 71

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 703 SGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           +GK K + C  C + FS   H TRH++S H+G KP  C  C   F RRD + +H+
Sbjct: 6   TGKTKRHFCSFCNKAFSRSEHKTRHERS-HAGVKPFECQVCSHSFVRRDLLQRHI 59

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 3/52 (5%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 756
           + Y+C  C R F    H TRH ++ H+GEKPH+C    CGKRF R+D + +H
Sbjct: 20  RPYVCPICARAFHRLEHQTRHIRT-HTGEKPHACDFAGCGKRFSRQDELTRH 70

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 756
           ++C  C R F    H TRH ++ H+GEKPH+C  P C KRF R D + +H
Sbjct: 43  HVCPICGRAFHRLEHQTRHMRT-HTGEKPHACDFPGCVKRFSRSDELTRH 91

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 15/22 (68%)

Query: 736 KPHSCPKCGKRFKRRDHVLQHL 757
           +PH CP CG+ F R +H  +H+
Sbjct: 41  RPHVCPICGRAFHRLEHQTRHM 62

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 35/51 (68%), Gaps = 1/51 (1%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           K + C+ C ++F+ G +L  H + +H+GE+P+ C KCGKRF R+ ++  H+
Sbjct: 513 KPFQCEYCGKRFTQGGNLRTHVR-LHTGERPYECDKCGKRFSRKGNLAAHM 562

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKR----RDHVLQHLNKK 760
           K + C  C + F+   HL  H +S H G KP  C  CGKRF +    R HV  H  ++
Sbjct: 485 KQHKCPYCHKCFTQSTHLEVHVRS-HIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGER 541

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 756
           + C  C R F    H TRH + +H+GEKPH+C  P C KRF R D + +H
Sbjct: 38  HACPICHRAFHRLEHQTRHMR-IHTGEKPHACDFPGCVKRFSRSDELTRH 86

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPK--CGKRFKRRDHVLQH 756
           +IC+ C   F++  HL+RH K +H+GEK H CP   C + F R D+ LQH
Sbjct: 252 HICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQH 300

>Scas_575.3
          Length = 455

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 756
           ++C  CQR F    H TRH ++ H+GEKPH C  P C K+F R D + +H
Sbjct: 68  HVCPICQRAFHRLEHQTRHMRT-HTGEKPHECDFPGCVKKFSRSDELTRH 116

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 702 LSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           +    + YIC  C + FS   H TRH++S H+G KP SC  C   F RRD + +H+
Sbjct: 1   MVASQRKYICSFCAQAFSRSEHKTRHERS-HTGVKPFSCKVCNHSFVRRDLLQRHI 55

>Kwal_47.17888
          Length = 786

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 1/50 (2%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           K + C+ C ++F+ G +L  H + +H+GEKP+ C KCG+RF R+ ++  H
Sbjct: 529 KPFQCEYCGKRFTQGGNLRTHVR-LHTGEKPYECEKCGRRFSRKGNLAAH 577

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKR----RDHVLQHLNKK 760
           K + C  C + F+   HL  H +S H G KP  C  CGKRF +    R HV  H  +K
Sbjct: 501 KQHECPYCHKCFTQSTHLEVHVRS-HIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGEK 557

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 3/80 (3%)

Query: 700 IVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQHL 757
           + L    K Y C++C R+FS   +L  H+ + H   KP  C    C K F +  ++  H 
Sbjct: 550 VRLHTGEKPYECEKCGRRFSRKGNLAAHRLT-HENLKPFHCKLDGCNKSFTQLGNMKAHQ 608

Query: 758 NKKIPCISNETTVDAPIMNP 777
           N+      NE T     M+P
Sbjct: 609 NRFHLQTLNELTQRLAEMDP 628

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 702 LSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           +    + YIC  C + FS   H  RH++S H+G KP SC  C   F RRD + +H+
Sbjct: 1   MVASQRKYICSFCAKPFSRSEHKARHERS-HTGSKPFSCSICSHSFVRRDLLQRHI 55

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 705 KNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 756
           K + + C+ C R F    H  RH ++ H+GEKPH C  P CGK F R D + +H
Sbjct: 13  KERPFKCEHCSRGFHRLEHKKRHMRT-HTGEKPHGCSFPGCGKSFSRSDELKRH 65

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 702 LSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQHL 757
           +  +N+ + C  C R F    H  RH ++ H+GEKPH C  P CGK F R D + +H+
Sbjct: 10  VDNENRPFRCDTCHRGFHRLEHKKRHLRT-HTGEKPHHCAFPGCGKSFSRSDELKRHM 66

>Scas_712.42*
          Length = 290

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQHL 757
           + C+ C R F    H  RH ++ H+GEKPH C  P CGK F R D + +HL
Sbjct: 18  FRCETCARGFHRLEHKKRHMRT-HTGEKPHHCAFPGCGKGFSRSDELKRHL 67

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 702 LSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           ++   K YIC  C + FS   H  RH++S H+G KP  C  C   F RRD + +H+
Sbjct: 1   MAAGQKKYICSFCLKPFSRSEHKIRHERS-HAGVKPFQCQVCKHSFVRRDLLQRHI 55

>Scas_697.35
          Length = 839

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           K Y C  C ++F+ G +L  H++ +H+GEKP+ C  C K+F R+ ++  HL
Sbjct: 541 KPYQCGYCGKRFTQGGNLRTHQR-LHTGEKPYECELCDKKFSRKGNLAAHL 590

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           K + C  C R F+   HL  H +S H G KP+ C  CGKRF +  ++  H
Sbjct: 513 KQHKCPYCHRLFAQSTHLEVHIRS-HLGYKPYQCGYCGKRFTQGGNLRTH 561

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 729 KSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           K++H G K H CP C + F +  H+  H+
Sbjct: 506 KTLHEGSKQHKCPYCHRLFAQSTHLEVHI 534

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 34/50 (68%), Gaps = 1/50 (2%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           K + C+ C ++F+ G +L  H + +H+GEKP+ C +CG++F R+ ++  H
Sbjct: 549 KPFSCEFCGKRFTQGGNLRTHIR-LHTGEKPYECERCGRKFSRKGNLAAH 597

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 5/58 (8%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKR----RDHVLQHLNKK 760
           K + C  C + F+   HL  H +S H G KP SC  CGKRF +    R H+  H  +K
Sbjct: 521 KQFQCPYCHKYFTQSTHLEVHVRS-HIGYKPFSCEFCGKRFTQGGNLRTHIRLHTGEK 577

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 3/62 (4%)

Query: 700 IVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQHL 757
           I L    K Y C+ C RKFS   +L  HK + H   KP  C    C K F +  ++  H 
Sbjct: 570 IRLHTGEKPYECERCGRKFSRKGNLAAHKLT-HDNLKPFECKLDDCNKNFTQLGNMKAHQ 628

Query: 758 NK 759
           N+
Sbjct: 629 NR 630

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQH 756
           Y+C EC + F+    L  H+ ++H+G++P +CP   CGK F  R ++L+H
Sbjct: 183 YVCTECGKGFARASSLRTHR-NIHTGDRPFTCPFKNCGKSFNARSNMLRH 231

>Scas_683.25
          Length = 879

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           K +IC  C + FS   H  RH++S H+G KP+ C  C   F R D  L+H+
Sbjct: 13  KRFICSFCAKGFSRAEHKIRHERS-HTGLKPYKCKVCTHCFVRSDLALRHI 62

>Kwal_47.19045
          Length = 266

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 704 GKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQHL 757
           G ++ + C  C + F    H  RH ++ H+GEKPHSC  P C KRF R D + +H+
Sbjct: 9   GGHRPFKCDMCGKGFHRLEHKRRHIRT-HTGEKPHSCNFPGCVKRFSRSDELKRHV 63

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 44/75 (58%), Gaps = 4/75 (5%)

Query: 685 EQGSSPLNSKF-APEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP-- 741
           ++ S+  + KF A  EI  + ++  +ICK C +KF     L+ H  ++H+GEKP+ CP  
Sbjct: 148 DETSNAFDEKFSAQAEINKTSEDTKFICKVCLKKFKRPSSLSTHM-NIHTGEKPYPCPFD 206

Query: 742 KCGKRFKRRDHVLQH 756
            C K F  + ++L+H
Sbjct: 207 NCTKSFNAKSNMLRH 221

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (62%), Gaps = 3/51 (5%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQHL 757
           Y+C+ C  +F    H TRH ++ H+GEKP +C  P C KRF R D + +H+
Sbjct: 12  YLCEICGNRFHRLEHKTRHIRT-HTGEKPFACTVPGCPKRFSRNDELKRHI 61

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 703 SGKNKIYICKE---CQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           S + K + C     C   F+   HL RH +  H+GEKP  CP C K F R D++ QH
Sbjct: 35  SARRKTFKCTGYDGCTMSFTRAEHLARHIRK-HTGEKPFQCPACLKFFSRVDNLKQH 90

>Scas_378.1
          Length = 208

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 708 IYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 760
           +Y C  C + F     L RH  + HS ++ +SCPKC  + KR+D++LQHL  K
Sbjct: 83  VYQCHMCVKSFRRHSWLKRHLLA-HSSQRHYSCPKCVSKHKRKDNLLQHLKLK 134

>AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W
           (MET31) - SH] complement(240857..241540) [684 bp, 227
           aa]
          Length = 227

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 45/87 (51%), Gaps = 6/87 (6%)

Query: 674 SFTSRNDDLDKEQGSSP---LNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKS 730
           ++ S ++ L K++ +SP   L     PEE V  GK   + C +C+  F     L RH+K 
Sbjct: 111 AYLSEDELLTKKRKTSPGAALEVSGGPEETVNDGKR--FHCTKCELVFRRSGDLRRHEK- 167

Query: 731 VHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           VH    P+ C  CGK F R+D + +H 
Sbjct: 168 VHLPILPNICSLCGKGFARKDALKRHF 194

>Scas_693.31
          Length = 635

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 5/59 (8%)

Query: 705 KNKIYICK--ECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKI 761
           +++ Y C    C + F   H L RHKK VHS EK ++CP CGK+F R D ++ H ++ I
Sbjct: 515 EDRPYACDFPNCDKAFVRNHDLVRHKK-VHS-EKSYACP-CGKKFNREDALIVHRSRMI 570

>YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in
           cell wall structure or biosynthesis [4236 bp, 1411 aa]
          Length = 1411

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/214 (20%), Positives = 77/214 (35%), Gaps = 57/214 (26%)

Query: 196 LNVWNVAKLP----NILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQDLYSINYIHFGA 251
           L+ WN+  +P    ++L H++  +     +    G+  +   W + D  L SI++ H G+
Sbjct: 479 LDQWNLDNIPLNELSLLQHLDLDMANFTRTTYDIGMLFSCQGWSVSDHFLPSIDFNHLGS 538

Query: 252 PKQWYSIPQEDRFK-----------------------------------FYK-FMQEQ-- 273
            K  YSI  +D  K                                   FYK F+  +  
Sbjct: 539 TKLVYSIAPKDMEKFEALIARGKSEWDTIQSRPRYSTSDDELKSFIETDFYKSFLDAEQS 598

Query: 274 -------------FPEE--AKNCPEFLRHKMFLASPKLLQENGIRCNEIVHHEGEFMITY 318
                        FPE+  A N         F+  P  +  NGI+  +    +G ++  +
Sbjct: 599 ADYSNTGDNSKNSFPEDKIAGNTLHDGSQSDFIFEPNFILANGIKLYKTTQEQGSYIFKF 658

Query: 319 PYGYHAGFNYGYNLAESVNFALEEWLPIGKKAGK 352
           P  +      G+ L+++  FA   WL    +A K
Sbjct: 659 PKAFTCSIGSGFYLSQNAKFAPSSWLRFSSEAAK 692

>Scas_719.68
          Length = 1350

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 6/73 (8%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCI-SNE 767
           ++C  C R      HL RH++S H+ EKP  C  CG+ F RRD VL++  K    I +N 
Sbjct: 41  FLCPICTRT----EHLKRHQRS-HTREKPFVCVFCGRCFARRDLVLRYQTKLHSSIMNNS 95

Query: 768 TTVDAPIMNPTVQ 780
            T +  I+  T Q
Sbjct: 96  ATHNDNILASTAQ 108

>Kwal_26.8021
          Length = 507

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 760
           Y C  C + F       RH  S HS  KP+SCP C  R KRRD++ QH+  K
Sbjct: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439

>YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-finger
           protein involved in transcriptional regulation of
           methionine metabolism, has two tandem C2H2-type zinc
           fingers [576 bp, 191 aa]
          Length = 191

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 2/68 (2%)

Query: 703 SGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIP 762
           S   K + C +C  +FS    L RH+K+ H    P+ CP+CGK F R+D + +H +  + 
Sbjct: 92  STGEKRFKCAKCSLEFSRSSDLRRHEKT-HFAILPNICPQCGKGFARKDALKRHYD-TLT 149

Query: 763 CISNETTV 770
           C  N T +
Sbjct: 150 CRRNRTKL 157

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           K + C+ C ++F+   +L  H++ +H+GE+P  C KC K F RR ++  H
Sbjct: 506 KPFECEFCGKRFTQAGNLRTHRR-LHTGERPFKCDKCDKTFARRGNLTAH 554

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           Y C  C + FS   HL  H K+ H G KP  C  CGKRF +  ++  H
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKA-HMGYKPFECEFCGKRFTQAGNLRTH 526

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 3/71 (4%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQHLNKKIPCISN 766
           + C +C + F+   +LT H+   H   KP+ C    C KRF +  ++  H NK  P    
Sbjct: 536 FKCDKCDKTFARRGNLTAHE-FTHESIKPYICRLDNCFKRFSQLGNMKSHQNKYHPQTIK 594

Query: 767 ETTVDAPIMNP 777
           E T    +++P
Sbjct: 595 ELTQKLALLDP 605

>Scas_687.33
          Length = 288

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 34/67 (50%), Gaps = 8/67 (11%)

Query: 693 SKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRR 750
           S FAP+        + + C  C R F    H  RH ++ H+GEKPH C    CGK F R 
Sbjct: 6   STFAPDNF-----QRPFRCPICSRGFHRLEHKKRHVRT-HTGEKPHPCTFAHCGKSFSRG 59

Query: 751 DHVLQHL 757
           D + +H+
Sbjct: 60  DELKRHI 66

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 708 IYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 760
           I+ C  C++ F     L RH  S HS  KP+SCP C  R KR+D++ QHL  K
Sbjct: 184 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 235

>Scas_636.14d
          Length = 275

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 706 NKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPC 763
           N  + C  CQ+ + +     +H K VH  E+ H C  C + FKR+DH+++H     PC
Sbjct: 212 NPEFPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKHQEGGSPC 268

>Scas_568.5
          Length = 199

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 706 NKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLN 758
           NK Y C +C+  F     L RH+K+ H    PH C +CGK F R+D + +H N
Sbjct: 115 NKRYPCSKCELIFLRSSDLRRHEKA-HLLVLPHICSQCGKGFARKDALKRHFN 166

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 705 KNKIYIC--KECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           ++K+Y C  + C + F+    LT H+ +VH G KP  C  CGK F ++ H+ +H+
Sbjct: 102 RSKVYFCDYQGCNKSFTRPSLLTEHQLTVHHGIKPFKCDTCGKEFAKKSHLNRHM 156

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           K + C  C ++F+   HL RH  S H+ +KP +C  CGK    R  + +H
Sbjct: 135 KPFKCDTCGKEFAKKSHLNRHMFS-HTDDKPFTCSICGKGVTTRQQLKRH 183

>Scas_627.17d
          Length = 275

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 706 NKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPC 763
           N  + C  CQ+ + +     +H K VH  E+ H C  C + FKR+DH+++H     PC
Sbjct: 212 NPGFPCPHCQKTYLTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKHQEGGSPC 268

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 709 YICKE--CQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKI 761
           Y C    C + F   H L RHKKS    EK ++CP CGK+F R D ++ H ++ I
Sbjct: 580 YSCDHPGCDKAFVRNHDLIRHKKSHQ--EKAYACP-CGKKFNREDALVVHRSRMI 631

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 700 IVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRF 747
           + +  K K Y C +CQ+ FS+   L +HK+ VHSGEKP+ C  C KRF
Sbjct: 588 LKVHSKYKPYQCPQCQKCFSTEDTLNQHKR-VHSGEKPYECHICHKRF 634

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 701 VLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           V SG+ K Y C  C ++F+  + L  H ++ H+GEKP  C  CG+ F    ++ +H+
Sbjct: 618 VHSGE-KPYECHICHKRFAISNSLKIHIRT-HTGEKPLKCKVCGRCFNESSNLSKHM 672

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 685 EQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCG 744
           ++G + LN         L     IY C  C +KF+  ++L  H ++ H+ E+P SC  CG
Sbjct: 402 DEGETALNLSGNTRRKSLQKNPAIYSCNLCDKKFTRPYNLKSHLRT-HTDERPFSCSVCG 460

Query: 745 KRFKRRDHVLQH 756
           K F R+    +H
Sbjct: 461 KAFARQHDRKRH 472

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 5/72 (6%)

Query: 706 NKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH--LNKKI 761
           N  Y C EC + F+    L+ H  ++H+G+KP+ C  P C K+F  + ++L+H  L+ K 
Sbjct: 301 NSKYRCAECGKAFARPSSLSTHM-NIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLKT 359

Query: 762 PCISNETTVDAP 773
           P +  ++   +P
Sbjct: 360 PKVKAKSRTRSP 371

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 714 CQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 760
           CQ+ F   H L RHKKS    EK +SC  CGK+F   D +++H  +K
Sbjct: 730 CQKAFVRNHDLLRHKKS--HLEKGYSCAGCGKKFHSEDSLVKHQERK 774

>Scas_720.39
          Length = 1455

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/224 (19%), Positives = 78/224 (34%), Gaps = 63/224 (28%)

Query: 184 GADTPGSIFPE----GLNV------WNVAKLP----NILDHMETKVPGVNDSYLYAGLWK 229
             D P +I+P      LN+      W +  +P    ++L +++  +     +    G++ 
Sbjct: 474 ALDLPSTIYPAETKFKLNIQEYNNPWRLENIPLSEDSLLRYLDLDLGCNTRTKFDIGMFL 533

Query: 230 ASFSWHLEDQDLYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFL---- 285
           +   W + D  L SI+Y H G+ K WY +  +D  K    M+    E  K   + L    
Sbjct: 534 SVAGWSVTDNFLPSIDYHHMGSSKLWYVVSPKDLEKLEALMKNVDTEIEKTQTQMLASIS 593

Query: 286 ------RHKMFLA---------------------------------------SPKLLQEN 300
                   + F+A                                       +   L++N
Sbjct: 594 LNDNFKESEFFIAYDMTKQTNFSIQTSADFRKDLSLTKENNFEQPSKPASLFTTAFLKKN 653

Query: 301 GIRCNEIVHHEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWL 344
           GI    +    G ++ TYP  Y +    G  L++   FA + WL
Sbjct: 654 GIEVRTVSQDSGSYIFTYPKTYTSYIGAGVYLSQHATFAPKSWL 697

>Kwal_56.23925
          Length = 745

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 6/63 (9%)

Query: 705 KNKIYIC--KECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIP 762
           +++ Y C  + C + F   H L RHKK+    EK + CP CGK+F R D +L H ++ I 
Sbjct: 611 EDRPYFCDFEGCHKAFVRNHDLIRHKKT--HAEKCYVCP-CGKKFVREDALLVHRSRMI- 666

Query: 763 CIS 765
           C+ 
Sbjct: 667 CVG 669

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 756
           + C+ C R F    H  RH ++ H+GEKPH C  P C K F R D + +H
Sbjct: 20  FRCEICSRGFHRLEHKKRHFRT-HTGEKPHKCKFPSCPKSFSRADELKRH 68

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 4/54 (7%)

Query: 714 CQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCISNE 767
           C + F   H L RHKK+    EK  +CP CGK+F R D +L H  + I C+  +
Sbjct: 711 CTKAFVRNHDLIRHKKT--HAEKTFTCP-CGKKFSREDALLTHRTRMI-CVGGK 760

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 684 KEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKC 743
           K+ G S LN     ++        +Y C  C +KF+  ++L  H +S H+ E+P+ C  C
Sbjct: 444 KDNGESTLNLIGTTKKKQAQKHPAVYACDICDKKFTRPYNLKSHLRS-HTDERPYVCSVC 502

Query: 744 GKRFKR 749
           GK F R
Sbjct: 503 GKAFAR 508

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 12/67 (17%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP---------KCGKRFKRRDHVLQHLNK 759
           Y+C  C + F+  H   RH+  +H+G++ + C           CGK+F R D + +H   
Sbjct: 497 YVCSVCGKAFARMHDKNRHED-LHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRHFKT 555

Query: 760 KI--PCI 764
           ++   CI
Sbjct: 556 ELGKKCI 562

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 687 GSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKR 746
            S+P+ S   P     S    I+ C+ C++ F     L RH  S HS ++   CP C  R
Sbjct: 326 SSNPVASNLVPAPS--SDHKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSR 382

Query: 747 FKRRDHVLQHLNKK 760
            KR+D++LQH+  K
Sbjct: 383 QKRKDNLLQHMKLK 396

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 8/69 (11%)

Query: 691 LNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFK 748
           L  +F P+        + + C+ C R F    H  RH ++ H+GEKPH C    C K F 
Sbjct: 4   LRDRFPPDN-----DQRPFRCEICSRGFHRLEHKKRHGRT-HTGEKPHKCTVQGCPKSFS 57

Query: 749 RRDHVLQHL 757
           R D + +HL
Sbjct: 58  RSDELKRHL 66

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           Y+C+ C + FS  ++L  H ++ H+ EKP+ C  CGK F R+    +H
Sbjct: 521 YVCEVCGKVFSRPYNLKSHLRT-HTDEKPYQCSICGKAFARQHDKKRH 567

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 10/60 (16%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP---------KCGKRFKRRDHVLQHL 757
           K Y C  C + F+  H   RH + +H+G+K + C           CGK+F R D + +H 
Sbjct: 547 KPYQCSICGKAFARQHDKKRH-EDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRHF 605

>Scas_717.60d
          Length = 167

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 699 EIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           EI+ S  N+++ CKEC + F +   L +H K  HS         CGK FKR+D    H
Sbjct: 91  EILTS--NELFNCKECSKAFVTSQKLKKHTKDAHSKRMFPCEYNCGKAFKRKDQRKSH 146

>Scas_720.33
          Length = 316

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 707 KIYIC---KECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           K + C   K+C   F+   HL RH +  H+GEKP  C  C + F R D++ QH
Sbjct: 13  KTFACQGYKDCHMTFTREEHLARHIRK-HTGEKPFQCYICFRFFSRMDNLKQH 64

>KLLA0C16203g complement(1414169..1418533) weakly similar to
           sp|Q03214 Saccharomyces cerevisiae YMR176w ECM5 involved
           in cell wall biogenesis and architecture singleton,
           start by similarity
          Length = 1454

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/199 (19%), Positives = 76/199 (38%), Gaps = 50/199 (25%)

Query: 196 LNVWNVAKL----PNILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQDLYSINYIHFGA 251
           ++ WN+  +     ++L + +     +    +  G+  ++  W LED+ L  +++ + G+
Sbjct: 535 IDAWNLNTINLSEKSLLQYQDLDFGNLAGGKIDVGMMLSTSGWALEDEFLPLLDFSYLGS 594

Query: 252 PKQWYSIP---------------------QEDRFK--------FYKFMQEQFPEEAKNCP 282
            K WY +P                       D+F+        F  F +  F ++ K   
Sbjct: 595 SKVWYFVPPQYRNSLEALFDDIRNKKEVKSSDQFEADFTESDFFQSFQETNFLDQHKTSR 654

Query: 283 EFLRHKMFL-----------------ASPKLLQENGIRCNEIVHHEGEFMITYPYGYHAG 325
           +   + MFL                  S   L  + IR  +++     F++ YP  Y   
Sbjct: 655 KRSINHMFLKNLVQDKHNSYTPNDFQISTSELSASHIRYFKVIQDPKTFIMKYPQVYSTS 714

Query: 326 FNYGYNLAESVNFALEEWL 344
            + G+ ++E   FA EEW+
Sbjct: 715 ISSGFQISEKSLFAPEEWV 733

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 6/72 (8%)

Query: 705 KNKIYICK--ECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIP 762
           +++ Y C    C + F   H L RHKK+    EK ++CP CGK F R D +  H ++ I 
Sbjct: 582 EDRPYRCDYDGCDKAFVRNHDLVRHKKTHQ--EKSYACP-CGKMFNREDALAVHRSRMI- 637

Query: 763 CISNETTVDAPI 774
           CI  +   +  I
Sbjct: 638 CIGGKKYANVVI 649

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 700 IVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRF 747
           + +  K K Y CK C+R FSS   L +H ++ HSGEKP+ C  C K+F
Sbjct: 759 LKVHSKYKPYKCKTCKRCFSSEETLVQHTRT-HSGEKPYKCHICNKKF 805

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 8/69 (11%)

Query: 695 FAPEEIVL------SGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFK 748
           F+ EE ++      SG+ K Y C  C +KF+    L  H ++ H+GEKP  C  CGKRF 
Sbjct: 777 FSSEETLVQHTRTHSGE-KPYKCHICNKKFAISSSLKIHIRT-HTGEKPLQCKICGKRFN 834

Query: 749 RRDHVLQHL 757
              ++ +H+
Sbjct: 835 ESSNLSKHI 843

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 3/61 (4%)

Query: 698 EEIVLSGKNKIYIC--KECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQ 755
           E + L+     Y C   +C R F     L RH K VHS  KP+ C  C + F   + ++Q
Sbjct: 727 EAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLK-VHSKYKPYKCKTCKRCFSSEETLVQ 785

Query: 756 H 756
           H
Sbjct: 786 H 786

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 8/58 (13%)

Query: 705 KNKIYIC-KECQRKFSSGHHLTRHKKSVHSGEKPHSCPK--CGKRFKRRDHVLQHLNK 759
           KN+ +IC + C R  +   HL     S+H+G+KP+ CPK  C KRF  + ++L+H  +
Sbjct: 340 KNQCHICGRICSRPSTLQTHL-----SIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKR 392

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 714 CQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           C+  FS   HL RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 33  CEMSFSRAEHLARHIRR-HTGEKPFKCDICLKYFSRIDNLKQH 74

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 36/69 (52%), Gaps = 2/69 (2%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLN-KKIPCISNE 767
           Y C  C+++F     L RH  S HS  K   CP C    KR+D++LQHL  K    + +E
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHE 364

Query: 768 TTVDAPIMN 776
            T+   +MN
Sbjct: 365 FTLFGILMN 373

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 713 ECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           +C   F+   HL RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 26  DCNMSFNRTEHLARHIRK-HTGEKPFQCNICLKFFSRIDNLRQH 68

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 37/71 (52%), Gaps = 2/71 (2%)

Query: 698 EEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           E+I +S     + C  C + F     L RH  S HS ++   CP C  R KRRD++LQH+
Sbjct: 523 EKIEVSSLAFPHRCHLCPKLFKRKSWLKRHLLS-HSQQRHFLCPWCNSRHKRRDNLLQHM 581

Query: 758 N-KKIPCISNE 767
             K +P +  E
Sbjct: 582 KLKHVPNLLQE 592

>Kwal_23.5400
          Length = 429

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%)

Query: 714 CQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           C + FS    LT H++ VH G KP  C  C ++F R+ H+ +H+
Sbjct: 57  CSKAFSRPSQLTEHQEVVHQGIKPFQCTVCARQFSRKTHLERHM 100

 Score = 36.2 bits (82), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 698 EEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           +E+V  G  K + C  C R+FS   HL RH  S HS +KP  C  CGK    +  + +H
Sbjct: 71  QEVVHQG-IKPFQCTVCARQFSRKTHLERHMFS-HSEDKPFKCSYCGKGVTTKQQLRRH 127

>KLLA0C16005g 1397274..1398269 some similarities with sgd|S0006151
           Saccharomyces cerevisiae YPL230w USV1, hypothetical
           start
          Length = 331

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 4/55 (7%)

Query: 706 NKIYICK---ECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           NK + C+   +C+ +F+   HL RH +  H+GE+P  C  C + F R D++ QH+
Sbjct: 17  NKSFKCQGFGDCRMEFTRQEHLARHIRK-HTGEQPFQCHLCLRFFSRLDNLKQHV 70

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           + C  C+++FS+   L  H ++ H+GEKP SC  CGKRF    ++ +H+
Sbjct: 572 FHCHYCRKQFSTSSSLRVHIRT-HTGEKPLSCTVCGKRFNESSNLSKHM 619

 Score = 33.1 bits (74), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 7/70 (10%)

Query: 695 FAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKR----R 750
           FAP +   + ++K   C  C + FS+   L +H ++ HSGE+P  C  C K+F      R
Sbjct: 532 FAPHQ--GTHRHKPCSCPHCPKTFSTDDILAQHIRT-HSGERPFHCHYCRKQFSTSSSLR 588

Query: 751 DHVLQHLNKK 760
            H+  H  +K
Sbjct: 589 VHIRTHTGEK 598

>CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 or tr|Q03081
           Saccharomyces cerevisiae YPL038w MET31, hypothetical
           start
          Length = 223

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 69/148 (46%), Gaps = 18/148 (12%)

Query: 609 STPSTVSNLSTSVLGPLSDTNDIKTPHPERPNHKTANRILKKESPVETSKSNLILSKVAS 668
           S P+TVS  S  V   LSD       +  +    T + ++ +++ V +  S+    +   
Sbjct: 59  SVPTTVSTASLHVTPMLSDV------YKAKQEETTMSPVISEKNAVNSGDSD----RSVR 108

Query: 669 TRQEDSFTSRNDDLDKEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHK 728
            + E S T ++  + K+  + P +   + E+ V       + C +C  KF+    L RH+
Sbjct: 109 VKSEGSST-KSHKVVKKTSTKPKDKSKSEEDTVY------HYCSQCSLKFNRSSDLRRHE 161

Query: 729 KSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           ++ H    P+ C +CGK F R+D + +H
Sbjct: 162 RA-HLLVLPYICTQCGKGFARKDALKRH 188

>Scas_711.56
          Length = 832

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRF 747
           K + C  C++ FS+   L +H+++ HSGEKP  C  CGKRF
Sbjct: 724 KPFQCSICKKHFSNEETLKQHERT-HSGEKPFKCDICGKRF 763

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           K + C  C ++F+    L  H ++ H+GEKP  C  CGK F    ++ +H+
Sbjct: 752 KPFKCDICGKRFAISSSLKIHIRT-HTGEKPLHCKICGKAFNESSNLSKHM 801

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 5/59 (8%)

Query: 705 KNKIYICK--ECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKI 761
           +++ Y C    C + F   H L RHK S H+ +K + CP CGKRF R D ++ H ++ I
Sbjct: 629 QDRPYSCDFPGCTKAFVRNHDLIRHKIS-HNAKK-YICP-CGKRFNREDALMVHRSRMI 684

>Sklu_1527.1 YPL038W, Contig c1527 389-1006
          Length = 205

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 44/91 (48%), Gaps = 1/91 (1%)

Query: 666 VASTRQEDSFTSRNDDLDKEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLT 725
             +T+Q+D    +     + + +S      + E++    ++K Y C +C+  F     L 
Sbjct: 82  TVTTQQDDDIGIQQPRKKRHKSTSSSTEADSVEDVQQLNEDKKYQCDKCELVFRRSSDLR 141

Query: 726 RHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           RH+++ H    P+ C  CGK F R+D + +H
Sbjct: 142 RHERA-HLPILPNICSLCGKGFARKDALKRH 171

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 714 CQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           C + F+    L RH K VHSG KP  CP C K+F   D + QH+
Sbjct: 635 CSKSFTQRQKLLRHLK-VHSGYKPFKCPHCTKKFSTEDILQQHI 677

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 8/70 (11%)

Query: 694 KFAPEEIVL------SGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRF 747
           KF+ E+I+       SG+ + + C  C ++F++   L  H ++ H+GEKP  C  CGKRF
Sbjct: 666 KFSTEDILQQHIRTHSGE-RPFKCTYCTKQFATSSSLRIHIRT-HTGEKPLKCKICGKRF 723

Query: 748 KRRDHVLQHL 757
               ++ +H+
Sbjct: 724 NESSNLSKHM 733

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 39/87 (44%), Gaps = 13/87 (14%)

Query: 687 GSSPLNSKFAPEEIVLSGKNKIYI----------CKECQRKFSSGHHLTRHKKSVHSGEK 736
           G  P    +  ++   S   +I+I          CK C ++F+   +L++H K   + E+
Sbjct: 682 GERPFKCTYCTKQFATSSSLRIHIRTHTGEKPLKCKICGKRFNESSNLSKHMK---THER 738

Query: 737 PHSCPKCGKRFKRRDHVLQHLNKKIPC 763
            + C KC + F + + +  H N+   C
Sbjct: 739 KYKCEKCKRSFNQLEQLRLHQNRCSHC 765

>AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -
           SH] complement(178780..180009) [1230 bp, 409 aa]
          Length = 409

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 714 CQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNK--KIPCISN 766
           C R F+   HL RH +   +GEKP  C  C + F R D++ QH      IP IS 
Sbjct: 28  CDRSFTRAEHLARHIRK-QTGEKPSQCEVCNRFFSRIDNLKQHRESVHSIPTIST 81

>CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 189

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLN 758
           KIY C  C   +     L +H+++ H  ++ + C  CGK+F R+D + +H +
Sbjct: 118 KIYPCNICGISYDKLTDLRKHERASHEPKQENVCMNCGKKFARKDALKRHFD 169

>Kwal_14.2206
          Length = 254

 Score = 38.5 bits (88), Expect = 0.012,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 711 CKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 756
           C+ C + FS    L+ H   +H+G +P++C  P CGKRF  + ++++H
Sbjct: 196 CRICGKTFSRPSGLSTHAL-IHTGHQPYACDAPNCGKRFNVKSNLMRH 242

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 10/58 (17%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP---------KCGKRFKRRDHVLQHL 757
           +IC  C + F+  H   RH + +H+G+K + C           CGK+F R D + +H 
Sbjct: 597 FICSICGKAFARQHDRKRH-EDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHF 653

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           + C  C +KF+  ++L  H ++ H+ E+P  C  CGK F R+    +H
Sbjct: 569 FACDVCGKKFTRPYNLKSHLRT-HTNERPFICSICGKAFARQHDRKRH 615

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 707 KIYICK--ECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           K Y+C+   C + F+    LT H+ +VH G KP  C +C   F ++ H+ +HL
Sbjct: 34  KTYLCEYDNCDKAFTRPSLLTEHQNTVHLGRKPWKCNQCESSFTKKIHLERHL 86

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query: 711 CKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           C +C+  F+   HL RH  + H+ E+P  C  CGK    R  + +H
Sbjct: 69  CNQCESSFTKKIHLERHLYT-HTDERPFYCSFCGKGLITRQQLKRH 113

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 6/57 (10%)

Query: 705 KNKIYIC--KECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNK 759
           ++K Y C  + C + F   H L RHKK   + +K  SCP CGK+F     +++H N+
Sbjct: 549 EDKPYKCDFEGCTKAFVRNHDLARHKK---THDKHFSCP-CGKKFSSEQSMMKHKNR 601

>Sklu_2398.2 , Contig c2398 2210-3076 reverse complement
          Length = 288

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 69/181 (38%), Gaps = 46/181 (25%)

Query: 582 NISRESSRSPIALNYE---ARQQHSQQHSFSTPSTVSNLSTSVLGPLSDTNDIKTPHPER 638
           N+S E S+SP   NY     + Q++    F TP   + LS  + GP              
Sbjct: 126 NMSAELSKSPYTFNYRKMSEQLQNTLDTVFPTPKLCTTLSLPLDGP-------------- 171

Query: 639 PNHKTANRILKKESPVETSKSNLILSKVASTRQEDSFTSRNDDLDKEQGSSPLNSKFAPE 698
                     ++ +PVE  +S                TS  D L   +GS   +    P 
Sbjct: 172 ---------TREVTPVERDRS----------------TSAPDLLIASKGSQQHSGPLCPV 206

Query: 699 EIVLSGKNKI-YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQ 755
                 + K+ ++C EC + F     L  H   +H G  P++C    C KRF  + ++L+
Sbjct: 207 VSEAPARPKLQHLCPECGKSFRRPSALKTHSI-IHVGRSPYACTWNGCSKRFNVKGNLLR 265

Query: 756 H 756
           H
Sbjct: 266 H 266

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           + Y C++C R F+   HL RH  S HS  KP SC  CGK    R  + +H
Sbjct: 148 RAYQCEQCGRGFTKKSHLERHLFS-HSETKPFSCTVCGKGVTTRQQLRRH 196

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 698 EEIVLSGKNKIYIC--KECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQ 755
           E    S + K + C  + C + F+    LT H+++ H G + + C +CG+ F ++ H+ +
Sbjct: 108 ESTASSTRRKTHYCDYEGCYKAFTRPSLLTEHQQTAHQGIRAYQCEQCGRGFTKKSHLER 167

Query: 756 HL 757
           HL
Sbjct: 168 HL 169

>Kwal_14.2543
          Length = 711

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           K Y C  C + F++   L  H ++ H+GEKP  C  CGKRF    ++ +H+
Sbjct: 632 KPYKCSHCGKGFATSSSLRIHIRT-HTGEKPLECKVCGKRFNESSNLSKHM 681

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 711 CKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKR----RDHVLQHLNKK 760
           C  C + FS+   L +H ++ HSGEKP+ C  CGK F      R H+  H  +K
Sbjct: 608 CVHCLKTFSTQDILQQHMRT-HSGEKPYKCSHCGKGFATSSSLRIHIRTHTGEK 660

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 707 KIYICK--ECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           K Y C    C + F+    LT H+ SVH G +   C KC K F ++ H+ +HL
Sbjct: 47  KTYFCDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHL 99

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           + + C +C + F    HL RH  + HS  KP  C  CGK    R  + +H
Sbjct: 78  RAFQCDKCAKSFVKKSHLERHLYT-HSDTKPFQCSYCGKGVTTRQQLKRH 126

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           + C  C + +S+   L  H ++ H+GEKP SCP C KRF    ++ +H+
Sbjct: 720 FKCHLCPKSYSTSSSLRIHIRT-HTGEKPLSCPICNKRFNESSNLAKHI 767

 Score = 37.4 bits (85), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 714 CQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           C + F     L RH K VHS  KP  C +CGK F  +D + QHL
Sbjct: 669 CNKVFVQKQKLIRHLK-VHSKYKPFRCAECGKCFNTQDILTQHL 711

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 5/63 (7%)

Query: 702 LSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKR----RDHVLQHL 757
           +  K K + C EC + F++   LT+H + VHSGE+P  C  C K +      R H+  H 
Sbjct: 685 VHSKYKPFRCAECGKCFNTQDILTQHLR-VHSGERPFKCHLCPKSYSTSSSLRIHIRTHT 743

Query: 758 NKK 760
            +K
Sbjct: 744 GEK 746

>Scas_695.2
          Length = 571

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           Y C+ C + F+  ++L  H ++ H+ E P  C  CGK F R+    +H
Sbjct: 452 YACELCDKTFTRPYNLKSHLRT-HTNEXPFVCNICGKAFARQHDRKRH 498

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 10/58 (17%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP---------KCGKRFKRRDHVLQHL 757
           ++C  C + F+  H   RH + +H+G+K + C           C K+F R D + +H 
Sbjct: 480 FVCNICGKAFARQHDRKRH-EDLHTGKKRYVCGGVLKNGTPWGCHKKFARSDALGRHF 536

>Scas_721.56
          Length = 199

 Score = 37.0 bits (84), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 704 GKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           G    + C +C+  F     L RH+K+ H    P+ C +CGK F R+D + ++ 
Sbjct: 110 GSRTGFQCNKCELYFIRSSDLRRHEKT-HLSILPNICSQCGKGFARKDALKRYF 162

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 5/61 (8%)

Query: 701 VLSGK--NKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQH 756
           V+ GK   K  IC +C ++F+    L  H   VHSG+KP  C    C K+F  + ++++H
Sbjct: 222 VVKGKANGKADICAQCGKQFTRPSALRTHML-VHSGDKPFECTWEGCNKKFNVKSNLIRH 280

Query: 757 L 757
           L
Sbjct: 281 L 281

>Kwal_27.10467
          Length = 302

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQH 756
           Y C +C + F+    L  H  + H+G+KP+ CP   C K+F  R ++ +H
Sbjct: 198 YTCTKCGKVFNRPSSLATHNNT-HTGDKPYCCPFDNCDKQFNARSNMTRH 246

>Kwal_47.16577
          Length = 881

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 714 CQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQHLNKKI 761
           C + FS   HL RHK + HS EK + C  P CG+ F R D   +H  + +
Sbjct: 20  CSKSFSRSDHLGRHKAN-HSSEK-YKCEWPACGREFSRLDVKKKHFGRHL 67

>Scas_631.7
          Length = 433

 Score = 37.0 bits (84), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 707 KIYICK--ECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           K Y C    C + F+    L+ H+ + H G KP  C +C K+F R+ H+ +HL
Sbjct: 55  KNYFCDYSGCTKAFTRPSLLSEHQLTFHQGIKPFKCEQCDKQFSRKTHLERHL 107

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           + C++C ++FS   HL RH  S HS  KP  C  CGK    R  + +H
Sbjct: 88  FKCEQCDKQFSRKTHLERHLIS-HSDSKPFCCLHCGKGVTTRQQLKRH 134

>CAGL0I02838g complement(248704..250671) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 655

 Score = 37.0 bits (84), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGK 745
           K + C+ C R F+   HL  H +S H G+KP+ C  CGK
Sbjct: 612 KQFECQYCHRCFAQVTHLDVHIRS-HLGKKPYQCEYCGK 649

>CAGL0E03762g complement(351003..352757) weakly similar to sp|P33400
           Saccharomyces cerevisiae YHL027w RIM101 meiotic
           regulatory protein, hypothetical start
          Length = 584

 Score = 37.0 bits (84), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 35/73 (47%), Gaps = 7/73 (9%)

Query: 703 SGKNKIYICK--ECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 760
           S KN    C+   C  K     H+T H + VH   KP +C  C KRFKR   + +HL   
Sbjct: 183 SQKNLQLKCQWDNCTSKTEKRDHMTSHLR-VHVPLKPFACSTCSKRFKRPQDLKKHLKIH 241

Query: 761 IPCISNETTVDAP 773
           +    ++  +DAP
Sbjct: 242 L----SDLGIDAP 250

>KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyces
           lactis RIM101 homologue, start by similarity
          Length = 517

 Score = 36.2 bits (82), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 703 SGKNKIYICK--ECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           S KN    C+  +CQ K     H+T H + VH   KP +C  C K+FKR   + +HL
Sbjct: 141 SQKNLQLNCQWGDCQTKTVKRDHITSHLR-VHVQLKPFACSTCNKKFKRPQDLKKHL 196

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 714 CQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           C  K     H+T H + VH   KP  C  CGK+FKR   + +HL
Sbjct: 95  CNTKTVKRDHITSHLR-VHVPLKPFGCSTCGKKFKRPQDLKKHL 137

>Scas_718.67
          Length = 473

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 18/79 (22%)

Query: 700 IVLSGKNKIYICK--------ECQRKFSSGHHLTRHKKSVHSGEKP-HSCPKC------- 743
           I  S  ++ Y C+         C  +FS  + LTRH+ ++H+ +K    C +C       
Sbjct: 370 ITESSTDETYTCRIINLTTNEPCCAQFSRSYDLTRHQNTIHASKKTVFRCSECIKSLGNE 429

Query: 744 --GKRFKRRDHVLQHLNKK 760
              K F R D + +H+  K
Sbjct: 430 GYDKTFSRLDALTRHIKSK 448

>Scas_718.36d
          Length = 330

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQH 756
           Y C  C + F     L  H  ++ SG +P+ CP   C K F  + ++L+H
Sbjct: 239 YFCDVCGKGFRRPSSLRTHS-NIRSGNRPYKCPYSNCTKSFNAKSNMLRH 287

>Kwal_27.11824
          Length = 199

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLN 758
           K + C +C+  F     L RH+++ H    P+ C  CGK F R+D + +H +
Sbjct: 117 KKFPCAKCELVFRRSSDLRRHERA-HLPILPNICSLCGKGFARKDALKRHFD 167

>YDL020C (RPN4) [840] chr4 complement(415110..416705) Subunit of the
           regulatory particle of the proteasome, also binds DNA to
           act as a positive regulator of expression of many
           proteasome subunit genes, functions in RNA polymerase II
           transcription elongation [1596 bp, 531 aa]
          Length = 531

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 18/75 (24%)

Query: 704 GKNKIYICK--------ECQRKFSSGHHLTRHKKSVHSGEK-PHSCPKC---------GK 745
           G N+I+ C+         C  +FS  + LTRH+ ++H+  K    C +C          K
Sbjct: 432 GNNEIFTCQIMNLITNEPCGAQFSRSYDLTRHQNTIHAKRKIVFRCSECIKILGSEGYQK 491

Query: 746 RFKRRDHVLQHLNKK 760
            F R D + +H+  K
Sbjct: 492 TFSRLDALTRHIKSK 506

>CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces
           cerevisiae YPL230w USV1, hypothetical start
          Length = 388

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 718 FSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           F+   H  RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 3   FTRAEHHARHIRK-HTGEKPFQCDICMKFFSRIDNLKQH 40

>KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 289

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 57/136 (41%), Gaps = 25/136 (18%)

Query: 625 LSDTNDIKTPHPERPNHKTANRILKKESPVETSKSNLILSKVASTRQEDSFTSRNDDLDK 684
           LS +ND  T H  R + +  NR  K++ P +   S    + +    ++ +  S N DLD 
Sbjct: 144 LSHSND--TYHQRRASTELENRSKKRKLPSKKILSGSSDTAIVPYDRDSTDGSNNADLD- 200

Query: 685 EQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCG 744
                                +K + C++C   F     L RH++  H    P+ C  CG
Sbjct: 201 ---------------------DKRFPCEKCHMVFRRSSDLRRHERQ-HLPILPNICTLCG 238

Query: 745 KRFKRRDHVLQHLNKK 760
           K F R+D + +H + +
Sbjct: 239 KGFARKDALKRHFDTQ 254

>Scas_627.6
          Length = 1207

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 11/58 (18%)

Query: 709 YICK--ECQRKFSSGHHLTRHKKSVHSGEKPHSCP--------KCGKRFKRRDHVLQH 756
           YIC   +C + F+   HL+RHK + H  ++   CP         C K F R+D +++H
Sbjct: 42  YICPHPDCNKSFTRQEHLSRHKLN-HWPKEIFVCPFIFPNTNITCNKTFVRKDLLIRH 98

>Scas_660.12
          Length = 367

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 29/64 (45%), Gaps = 13/64 (20%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP----------KCGKR--FKRRDHVLQH 756
           Y+C  CQ KF    +LTRH K  H+ EK + CP          +C     F RRD    H
Sbjct: 96  YVCHYCQAKFRIKGYLTRHIKK-HAVEKAYHCPFFSTESPPELRCHNSGGFSRRDTYKTH 154

Query: 757 LNKK 760
           L  +
Sbjct: 155 LKAR 158

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 60/138 (43%), Gaps = 10/138 (7%)

Query: 621 VLGPLSDTNDIKTPHPERPNHKTANRILKKESPVETSKSNLILSKVASTRQEDSFTSRND 680
           +LG L    ++  P PE    K + ++L    P     S++ L ++          +   
Sbjct: 135 LLGVLQGNLEMVPPTPETYFFKPSPKLL----PEHIEFSSIKLERLTGEEAPLCCITEGT 190

Query: 681 DLDKEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSC 740
            LD++   +   ++F P +  +S     Y C +C+++F     L  H   +H G  P  C
Sbjct: 191 FLDQDWKLNKECNRFPPRKKRVS---YTYCCPKCKKEFKRPSGLRTHM-VIHYGRNPFFC 246

Query: 741 --PKCGKRFKRRDHVLQH 756
             P C K+F  + ++L+H
Sbjct: 247 KWPNCSKKFNVKSNLLRH 264

>YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor
           involved in sulfite metabolism, has five C2H2-type zinc
           fingers [900 bp, 299 aa]
          Length = 299

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 707 KIYICKE--CQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLN 758
           K Y C E  C +KF    HL  HK + HS  KP +C  C KRF     + +HLN
Sbjct: 40  KPYHCDEPGCGKKFIRPCHLRVHKWT-HSQIKPKACTLCQKRFVTNQQLRRHLN 92

>Scas_604.4
          Length = 585

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 714 CQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           C  K     H+T H + VH   KP +C KC K+FKR   + +HL
Sbjct: 224 CFTKTVKRDHITSHLR-VHVPLKPFACKKCTKKFKRPQDLKKHL 266

>KLLA0B00286g complement(15257..16666)
           gi|1709726|sp|P52289|PPA5_KLULA Kluyveromyces lactis
           REPRESSIBLE ACID PHOSPHATASE PRECURSOR, start by
           similarity
          Length = 469

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 51/121 (42%), Gaps = 26/121 (21%)

Query: 125 VSKSTKLKLKNFESSFNIDDFEQFRTEYTIDLSDFQNTERLKFLEEYYWKTLNFTTPMYG 184
           +S S    ++ F S+  + D     TEY++D  DFQN ++L ++           TPM  
Sbjct: 335 LSFSHDTDIQQFISALGLID--NGVTEYSLDQVDFQNIQQLSWV-----------TPM-- 379

Query: 185 ADTPGSIFPEGLNVWNVAKLPNILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQDLYSI 244
               G IF E L   N + +  I++ +   VPG              FS  +ED D Y  
Sbjct: 380 ---GGRIFTEKLKCGNASYVRYIINDVIIPVPGCTSG--------PGFSCPIEDFDDYIT 428

Query: 245 N 245
           N
Sbjct: 429 N 429

>YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription factor
           involved in regulating transcription of amino acid
           permease genes and involved in pre-tRNA splicing of
           specific tRNA species, has three C2H2-type zinc fingers
           [1560 bp, 519 aa]
          Length = 519

 Score = 33.9 bits (76), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 39/88 (44%), Gaps = 16/88 (18%)

Query: 688 SSPLN-SKFAPEEI--VLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP--- 741
           SSPL+ S   PE    VL+   + +IC  C   F    +LTRH K  H+ EK + CP   
Sbjct: 136 SSPLSPSGSTPEHSTKVLNNGEEEFICHYCDATFRIRGYLTRHIKK-HAIEKAYHCPFFN 194

Query: 742 -------KC--GKRFKRRDHVLQHLNKK 760
                  +C     F RRD    HL  +
Sbjct: 195 SATPPDLRCHNSGGFSRRDTYKTHLKAR 222

>AFR301C [3493] [Homologous to ScYIL159W (BNR1) - SH]
           (981215..986182) [4968 bp, 1655 aa]
          Length = 1655

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 61/132 (46%), Gaps = 12/132 (9%)

Query: 543 LLYISNKNISGISHSAPHSPVN--PNISLIKRVKSPNIVTLNISRESSRSPIALNYEARQ 600
            L+   KN +G+    PHS V+  P+++  KRV    ++T N SR S   P  +      
Sbjct: 575 FLFAQLKNGNGL----PHSNVSRTPSLTRSKRVSYSALLTENQSRRSFSGPEGITTSEND 630

Query: 601 QHSQQHSFSTPSTVSNLSTSVLGPLSDTN--DIKTPHPERPNHKTANRILKKESPVETSK 658
                H+F + S     ST + G +S  N  D+++    RP H T+ R     +  +T+K
Sbjct: 631 NPRADHTFGSQSHRRTHSTMLSGAVSPINLADLES----RPLHVTSPRPTLASNKSKTTK 686

Query: 659 SNLILSKVASTR 670
              +   +A+TR
Sbjct: 687 PQKLGKDIATTR 698

>CAGL0E04312g 412563..414629 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 or sp|P38704
           Saccharomyces cerevisiae YHR006w SPT2, hypothetical
           start
          Length = 688

 Score = 33.9 bits (76), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 30/72 (41%), Gaps = 13/72 (18%)

Query: 701 VLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP----------KC--GKRFK 748
            L    K ++C  C  KF    +LTRH K  H+ EK + CP          +C     F 
Sbjct: 190 TLDDDEKEFVCHYCDAKFRIRGYLTRHIKK-HAIEKAYHCPFYNGQEVPSKRCHNSGGFS 248

Query: 749 RRDHVLQHLNKK 760
           RRD    H+  +
Sbjct: 249 RRDTYKTHMKAR 260

>Scas_641.24
          Length = 532

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 28/64 (43%), Gaps = 13/64 (20%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP----------KCGKR--FKRRDHVLQH 756
           +IC  C  KF    +LTRH K  H+ EK + CP          +C     F RRD    H
Sbjct: 183 FICHYCDAKFRIRGYLTRHIKK-HAVEKAYHCPFFNSDILSESRCHNTGGFSRRDTYKTH 241

Query: 757 LNKK 760
           L  +
Sbjct: 242 LKAR 245

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 709 YICKE--CQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756
           ++C+E  C + F    HL  HK S HS  KP +CP C K F     + +H
Sbjct: 38  FVCEEPGCGKGFLRASHLKVHKWS-HSQVKPLACPVCSKGFTTNQQLSRH 86

>YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor
           involved in induction of IME1, IME2, DIT1, and DIT2
           transcription, has three C2H2-type zinc fingers [1878
           bp, 625 aa]
          Length = 625

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 713 ECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           +C  K     H+T H + VH   KP  C  C K+FKR   + +HL
Sbjct: 188 DCTTKTEKRDHITSHLR-VHVPLKPFGCSTCSKKFKRPQDLKKHL 231

>Kwal_56.22497
          Length = 280

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 56/140 (40%), Gaps = 17/140 (12%)

Query: 591 PIALNYEARQQHSQQHSFSTPSTVSNLSTS--VLG---PLSDTNDIKTPHPERPNHKTAN 645
           PI  N      +S   S S PS V +L  +   LG   P     +I  P  E   H +  
Sbjct: 14  PIVNNSIKDFLNSHLQSISLPSYVGSLRVTDFCLGCTPPKITLREISNPLEEFYEHISNE 73

Query: 646 RILKKESPVETSKSNLILSKVASTRQEDSFTSRNDDLDKEQGSSPLNSKFAPEEIVLSGK 705
           R+  +   +E S SNL        R ED F   NDD  K++  S  + +F   EI   G 
Sbjct: 74  RLADE---IEASSSNL--------RGEDHFHGENDDSGKDEKDSDSDLQFLV-EIDYKGD 121

Query: 706 NKIYICKECQRKFSSGHHLT 725
             I +  E    + S H +T
Sbjct: 122 MLITVSAELALNYPSPHFMT 141

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 32.7 bits (73), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 707 KIYIC--KECQRKFSSGHHLTRHKKSVHSGEKPHSCPK--CGKRFKRRDHVLQHL 757
           K Y+C  + C +K+S    L +H +S H+ EKP  CP+  C K F R  H+  H+
Sbjct: 6   KRYVCPIESCGKKYSRPCLLRQHVRS-HTNEKPFHCPEPGCDKAFLRPSHLRVHM 59

>Scas_713.11
          Length = 465

 Score = 33.1 bits (74), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 18/74 (24%)

Query: 705 KNKIYIC--------KECQRKFSSGHHLTRHKKSVHSGEK-PHSCPKC---------GKR 746
           +N IY C          C  +FS  + L RH+ ++H+ +K    C +C          K 
Sbjct: 366 ENDIYTCMMLDLITDAPCSAQFSRSYDLVRHQNTIHAKQKIVFHCLQCIKLFGERGFSKT 425

Query: 747 FKRRDHVLQHLNKK 760
           F R D + +HL  K
Sbjct: 426 FSRLDALSRHLKSK 439

>AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH]
           (783110..784408) [1299 bp, 432 aa]
          Length = 432

 Score = 33.1 bits (74), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 1/60 (1%)

Query: 714 CQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCISNETTVDAP 773
           C  K     H+T H + VH   KP SC  C ++FKR   + +HL   +     E +  AP
Sbjct: 113 CTTKTVKRDHITSHLR-VHVPLKPFSCSTCSRKFKRPQDLKKHLKVHMEDTMKERSRAAP 171

>CAGL0K01727g complement(152569..154068) similar to sp|Q03465
           Saccharomyces cerevisiae YDL020c, start by similarity
          Length = 499

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 15/72 (20%)

Query: 699 EIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKP-HSCPKC---------GKRFK 748
           E+V S  N++     C  +FS  + LTRH+ ++H+ ++    C +C          K F 
Sbjct: 408 ELVNSVTNEV-----CGAQFSRTYDLTRHQNTIHAKKRSIFRCSECIRALGDEGFQKTFS 462

Query: 749 RRDHVLQHLNKK 760
           R D + +H+  K
Sbjct: 463 RLDALTRHIKAK 474

>YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor
           involved in regulating transcription of amino acid
           permease genes, functions redundantly with Stp1p, which
           is involved in tRNA splicing and branched-chain amino
           acid uptake [1626 bp, 541 aa]
          Length = 541

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 13/64 (20%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP----------KC--GKRFKRRDHVLQH 756
           YIC  C  +F    +LTRH K  H+  K + CP          +C     F RRD    H
Sbjct: 204 YICHYCDARFRIRGYLTRHIKK-HAKRKAYHCPFFDNSISQELRCHTSGGFSRRDTYKTH 262

Query: 757 LNKK 760
           L  +
Sbjct: 263 LKSR 266

>ADL042W [1699] [Homologous to ScYPR015C - SH]
           complement(615818..616663) [846 bp, 281 aa]
          Length = 281

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 43/87 (49%), Gaps = 4/87 (4%)

Query: 675 FTSRNDDLDKEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSG 734
           FT+      +   +SPL+++  P       KN   +C+ C + F     L  H   VH+ 
Sbjct: 192 FTASQTPPQQPLLNSPLHTRKNPYRGSAYKKNG-SVCEICGKDFKRPSALRTHM-VVHNN 249

Query: 735 EKPHSCPK--CGKRFKRRDHVLQHLNK 759
           +KP++C    C KRF  + ++L+H+ K
Sbjct: 250 DKPYNCEHRGCQKRFNVKSNMLRHMRK 276

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 7/51 (13%)

Query: 713 ECQRKFSSGHHLTRHKKS-------VHSGEKPHSCPKCGKRFKRRDHVLQH 756
           EC + FS   HL+RHK +       V S   P +   C K F R+D +++H
Sbjct: 37  ECNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPCNKTFVRKDLLIRH 87

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 709 YICKE--CQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLN 758
           Y+C E  C ++F    HL  HK + H+  KP  C  C +RF     + +H N
Sbjct: 87  YVCDEPNCGKRFLRPCHLRVHKWT-HAQVKPLKCSYCERRFITNQQLKRHTN 137

>Sklu_2436.9 YDR463W, Contig c2436 18516-20069
          Length = 517

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 32/75 (42%), Gaps = 13/75 (17%)

Query: 698 EEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP----------KCGKR- 746
           EEI    +   Y+C  C  +F    +LTRH K  H+ EK + CP          +C    
Sbjct: 151 EEIDDEEQRGKYVCHYCDAEFRIRGYLTRHIKK-HAVEKAYHCPFFNSKLPPESRCHTTG 209

Query: 747 -FKRRDHVLQHLNKK 760
            F RRD    HL  +
Sbjct: 210 GFSRRDTYKTHLKSR 224

>Kwal_26.9300
          Length = 304

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 695 FAPEEIVLSGK--NKIYICKECQRKFSSGHHLTRHKKS-VHSGEKPHSCPKCGKRFKRRD 751
           F P +I +S K  +K    KEC    +   +L+ H+ S +    KPH CP CG+ F R +
Sbjct: 127 FTPLQIPVSSKPASKPRRKKECPICHNFYANLSTHRSSHLQPENKPHKCPVCGRGFTRHN 186

Query: 752 HVLQHLNK 759
            +L+H  +
Sbjct: 187 DLLRHRKR 194

>CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces
           cerevisiae YPR022c, hypothetical start
          Length = 1162

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 39/89 (43%), Gaps = 22/89 (24%)

Query: 714 CQRKFSSGHHLTRHKKSVHSGE-------KPHSCPKCGKRFKRRD----HVLQHLNK--- 759
           C + FS   HL+RHK +    E        P S   CGK F RRD    H  +H NK   
Sbjct: 52  CDKSFSRQEHLSRHKLNHWPKEIFKCHYVSPLSGQPCGKTFVRRDLLNRHEKRHENKSYT 111

Query: 760 --KIPCISNETT--VDAPIM----NPTVQ 780
             K   IS E T  + +P+     NP+ Q
Sbjct: 112 GRKSRSISREITPGITSPVAESPSNPSFQ 140

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 733 SGEKPHSCPKCGKRFKRRDHVLQH 756
           +GEKP+ C  C KRF R+ ++  H
Sbjct: 6   TGEKPYECDICKKRFSRKGNLAAH 29

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 707 KIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQHLNK 759
           K Y C  C+++FS   +L  HK + H   +P  C    C K F +  ++  H NK
Sbjct: 9   KPYECDICKKRFSRKGNLAAHKMT-HGKIRPFICKLDNCNKSFSQLGNMKSHQNK 62

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 711 CKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQHLN 758
           C  C R+ +    L  H   +H+GE P  C  P C KRF  R ++ +H+N
Sbjct: 260 CLVCGRRCTRPSTLKTHML-IHTGELPFQCSWPGCSKRFNVRSNMNRHVN 308

>Kwal_55.20634
          Length = 419

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 703 SGKNKIYICK--ECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           S KN    C+  +C  K     H+T H + VH   KP +C  C K FKR   + +HL
Sbjct: 86  SQKNLQLNCRWGKCTAKTVKRDHITSHLR-VHVPLKPFACSTCTKTFKRPQDLKKHL 141

>KLLA0F13442g complement(1244416..1246179) similar to sp|P39081
           Saccharomyces cerevisiae YDR228c PCF11 component of
           pre-mRNA 3 -end processing factor CF I singleton, start
           by similarity
          Length = 587

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 10/50 (20%)

Query: 736 KPHSCPKCGKRF----KRRDHVLQHL------NKKIPCISNETTVDAPIM 775
           KP+ C  CGKRF    + ++  +QHL      NKKI  I + TT    ++
Sbjct: 401 KPNKCSICGKRFGNTLEEKELEIQHLDWHFRVNKKIKGIQSNTTTSTKVI 450

>KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 pre-tRNA splicing
           protein, transcription factor, start by similarity
          Length = 623

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 13/64 (20%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP----------KCGKR--FKRRDHVLQH 756
           ++C  C  +F    +LTRH K  H+ EK + CP          +C     F RRD    H
Sbjct: 242 FVCHYCDAEFKMRGYLTRHIKK-HAIEKAYHCPFWDASLPSEKRCHSTGGFSRRDSYKTH 300

Query: 757 LNKK 760
           L  +
Sbjct: 301 LRSR 304

>Scas_591.8
          Length = 680

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 8/62 (12%)

Query: 230 ASFSWHLEDQDLYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLR-HK 288
           A+ SW     D       HFG  +   S    D FKF++F +E   E A+   EF +  K
Sbjct: 619 ATLSWGNYSHD-------HFGIDRFGVSGKGPDAFKFFEFTKEGVTERARKAMEFYKGRK 671

Query: 289 MF 290
           M+
Sbjct: 672 MY 673

>Kwal_33.14227
          Length = 551

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 10/57 (17%)

Query: 714 CQRKFSSGHHLTRHKKSVH-SGEKPHSCPKC---------GKRFKRRDHVLQHLNKK 760
           C +KFS  + L RH+K++H S +K   C  C          K F R D + +H+  K
Sbjct: 471 CSKKFSRPYDLIRHQKTIHASKKKVFRCVFCIQQQGAEGYQKTFSRGDALSRHIKVK 527

>AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH]
           (1269565..1271199) [1635 bp, 544 aa]
          Length = 544

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 13/64 (20%)

Query: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP----------KC--GKRFKRRDHVLQH 756
           ++C  C  +F    +LTRH K  H+ EK + CP          +C     F RRD    H
Sbjct: 152 FVCHYCDAEFRIRGYLTRHIKK-HAVEKAYHCPFFNSHVPPETRCHTTGGFSRRDTYKTH 210

Query: 757 LNKK 760
           L  +
Sbjct: 211 LRSR 214

>Scas_712.2
          Length = 327

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 709 YIC--KECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLN 758
           YIC  + C ++F    HL  HK + HS  KP  C  C K F     + +HLN
Sbjct: 43  YICDVEGCGKRFMRPCHLKVHKWT-HSKVKPLKCAFCEKGFITNQQLKRHLN 93

>Kwal_47.18337
          Length = 536

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 33/80 (41%), Gaps = 13/80 (16%)

Query: 693 SKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP----------K 742
           SK   EE       K ++C  C  +F    +LTRH K  H+ EK + CP          +
Sbjct: 141 SKTEDEEKDAHKGQKRFVCHYCNAEFYIRGYLTRHIKK-HAVEKAYYCPFFNADAPKDAR 199

Query: 743 CGKR--FKRRDHVLQHLNKK 760
           C     F RRD    HL  +
Sbjct: 200 CHTTGGFSRRDTYKTHLRSR 219

>CAGL0G05423g complement(511175..512911) similar to sp|P09932
           Saccharomyces cerevisiae YDL227c HO homothallic
           switching endonuclease, start by similarity
          Length = 578

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 6/55 (10%)

Query: 697 PEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRD 751
           P  I+L  K  +Y C EC    +   H+T+ K   H      SCP+ G R+  RD
Sbjct: 451 PRNILLGNKIVVYSCTECCE--TDAVHITKIKNLKHC----VSCPRTGVRYFYRD 499

>Sklu_2359.5 YPR022C, Contig c2359 10655-12818
          Length = 722

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 10/68 (14%)

Query: 698 EEIVLSGKNKIYICKE--CQRKFSSGHHLTRHKKSVHSGE-------KPHSCPKCGKRFK 748
           E +   GK + Y+C    C + F+   HL+RHK +    E        P     C + F 
Sbjct: 6   ETVQQQGKPR-YVCPHPNCSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFV 64

Query: 749 RRDHVLQH 756
           RRD +++H
Sbjct: 65  RRDLLVRH 72

>Kwal_27.10167
          Length = 285

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 706 NKIYICKE--CQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757
           N+ + C E  C ++F    H+  H+ + HS  KP  C +C K F  +  + +HL
Sbjct: 62  NRPFACPEPNCGKRFLRVCHMNVHRWT-HSKIKPLKCEECSKGFTTKQQLSRHL 114

>Scas_683.30
          Length = 478

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 6/60 (10%)

Query: 703 SGKNKIYICK-----ECQRKFSSGHHLTRHKKSVHSGE-KPHSCPKCGKRFKRRDHVLQH 756
           SG NK  + K     +C    +   +L+ HK +  + E +PH CP C + F R + +++H
Sbjct: 273 SGNNKGSVTKTRRKKQCPTCLNYYANLSTHKSTHLTPEDRPHKCPICERGFARNNDLIRH 332

>YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with strong
           similarity to Stp1p, which is involved in tRNA splicing
           and branched-chain amino acid uptake [1032 bp, 343 aa]
          Length = 343

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 711 CKECQRKFSSGHHLTRHKKSVHSGE-KPHSCPKCGKRFKRRDHVLQH 756
           C  C+  +++   LT HK +  + E +PH CP C + F R + +L+H
Sbjct: 144 CPICRNFYAN---LTTHKATHLTPEDRPHKCPICHRGFARNNDLLRH 187

>KLLA0C04103g complement(372753..374447) weakly similar to sp|Q03465
           Saccharomyces cerevisiae YDL020c SON1 26S proteasome
           subunit singleton, start by similarity
          Length = 564

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 10/57 (17%)

Query: 714 CQRKFSSGHHLTRHKKSVHSGEKP-HSCPKC---------GKRFKRRDHVLQHLNKK 760
           C +KFS  + L RH+K++H+ +K    C  C          + F R D + +H+  K
Sbjct: 484 CMKKFSRPYDLIRHQKTIHASKKKIFRCLICIQELGSEGYQRTFSRNDALSRHVKVK 540

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.131    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,346,462
Number of extensions: 1269735
Number of successful extensions: 4287
Number of sequences better than 10.0: 281
Number of HSP's gapped: 4190
Number of HSP's successfully gapped: 355
Length of query: 782
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 672
Effective length of database: 12,788,129
Effective search space: 8593622688
Effective search space used: 8593622688
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)