Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER168C (CCA1)54653728730.0
CAGL0L11858g53151017200.0
Scas_681.2054351217060.0
Sklu_1964.251950615710.0
Kwal_56.2346151950914560.0
KLLA0C17688g48951810981e-145
AGR118W5335059951e-129
Kwal_47.17635728103711.6
KLLA0E09328g21241672.9
Sklu_1792.321159663.5
AAL118C10760634.1
YPR122W (AXL1)120865675.1
CAGL0M11990g617726410.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER168C
         (537 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER168C (CCA1) [1596] chr5 complement(521024..522664) tRNA nucle...  1111   0.0  
CAGL0L11858g complement(1270455..1272050) similar to tr|Q9P4S5 S...   667   0.0  
Scas_681.20                                                           661   0.0  
Sklu_1964.2 YER168C, Contig c1964 2064-3623 reverse complement        609   0.0  
Kwal_56.23461                                                         565   0.0  
KLLA0C17688g complement(1565906..1567375) gi|9836828|gb|AAG00316...   427   e-145
AGR118W [4429] [Homologous to ScYER168C (CCA1) - SH] complement(...   387   e-129
Kwal_47.17635                                                          32   1.6  
KLLA0E09328g complement(831306..831944) highly similar to sgd|S0...    30   2.9  
Sklu_1792.3 YDR020C, Contig c1792 2698-3333                            30   3.5  
AAL118C [69] [Homologous to ScYOR265W (RBL2) - SH] (139715..1400...    29   4.1  
YPR122W (AXL1) [5543] chr16 (782039..785665) Protease involved i...    30   5.1  
CAGL0M11990g complement(1187859..1189712) similar to sp|P13365 S...    29   10.0 

>YER168C (CCA1) [1596] chr5 complement(521024..522664) tRNA
           nucleotidyltransferase (tRNA CCA-pyrophosphorylase),
           carries out addition of CCA to 3' end without a
           template, involved in Los1p-independent tRNA nuclear
           export [1641 bp, 546 aa]
          Length = 546

 Score = 1111 bits (2873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/537 (100%), Positives = 537/537 (100%)

Query: 1   MLRSTISLLMNSAAQKTMTNSNFVLNAPKITLTKVEQNICNLLNDYTDLYNQKYHNKPEP 60
           MLRSTISLLMNSAAQKTMTNSNFVLNAPKITLTKVEQNICNLLNDYTDLYNQKYHNKPEP
Sbjct: 1   MLRSTISLLMNSAAQKTMTNSNFVLNAPKITLTKVEQNICNLLNDYTDLYNQKYHNKPEP 60

Query: 61  LTLRITGGWVRDKLLGQGSHDLDIAINVMSGEQFATGLNEYLQQHYAKYGAKPHNIHKID 120
           LTLRITGGWVRDKLLGQGSHDLDIAINVMSGEQFATGLNEYLQQHYAKYGAKPHNIHKID
Sbjct: 61  LTLRITGGWVRDKLLGQGSHDLDIAINVMSGEQFATGLNEYLQQHYAKYGAKPHNIHKID 120

Query: 121 KNPEKSKHLETATTKLFGVEVDFVNLRSEKYTELSRIPKVCFGTPEEDALRRDATLNALF 180
           KNPEKSKHLETATTKLFGVEVDFVNLRSEKYTELSRIPKVCFGTPEEDALRRDATLNALF
Sbjct: 121 KNPEKSKHLETATTKLFGVEVDFVNLRSEKYTELSRIPKVCFGTPEEDALRRDATLNALF 180

Query: 181 YNIHKGEVEDFTKRGLQDLKDGVLRTPLPAKQTFLDDPLRVLRLIRFASRFNFTIDPEVM 240
           YNIHKGEVEDFTKRGLQDLKDGVLRTPLPAKQTFLDDPLRVLRLIRFASRFNFTIDPEVM
Sbjct: 181 YNIHKGEVEDFTKRGLQDLKDGVLRTPLPAKQTFLDDPLRVLRLIRFASRFNFTIDPEVM 240

Query: 241 AEMGDPQINVAFNSKISRERVGVEMEKILVGPTPLLALQLIQRAHLENVIFFWHNDSSVV 300
           AEMGDPQINVAFNSKISRERVGVEMEKILVGPTPLLALQLIQRAHLENVIFFWHNDSSVV
Sbjct: 241 AEMGDPQINVAFNSKISRERVGVEMEKILVGPTPLLALQLIQRAHLENVIFFWHNDSSVV 300

Query: 301 KFNEENCQDMDKINHVYNDNILNSHLKSFIELYPMFLEKLPILREKIGRSPGFQQNFILS 360
           KFNEENCQDMDKINHVYNDNILNSHLKSFIELYPMFLEKLPILREKIGRSPGFQQNFILS
Sbjct: 301 KFNEENCQDMDKINHVYNDNILNSHLKSFIELYPMFLEKLPILREKIGRSPGFQQNFILS 360

Query: 361 AILSPMANLQIIGNPKKKINNLVSVTESIVKEGLKLSKNDAAVIAKTVDSICSYEEILAK 420
           AILSPMANLQIIGNPKKKINNLVSVTESIVKEGLKLSKNDAAVIAKTVDSICSYEEILAK
Sbjct: 361 AILSPMANLQIIGNPKKKINNLVSVTESIVKEGLKLSKNDAAVIAKTVDSICSYEEILAK 420

Query: 421 FADRSQLKKSEIGIFLRNFNGEWETAHFASLSDAFLKIPKLETKKIELLFQNYNEFYSYI 480
           FADRSQLKKSEIGIFLRNFNGEWETAHFASLSDAFLKIPKLETKKIELLFQNYNEFYSYI
Sbjct: 421 FADRSQLKKSEIGIFLRNFNGEWETAHFASLSDAFLKIPKLETKKIELLFQNYNEFYSYI 480

Query: 481 FDNNLNNCHELKPIVDGKQMAKLLQMKPGPWLGKINNEAIRWQFDNPTGTDQELITH 537
           FDNNLNNCHELKPIVDGKQMAKLLQMKPGPWLGKINNEAIRWQFDNPTGTDQELITH
Sbjct: 481 FDNNLNNCHELKPIVDGKQMAKLLQMKPGPWLGKINNEAIRWQFDNPTGTDQELITH 537

>CAGL0L11858g complement(1270455..1272050) similar to tr|Q9P4S5
           Saccharomyces cerevisiae YER168c tRNA
           nucleotidyltransferase, hypothetical start
          Length = 531

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/510 (63%), Positives = 393/510 (77%), Gaps = 3/510 (0%)

Query: 28  PKITLTKVEQNICNLLNDYTDLYNQKYHNKPEPLTLRITGGWVRDKLLGQGSHDLDIAIN 87
           P+I LT+ E  ICNLL DYT  YN   H   EPLTLRITGGWVRDKLLGQGSHDLDIAIN
Sbjct: 13  PRIQLTEKETRICNLLKDYTAHYNS-LHYGQEPLTLRITGGWVRDKLLGQGSHDLDIAIN 71

Query: 88  VMSGEQFATGLNEYLQQHYAKYGAKPHNIHKIDKNPEKSKHLETATTKLFGVEVDFVNLR 147
           +MSGE+FATGLN YL +H+ KYG KPH+IHKIDKNPEKSKHLETATTKLF VEVDFVNLR
Sbjct: 72  IMSGEEFATGLNGYLLEHFDKYGVKPHSIHKIDKNPEKSKHLETATTKLFDVEVDFVNLR 131

Query: 148 SEKYTELSRIPKVCFGTPEEDALRRDATLNALFYNIHKGEVEDFTKRGLQDLKDGVLRTP 207
           SE+YTE SRIP   FGTPEEDALRRDATLNALFYNI +  VEDFTKRG QDL+DGVLRTP
Sbjct: 132 SEEYTEDSRIPTTQFGTPEEDALRRDATLNALFYNIQQDAVEDFTKRGWQDLQDGVLRTP 191

Query: 208 LPAKQTFLDDPLRVLRLIRFASRFNFTIDPEVMAEMGDPQINVAFNSKISRERVGVEMEK 267
           LPA+QTFLDDPLRVLRLIRFASRFNF I+  V+ EM DP+IN AFN+KISRER+GVEMEK
Sbjct: 192 LPARQTFLDDPLRVLRLIRFASRFNFNIEAGVLKEMHDPEINEAFNNKISRERIGVEMEK 251

Query: 268 ILVGPTPLLALQLIQRAHLENVIFFWHNDSSVVKFNEENCQDMDKINHVYNDNILNSHLK 327
           ILVGP P+L L+LIQR HLENVIF WH D SV+++N +N      +  +Y   I N HLK
Sbjct: 252 ILVGPNPILGLKLIQRTHLENVIFLWHGDQSVIEYNRKNWPQTKDVEDIYKKGIFNHHLK 311

Query: 328 SFIELYPMFLEKLPILREKI-GRSPGFQQNFILSAILSPMANLQIIGNPKKKINNLVSVT 386
           +FI  Y  FL +   LR+ I  +   FQQNF+L++IL PMA+L+II  PKKK+NN + V+
Sbjct: 312 NFIHHYKDFLSRYLKLRQAIETKDKSFQQNFLLASILIPMADLKIIALPKKKLNNTLPVS 371

Query: 387 ESIVKEGLKLSKNDAAVIAKTVDSICSYEEILAKFADRSQLKKSEIGIFLRNFNGEWETA 446
           ESIV+EGLK +K  + V+A+ V++I +Y  ++ K+     LK+SE+G FLR   G+WE  
Sbjct: 372 ESIVREGLKFNKASSIVVARCVENIAAYNSMVEKYLQSGDLKRSEVGTFLRELRGDWEIV 431

Query: 447 HFASLSDAFLKIPKLETKKIELLFQNYNEFYSYIFDNNLNNCHELKPIVDGKQMAKLLQM 506
           H+ SL D +LK    +   + ++   Y+ F++YI + NL +  ++ PI+DGK+M K+L+ 
Sbjct: 432 HYVSLMDQYLKYISRKDNVVNII-DKYDRFWNYIQEQNLQDSDKMVPIIDGKRMVKILET 490

Query: 507 KPGPWLGKINNEAIRWQFDNPTGTDQELIT 536
           KPGPWLGKIN+E I WQFD+P GT+QELI+
Sbjct: 491 KPGPWLGKINDEVILWQFDHPQGTEQELIS 520

>Scas_681.20
          Length = 543

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/512 (60%), Positives = 400/512 (78%), Gaps = 2/512 (0%)

Query: 28  PKITLTKVEQNICNLLNDYTDLYNQKYHNKPEPLTLRITGGWVRDKLLGQGSHDLDIAIN 87
           P I LT +E++IC LLNDYT  YNQ + +  EPLTLRITGGWVRDKLLGQGSHDLDIAIN
Sbjct: 24  PIIKLTPIEKDICKLLNDYTLHYNQTHLDIKEPLTLRITGGWVRDKLLGQGSHDLDIAIN 83

Query: 88  VMSGEQFATGLNEYLQQHYAKYGAKPHNIHKIDKNPEKSKHLETATTKLFGVEVDFVNLR 147
           +MSGE FA GLNEYL +HYA+YG KPH+IHKIDKNPEKSKHLETATTKLF +EVDFVNLR
Sbjct: 84  IMSGESFARGLNEYLTKHYARYGIKPHSIHKIDKNPEKSKHLETATTKLFDIEVDFVNLR 143

Query: 148 SEKYTELSRIPKVCFGTPEEDALRRDATLNALFYNIHKGEVEDFTKRGLQDLKDGVLRTP 207
           +E+YTELSRIP   FGTPEEDALRRDATLNALFYNI + ++EDFT++GL DLK+G+LRTP
Sbjct: 144 AEEYTELSRIPITKFGTPEEDALRRDATLNALFYNIQENQIEDFTRKGLTDLKNGILRTP 203

Query: 208 LPAKQTFLDDPLRVLRLIRFASRFNFTIDPEVMAEMGDPQINVAFNSKISRERVGVEMEK 267
           LPA++TFLDDPLRVLRLIRFASRFNFTI+  V+ EM +P+IN AF +KISRERVG EMEK
Sbjct: 204 LPARKTFLDDPLRVLRLIRFASRFNFTIEDNVLKEMSNPEINAAFITKISRERVGNEMEK 263

Query: 268 ILVGPTPLLALQLIQRAHLENVIFFWHNDSSVVKFNE-ENCQDMDKINHVYNDNILNSHL 326
           IL+G  P+L L LIQ+AHLEN IFFWHND S+++ NE  N + M  I  +Y + ILN HL
Sbjct: 264 ILIGNNPILGLSLIQQAHLENAIFFWHNDPSIIECNETSNKEQMQTIQKIYQEGILNKHL 323

Query: 327 KSFIELYPMFLEKLPILREKIGRSPGFQQNFILSAILSPMANLQIIGNPKKKINNLVSVT 386
              I+ Y + L + PIL+  I  +  F+QNFIL++ L P A L+II  PKKK+NN   V+
Sbjct: 324 LKVIDNYQLLLSRSPILQSHILNNNTFKQNFILASSLLPFATLRIIALPKKKLNNTCYVS 383

Query: 387 ESIVKEGLKLSKNDAAVIAKTVDSICSYEEILAKFADRS-QLKKSEIGIFLRNFNGEWET 445
           ESI+KEGLK++K DA ++++TV+++  ++ ++ +F   S  L++S++G +LR+++G WE 
Sbjct: 384 ESIIKEGLKMNKLDAKIVSQTVENVSKHKALIKEFVQNSNSLQRSKLGTYLRSYSGHWEI 443

Query: 446 AHFASLSDAFLKIPKLETKKIELLFQNYNEFYSYIFDNNLNNCHELKPIVDGKQMAKLLQ 505
            HF +L + F+ +   +      LF++YN FYS+I D  L NCHE+KP++DGK+M K+L 
Sbjct: 444 VHFVALLEEFINLQSNDDHTAIELFKDYNSFYSFILDQGLKNCHEMKPLIDGKKMLKVLN 503

Query: 506 MKPGPWLGKINNEAIRWQFDNPTGTDQELITH 537
           MK GPW+ ++NN  I WQFDNP GT+ +L+ +
Sbjct: 504 MKAGPWMSELNNNIIVWQFDNPNGTEAQLLEY 535

>Sklu_1964.2 YER168C, Contig c1964 2064-3623 reverse complement
          Length = 519

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/506 (59%), Positives = 370/506 (73%), Gaps = 15/506 (2%)

Query: 30  ITLTKVEQNICNLLNDYTDLYNQKYHNKPEPLTLRITGGWVRDKLLGQGSHDLDIAINVM 89
           + LTK+EQ++C LL DY   YN       EPLTLRITGGWVRDKLLG  SHDLDIA+N M
Sbjct: 18  LQLTKIEQDVCGLLKDYVAHYNATATKSSEPLTLRITGGWVRDKLLGHLSHDLDIAVNNM 77

Query: 90  SGEQFATGLNEYLQQHYAKYGAKPHNIHKIDKNPEKSKHLETATTKLFGVEVDFVNLRSE 149
           +GEQFATGLN YL +HY+KYG KPH+IHKIDKNP KSKHLETATTKLFGVEVDFVNLRSE
Sbjct: 78  TGEQFATGLNTYLTEHYSKYGIKPHSIHKIDKNPAKSKHLETATTKLFGVEVDFVNLRSE 137

Query: 150 KYTELSRIPKVCFGTPEEDALRRDATLNALFYNIHKGEVEDFTKRGLQDLKDGVLRTPLP 209
           +YT  SRIP V  GTP +DA+RRDATLNALFYNI + ++ED+T RGL+DL DGVLRTPLP
Sbjct: 138 EYTTESRIPIVACGTPAQDAMRRDATLNALFYNIQQEQIEDYTGRGLKDLHDGVLRTPLP 197

Query: 210 AKQTFLDDPLRVLRLIRFASRFNFTIDPEVMAEMGDPQINVAFNSKISRERVGVEMEKIL 269
            KQTFLDDPLRVLRLIRFASRFNF+ID E    M D +IN AF  KISRERVGVE++KIL
Sbjct: 198 PKQTFLDDPLRVLRLIRFASRFNFSIDEETYEAMKDQEINQAFEVKISRERVGVELQKIL 257

Query: 270 VGPTPLLALQLIQRAHLENVIFFWHNDSSVVKFNEENCQDMDKINHVYNDNILNSHLKSF 329
            GP PL  L LIQ A LENVIF+WHND +V+ +N ++  DM  +  VY    L+SH+   
Sbjct: 258 TGPNPLRGLHLIQGASLENVIFYWHNDLAVIDYNNKHT-DMSDVELVYKQ--LSSHIDVV 314

Query: 330 IELYPMFLEKLPILREKIGRSPGFQQNFILSAILSPMANLQIIGNPKKKINNLVSVTESI 389
           +   P  L+ LP L+EK      F+QNFIL   L+P + L II NP KK++N +SVTESI
Sbjct: 315 LHNIPKLLQALPHLKEKYDSDAVFKQNFILGVTLAPFSTLSIISNP-KKMHNRLSVTESI 373

Query: 390 VKEGLKLSKNDAAVIAKTVDSICSYEEILAKFADRSQLKKSEIGIFLRNFNGEWETAHFA 449
           +KEGLK  KNDA V+AK VD+   ++EI+        +K+S++G  LR++ G+W+ AH+ 
Sbjct: 374 IKEGLKFGKNDAEVVAKCVDTKDQFQEIVKNI---DHVKRSQVGTLLRSYYGDWQLAHYI 430

Query: 450 SLSDAFLKIPKLETKKIELLFQNYNEFYSYIFDNNLNNCHELKPIVDGKQMAKLLQMKPG 509
           +LS        LE      +   Y  FY+Y+   +L NCH LKP+VDGK+++KLLQMKPG
Sbjct: 431 NLS--------LEYFYDSNVLGRYERFYTYVVKQDLENCHILKPLVDGKKLSKLLQMKPG 482

Query: 510 PWLGKINNEAIRWQFDNPTGTDQELI 535
           PW+GK+NN+ + WQ DNP   ++EL+
Sbjct: 483 PWMGKVNNQLLLWQLDNPGKGEEELL 508

>Kwal_56.23461
          Length = 519

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/509 (55%), Positives = 366/509 (71%), Gaps = 15/509 (2%)

Query: 27  APKITLTKVEQNICNLLNDYTDLYNQKYHNKPEPLTLRITGGWVRDKLLGQGSHDLDIAI 86
           A K+TLTK EQ+IC LL DY+  YN     K EPL LRITGGWVRDK+LG  SHDLDIA+
Sbjct: 15  ATKLTLTKTEQDICGLLRDYSREYNAANAGK-EPLMLRITGGWVRDKILGFDSHDLDIAV 73

Query: 87  NVMSGEQFATGLNEYLQQHYAKYGAKPHNIHKIDKNPEKSKHLETATTKLFGVEVDFVNL 146
           N M+GEQ A GL+++L +++  YG  PH+IHKIDKNPEKSKHLETATTKLFG+EVDFVNL
Sbjct: 74  NTMTGEQLALGLSDFLTRNHQLYGITPHSIHKIDKNPEKSKHLETATTKLFGIEVDFVNL 133

Query: 147 RSEKYTELSRIPKVCFGTPEEDALRRDATLNALFYNIHKGEVEDFTKRGLQDLKDGVLRT 206
           RSE+YT  SRIP V FGTP++DALRRDATLNALFYNI   ++EDFT  G++DLK GVLRT
Sbjct: 134 RSEEYTNDSRIPVVAFGTPKQDALRRDATLNALFYNIQCDKIEDFTGTGIEDLKRGVLRT 193

Query: 207 PLPAKQTFLDDPLRVLRLIRFASRFNFTIDPEVMAEMGDPQINVAFNSKISRERVGVEME 266
           PLP +QTFLDDPLRVLRLIRFASRF F IDPE    M DP+IN AF  KISRERVG EM+
Sbjct: 194 PLPPRQTFLDDPLRVLRLIRFASRFGFIIDPETYQAMQDPEINKAFEIKISRERVGAEMQ 253

Query: 267 KILVGPTPLLALQLIQRAHLENVIFFWHNDSSVVKFNEENCQDMDKINHVYNDNILNSHL 326
           KIL GP PLL L+LIQ A+L+NVIF WH+D  ++ +N EN  DM +    Y     + H+
Sbjct: 254 KILQGPNPLLGLKLIQGANLQNVIFHWHSDPVIIAYNRENV-DMTEALEAYQK--FSKHI 310

Query: 327 KSFIELYPMFLEKLPILREKIGRSPGFQQNFILSAILSPMANLQIIGNPKKKINNLVSVT 386
              +E  P+ L   P ++      P F+QNF+LS IL+P   ++I+ NP+K +N    +T
Sbjct: 311 ALVLEKLPVLLNSFPKIQNDWDTQPTFKQNFLLSIILAPFRGIKIVWNPQKLLNREAPIT 370

Query: 387 ESIVKEGLKLSKNDAAVIAKTVDSICSYEEILAKFADRSQLKKSEIGIFLRNFNGEWETA 446
           ESIVK+GLKL KND+ +I+K V+S  +Y +++ KF     L +SEIG+ +R+F G+WE A
Sbjct: 371 ESIVKDGLKLGKNDSELISKCVESHLAYNKMVLKF---ESLSRSEIGLVIRDFKGDWELA 427

Query: 447 HFASLSDAFLKIPKLETKKIELLFQNYNEFYSYIFDNNLNNCHELKPIVDGKQMAKLLQM 506
           H A+L+ A+           E     Y  FY ++F+ NL N H LKP++DGK ++K L++
Sbjct: 428 HLANLALAYC--------FDETSLGQYQNFYKFVFNENLENSHLLKPLIDGKSLSKRLKI 479

Query: 507 KPGPWLGKINNEAIRWQFDNPTGTDQELI 535
           KPG W+G + +E I+WQ DNPT T++E++
Sbjct: 480 KPGRWMGGVVSEMIKWQLDNPTATEEEVL 508

>KLLA0C17688g complement(1565906..1567375)
           gi|9836828|gb|AAG00316.1|AF207744_1 Kluyveromyces lactis
           tRNA nucleotidyltransferase, start by similarity
          Length = 489

 Score =  427 bits (1098), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 242/518 (46%), Positives = 309/518 (59%), Gaps = 45/518 (8%)

Query: 23  FVLNAPKITLTKVEQNICNLLNDYTDLYNQKYHNKPEPLTLRITGGWVRDKLLGQGSHDL 82
           F + A KI L KVE  IC L+ ++   YN K + + EPL  RITGGWVRDKLLG  S+DL
Sbjct: 2   FKMVASKIQLNKVESEICTLVKEFCSHYN-KANAETEPLVARITGGWVRDKLLGNDSNDL 60

Query: 83  DIAINVMSGEQFATGLNEYLQQHYAKYGAKPHNIHKIDKNPEKSKHLETATTKLFGVEVD 142
           DIAIN M+GEQFA  L  +LQ      G + H++H IDKNP KSKHLET TTKLF V VD
Sbjct: 61  DIAINNMTGEQFAEKLCAFLQDR----GLETHSLHTIDKNPSKSKHLETCTTKLFDVPVD 116

Query: 143 FVNLRSEKYTELSRIPKVCFGTPEEDALRRDATLNALFYNIHKGEVEDFTKRGLQDLKDG 202
           FVNLRSE+YT  SRIPKV FGTP +DA+RRDATLNA+FYNI + ++EDFTK+G QDL DG
Sbjct: 117 FVNLRSEEYTMESRIPKVEFGTPYDDAMRRDATLNAMFYNITEDKIEDFTKKGFQDLNDG 176

Query: 203 VLRTPLPAKQTFLDDPLRVLRLIRFASRFNFTIDPEVMAEMGDPQINVAFNSKISRERVG 262
           +LRTPLP +QTF+DDPLRVLRLIRFASRFNF IDP+    M DP I+ +FN KIS+ RV 
Sbjct: 177 ILRTPLPPRQTFIDDPLRVLRLIRFASRFNFQIDPQTYQAMRDPGIHQSFNHKISKGRVY 236

Query: 263 VEMEKILVGPTPLLALQLIQRAHLENVIFFWHNDSSVVKFNEENCQDMDKINHVYNDNIL 322
            EM K L    P  AL LIQ AHL  VIF  +  S  ++   EN               L
Sbjct: 237 TEMHKTLTSANPFYALDLIQGAHLSRVIFTTNESSPEIESIYEN---------------L 281

Query: 323 NSHLKSFIELYPMFLEKLPILREKIGRSPGFQQNFILSAILSPMANLQIIGNPKKKINNL 382
           + HLKS +E  P  L+            PG Q+  ILS +LS    L+  G    K  N 
Sbjct: 282 DQHLKSLVETIPKLLKSHTTFASVF---PGMQEPLILSLVLSGFKGLK--GPDPAKPKNS 336

Query: 383 VSVTESIVKEGLKLSKNDAAVIAKTVDSICSYEEILAKFADRSQLKKSEIGIFLRNFNGE 442
           + +   I KEGL         +   V+S  SY  ++    +   +K+SE+G  LR     
Sbjct: 337 IPLAGVITKEGLNFPNTQVDNVIACVESEDSYHNLV---KNGKSMKRSELGFALRKLGKN 393

Query: 443 WETAHFASLSDAFLK-----IPKLETKKIELLFQNYNEFYSYIFDNNLNNCHELKPIVDG 497
           W+  HF +L   +L+     IP            +Y+EFY ++ D  L++ + LK I++G
Sbjct: 394 WQMVHFYNLCLDYLRHGDEPIP------------HYDEFYKHVHDCKLDDVYTLKHIING 441

Query: 498 KQMAKLLQMKPGPWLGKINNEAIRWQFDNPTGTDQELI 535
           K++AKLL  KPG W+G+  +  + WQ DNP  + +  I
Sbjct: 442 KELAKLLDRKPGIWMGETLDRILIWQLDNPDISKETFI 479

>AGR118W [4429] [Homologous to ScYER168C (CCA1) - SH]
           complement(967217..968818) [1602 bp, 533 aa]
          Length = 533

 Score =  387 bits (995), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 207/505 (40%), Positives = 291/505 (57%), Gaps = 34/505 (6%)

Query: 30  ITLTKVEQNICNLLNDYTDLYNQKYHNKPEPLTLRITGGWVRDKLLGQGSHDLDIAINVM 89
           I LT +E+ IC+++ DY              L  RI GGWVRDKLLG  S DLDI +N +
Sbjct: 50  IQLTALERRICDVIRDYCAQLGDA------GLRPRIAGGWVRDKLLGLESEDLDIVLNNV 103

Query: 90  SGEQFATGLNEYLQQHYAKYGAKPHNIHKIDKNPEKSKHLETATTKLFGVEVDFVNLRSE 149
           +GE+FA+GL E+L+      G     +HKI +NP +SKHLET TT + GV VDFVNLRSE
Sbjct: 104 TGERFASGLVEFLKAQ----GGSARGVHKIQRNPARSKHLETCTTTVLGVAVDFVNLRSE 159

Query: 150 KYTELSRIPKVCFGTPEEDALRRDATLNALFYNIHKGEVEDFTKRGLQDLKDGVLRTPLP 209
            Y E SR+P V FGTP +DA+RRDATLNALFYNI +G VEDFT RGL DL  GVLRTP+P
Sbjct: 160 TYAEESRVPTVEFGTPLQDAMRRDATLNALFYNILEGVVEDFTGRGLADLAAGVLRTPMP 219

Query: 210 AKQTFLDDPLRVLRLIRFASRFNFTIDPEVMAEMGDPQINVAFNSKISRERVGVEMEKIL 269
           A+QTFLDDPLRVLRL+RFA+RF F +D E    M    I+ A   KISRERVG E+ K+L
Sbjct: 220 ARQTFLDDPLRVLRLVRFAARFGFELDNEAREGMAYRDIHAALVRKISRERVGTELHKML 279

Query: 270 VGPTPLLALQLIQRAHLENVIFFWHNDSSVVKFNEENCQDMDKINHVYNDNILNSHLKSF 329
               PL  L+L+  A L   +F   +   + +  E++   MD     Y    L +HL + 
Sbjct: 280 TSADPLYGLRLLCEAGLLPAVFL--SPDGLPRGAEQHVLGMD-----YQVEALCAHLSAL 332

Query: 330 IELYPMFLEKLPILREKIGRSPGFQQNFILSAILSPMANLQIIGNPKKKINNLVSVTESI 389
            E  P F   L            F++ F+LS +L+    +      K+ +  +V    SI
Sbjct: 333 KERCPGFAAALE--------DEAFRERFLLSTVLARFRGVHATSTKKQPVEAVV----SI 380

Query: 390 VKEGLKLSKNDAAVIAKTVDSICSYEEILAKFADRSQLKKSEIGIFLRNFNGEWETAHFA 449
           V+EGLKL +   + +   V SI  Y E++  +   S   ++ +G+ LR     W   H+ 
Sbjct: 381 VREGLKLGRATVSAVQMAVRSIDDYHEMVENYGSWS---RARVGLQLRGLEDHWRQCHYT 437

Query: 450 SLSDAFLKIPKLETKKIELLFQNYNEFYSYIFDNNLNNCHELKPIVDGKQMAKLLQMKPG 509
           +++  +  +   E  ++ L+   Y  F  ++ +  L + H+L+P++DG Q+ KLL  K G
Sbjct: 438 AMACQYF-LAANEDARLALI-GLYGRFEQHVREEGLEDAHKLRPMIDGNQLVKLLGTKGG 495

Query: 510 PWLGKINNEAIRWQFDNPTGTDQEL 534
           PW+ +  +  + WQ ++P GT ++L
Sbjct: 496 PWMSRAMSMMVEWQLEHPHGTSEQL 520

>Kwal_47.17635
          Length = 728

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 43/103 (41%), Gaps = 12/103 (11%)

Query: 369 LQIIGNPKKKINNLVSVTESIVKEGLKLS-----KNDAAVIAKTVDSICS----YEEILA 419
            Q+   PK K + L  V+   VKEG+ +      K    V  K +  +      YE++++
Sbjct: 283 FQLCHEPKDKSHLLKQVSSHFVKEGMGIEEDRTIKKKGQVAFKWITDVLQLKKKYEDMIS 342

Query: 420 KFADRSQLKKSEIGIFLRNF---NGEWETAHFASLSDAFLKIP 459
              +    K+S IG  L  F   NG     + A   D  L++P
Sbjct: 343 LVGEEDTTKQSVIGQSLATFLNQNGRKTAEYLAIYMDTLLRLP 385

>KLLA0E09328g complement(831306..831944) highly similar to
           sgd|S0005547 Saccharomyces cerevisiae YOR021c, start by
           similarity
          Length = 212

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 28/41 (68%)

Query: 429 KSEIGIFLRNFNGEWETAHFASLSDAFLKIPKLETKKIELL 469
           +S+I   LR    +W TA+   +++AF ++P+L+++++ LL
Sbjct: 43  ESDIPKKLREMGLQWTTANLDKINEAFPELPELKSQRVCLL 83

>Sklu_1792.3 YDR020C, Contig c1792 2698-3333
          Length = 211

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 5/59 (8%)

Query: 448 FASLSDAFLKIPKLETKKIELLFQNYNEFYSYIFDNNLNNCHELKPIVDGKQMAKLLQM 506
           F ++ D  +  PK E+ +I LL  +Y      ++D N+NN  +LK  +D +   +L+ M
Sbjct: 61  FNAVYDTLITKPKHESLEIVLLCGSYA-----LYDANINNLSKLKVFLDSEGDKRLINM 114

>AAL118C [69] [Homologous to ScYOR265W (RBL2) - SH] (139715..140038)
           [324 bp, 107 aa]
          Length = 107

 Score = 28.9 bits (63), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 35/60 (58%), Gaps = 4/60 (6%)

Query: 391 KEGLKLSKNDAAV----IAKTVDSICSYEEILAKFADRSQLKKSEIGIFLRNFNGEWETA 446
           +E ++L K DA+V    + K ++ +   E +L +F ++ Q   +++  F+  +NG+ +TA
Sbjct: 31  RERVELLKRDASVDPYELKKQIEVMQDTERLLPRFYEKVQQFYNDLKDFVNGYNGDEDTA 90

>YPR122W (AXL1) [5543] chr16 (782039..785665) Protease involved in
           second proteolytic step of a-factor N-terminal
           processing [3627 bp, 1208 aa]
          Length = 1208

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 7/65 (10%)

Query: 277 ALQLIQRAHLENVIF-FWHNDSSVVKFNEENCQDMDKINHVYNDN------ILNSHLKSF 329
           AL+L +    E   F FW N   +V F + + +  D IN   N+N      I N   K  
Sbjct: 785 ALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLKISNEGSKPT 844

Query: 330 IELYP 334
           I LYP
Sbjct: 845 IRLYP 849

>CAGL0M11990g complement(1187859..1189712) similar to sp|P13365
           Saccharomyces cerevisiae YAL040c CLN3, hypothetical
           start
          Length = 617

 Score = 29.3 bits (64), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 19/72 (26%)

Query: 314 NHVYNDNI-LNSHLKSFIELYPMFLEKLPILREKIGRSPGFQQNFILSAILSPMANLQII 372
           NHVYN N+ LN H         M  ++  ILR++ G          L++  S ++ L + 
Sbjct: 418 NHVYNQNLTLNDH--------SMIPQQSNILRKRQG----------LNSSASNLSPLSLG 459

Query: 373 GNPKKKINNLVS 384
           GNP   +NN +S
Sbjct: 460 GNPNTAMNNFIS 471

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,550,982
Number of extensions: 869485
Number of successful extensions: 2651
Number of sequences better than 10.0: 40
Number of HSP's gapped: 2687
Number of HSP's successfully gapped: 40
Length of query: 537
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 431
Effective length of database: 12,926,601
Effective search space: 5571365031
Effective search space used: 5571365031
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)