Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER167W (BCK2)85183738820.0
Scas_681.218468026782e-76
CAGL0L11836g8477324345e-44
Kwal_56.234626956143773e-37
AGR119C8013482189e-18
KLLA0C17666g7901542142e-17
Scas_636.16d6201251151e-05
KLLA0A00715g59177712.3
KLLA0A08734g1162128694.2
YPL167C (REV3)150470686.9
AFR265C59173669.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER167W
         (837 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER167W (BCK2) [1595] chr5 (518211..520766) Protein involved in ...  1499   0.0  
Scas_681.21                                                           265   2e-76
CAGL0L11836g 1267563..1270106 weakly similar to sp|P33306 Saccha...   171   5e-44
Kwal_56.23462                                                         149   3e-37
AGR119C [4430] [Homologous to ScYER167W (BCK2) - SH] (969101..97...    89   9e-18
KLLA0C17666g 1562996..1565368 some similarities with sp|P33306 S...    87   2e-17
Scas_636.16d                                                           49   1e-05
KLLA0A00715g complement(69861..71636) similar to sp|P43620 Sacch...    32   2.3  
KLLA0A08734g 763946..767434 similar to sp|P34111 Saccharomyces c...    31   4.2  
YPL167C (REV3) [5280] chr16 complement(232592..237106) DNA polym...    31   6.9  
AFR265C [3457] [Homologous to ScYFR048W - SH] (910793..912568) [...    30   9.3  

>YER167W (BCK2) [1595] chr5 (518211..520766) Protein involved in the
           SIT4 pathway for CLN activation and in suppression of
           lethality due to mutations in the protein kinase C
           pathway [2556 bp, 851 aa]
          Length = 851

 Score = 1499 bits (3882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 753/837 (89%), Positives = 753/837 (89%)

Query: 1   MPKNXXXXXXXXXXXXXXXXXXXTNKWKIPHYYRRSASGSTQASPDRNSSTGSCSTPVLP 60
           MPKN                   TNKWKIPHYYRRSASGSTQASPDRNSSTGSCSTPVLP
Sbjct: 1   MPKNSHHHRSSSVNSTKSRSTESTNKWKIPHYYRRSASGSTQASPDRNSSTGSCSTPVLP 60

Query: 61  TMNVMSSPKKVLLEDPRDNHTKAKKSSRKKSGEMVFVNYTVQDTANENDTDLQTQPVSVX 120
           TMNVMSSPKKVLLEDPRDNHTKAKKSSRKKSGEMVFVNYTVQDTANENDTDLQTQPVSV 
Sbjct: 61  TMNVMSSPKKVLLEDPRDNHTKAKKSSRKKSGEMVFVNYTVQDTANENDTDLQTQPVSVP 120

Query: 121 XXXXXXXXXXXXXXXXXIFGSSKNEHIEDIVEEQPMVLQMDSESKPLSGTPISESGIDAS 180
                            IFGSSKNEHIEDIVEEQPMVLQMDSESKPLSGTPISESGIDAS
Sbjct: 121 APKAKLKKKSSKRRMLKIFGSSKNEHIEDIVEEQPMVLQMDSESKPLSGTPISESGIDAS 180

Query: 181 SLTTKRSYNSFLKHNRLNGKTPFSGNLSFPSLNMMGNTTDLPIDNNDFCSEKEVVPKSTH 240
           SLTTKRSYNSFLKHNRLNGKTPFSGNLSFPSLNMMGNTTDLPIDNNDFCSEKEVVPKSTH
Sbjct: 181 SLTTKRSYNSFLKHNRLNGKTPFSGNLSFPSLNMMGNTTDLPIDNNDFCSEKEVVPKSTH 240

Query: 241 DPSLAKPPSRFTESETNSTPNLSSIPLMNTKNTRLKYNKVAPQSSDRQKSQESGLYHSTE 300
           DPSLAKPPSRFTESETNSTPNLSSIPLMNTKNTRLKYNKVAPQSSDRQKSQESGLYHSTE
Sbjct: 241 DPSLAKPPSRFTESETNSTPNLSSIPLMNTKNTRLKYNKVAPQSSDRQKSQESGLYHSTE 300

Query: 301 SFNFKDQNYXXXXXXXXXXXXXXTPHFAKHSPDSPRTSRSFNCGDSQSKVKLPEENDASI 360
           SFNFKDQNY              TPHFAKHSPDSPRTSRSFNCGDSQSKVKLPEENDASI
Sbjct: 301 SFNFKDQNYSNNKSSLSLNSDLSTPHFAKHSPDSPRTSRSFNCGDSQSKVKLPEENDASI 360

Query: 361 AFSKMFTRKRANTGGSTCSLASPTIAQTIQQSNIKVNKLPTQRTTSVGSLSSMSNRYSPI 420
           AFSKMFTRKRANTGGSTCSLASPTIAQTIQQSNIKVNKLPTQRTTSVGSLSSMSNRYSPI
Sbjct: 361 AFSKMFTRKRANTGGSTCSLASPTIAQTIQQSNIKVNKLPTQRTTSVGSLSSMSNRYSPI 420

Query: 421 RVASPGRARSATRGSSLYRLSRDLNSLPSVTDLPEMDSTTPVNEIFLDGQPQHKSGSVKG 480
           RVASPGRARSATRGSSLYRLSRDLNSLPSVTDLPEMDSTTPVNEIFLDGQPQHKSGSVKG
Sbjct: 421 RVASPGRARSATRGSSLYRLSRDLNSLPSVTDLPEMDSTTPVNEIFLDGQPQHKSGSVKG 480

Query: 481 GHRKKQESISDAQRIQHSNSYITTPSSSLVTPPYYMTGYTLPXXXXXXXTPNVLETHNMN 540
           GHRKKQESISDAQRIQHSNSYITTPSSSLVTPPYYMTGYTLP       TPNVLETHNMN
Sbjct: 481 GHRKKQESISDAQRIQHSNSYITTPSSSLVTPPYYMTGYTLPSSASASSTPNVLETHNMN 540

Query: 541 FVPSTSTVTSYRPSSNFSSFDKEYSNENDASGEFSAFNTPMENIPALKGIPRSTLEENEE 600
           FVPSTSTVTSYRPSSNFSSFDKEYSNENDASGEFSAFNTPMENIPALKGIPRSTLEENEE
Sbjct: 541 FVPSTSTVTSYRPSSNFSSFDKEYSNENDASGEFSAFNTPMENIPALKGIPRSTLEENEE 600

Query: 601 EDVLVQDIPNTAHFQRRDIMGMDTHRKDDSLDFNSLMPHGSTTSSSIVDSVMXXXXXXXX 660
           EDVLVQDIPNTAHFQRRDIMGMDTHRKDDSLDFNSLMPHGSTTSSSIVDSVM        
Sbjct: 601 EDVLVQDIPNTAHFQRRDIMGMDTHRKDDSLDFNSLMPHGSTTSSSIVDSVMTNSISTTT 660

Query: 661 XXXXXXYFQDQDKYTLVNTGLGLSDANLDHFIRSQWKHASRSESNNNTGNRVSYSGSTPN 720
                 YFQDQDKYTLVNTGLGLSDANLDHFIRSQWKHASRSESNNNTGNRVSYSGSTPN
Sbjct: 661 SNATGNYFQDQDKYTLVNTGLGLSDANLDHFIRSQWKHASRSESNNNTGNRVSYSGSTPN 720

Query: 721 NVDTTKTNLQVYTEFDFENPESFFHEQSKLLGEMGHXXXXXXXXXXXXEPKSADTYIGNI 780
           NVDTTKTNLQVYTEFDFENPESFFHEQSKLLGEMGH            EPKSADTYIGNI
Sbjct: 721 NVDTTKTNLQVYTEFDFENPESFFHEQSKLLGEMGHSNNNSNSAINMNEPKSADTYIGNI 780

Query: 781 SPDTSATVSLGDLMGSNVSNNSERNFYDGHTFVPQYQANSSVENSNNQNAAPIANND 837
           SPDTSATVSLGDLMGSNVSNNSERNFYDGHTFVPQYQANSSVENSNNQNAAPIANND
Sbjct: 781 SPDTSATVSLGDLMGSNVSNNSERNFYDGHTFVPQYQANSSVENSNNQNAAPIANND 837

>Scas_681.21
          Length = 846

 Score =  265 bits (678), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 268/802 (33%), Positives = 369/802 (46%), Gaps = 174/802 (21%)

Query: 25  NKWKIPHYYRRSASGSTQASPDRNSSTGSCSTPVLPTMNVMSSPKKVLLEDPRDNHTKAK 84
           NKWKIPHYYRRS  G +    + + S  + S  + P +NVM+SPKK+LLE+P+       
Sbjct: 39  NKWKIPHYYRRSNIGLSTPQTESSMSFANPSANLSPNINVMTSPKKLLLEEPKK-SKNGS 97

Query: 85  KSSRKKSGEMVFVNYTVQDTANE-------NDTDLQTQPVSVXXXXXXXXXXXXXXXXXX 137
           K S+KK G MVFVNYTVQDT           D   Q+   +                   
Sbjct: 98  KKSQKKKGGMVFVNYTVQDTEPALAAMDPIQDQGQQSIRKTSSSNKKEEKKKSSRQRMLK 157

Query: 138 IFGSSKNEHIEDIVEEQPMVLQMDS--ESKPLSGTP-----ISESGIDASSLT------- 183
           IF SS+N   +         +QM++  ++  +S  P      +++ I+   +T       
Sbjct: 158 IFKSSQNNSKQ---------IQMNNNDQNTGMSNLPDLNLLKNDTSINNHEITNSDEKIG 208

Query: 184 -TKRSYNSFLKHNRLNGKTPFSGNLSFPSLNMMGNTTDLPIDNNDFCSEKEVVPKSTHDP 242
            TKRSY SFLKHN+ N   P                              EVVPKS  + 
Sbjct: 209 CTKRSYGSFLKHNKSNSSLP-----------------------------NEVVPKSVPNS 239

Query: 243 SLAKPPSRFTESETNS---TPNLSSIPLMNTKNTRLKYNKVAPQSSDRQKSQESGLYHST 299
            LAKPPS  T S   S   T  +++IPL NT+N R    K     +D +  ++  +    
Sbjct: 240 ILAKPPSNPTGSNGRSKSFTSKVANIPLFNTRNYRNTMTK-----NDSKLLKDEPMNDLE 294

Query: 300 ESFNFKDQNYXXXXXXXXXXXXXXTPHFAKHSPDSPRTSRSFNCGDSQSK--VKLPEEND 357
              ++ D +Y              TP+   +   S  T    N   + +K   K+ EEND
Sbjct: 295 IDHHYLDGSYYMDNNNIIPESNS-TPNLNYNLTQSGNTLHKVNSTSATTKKFTKM-EEND 352

Query: 358 ASIAFSKMFTRKRANTGGSTCSLASPT-------------------------IAQTIQ-- 390
           ASIAFSKMFTRKRANT GS  SL   +                         I Q++Q  
Sbjct: 353 ASIAFSKMFTRKRANTAGSMNSLRYTSNSNSNSNANANANANANANQAQLQNIYQSVQHP 412

Query: 391 ----QSNIKVNKLPT-----QRTTSVGSLSSMSNRYSPIRVASPGRARSATRGSSLYRLS 441
               Q N+K+N+  +     QRT SV SLSS+SNRYSP R+ SP R RSA + +S YRLS
Sbjct: 413 SNQSQPNLKINRSSSSTTLAQRTMSVASLSSLSNRYSPNRMISPARPRSA-KSTSNYRLS 471

Query: 442 RDLNSL-PSVTDLPEMDSTTPVNEIFLDGQPQHKSGSVKG------GHRKKQESISDAQR 494
           R+LNSL  +V ++PE+  T P  E +LD Q   KS SV        GHRKKQESISD  R
Sbjct: 472 RELNSLYTNVLEIPEL--TGP--ESYLDVQYMQKSNSVSSDKATVLGHRKKQESISDLHR 527

Query: 495 IQHSNSYITTPSSSLVTPPYYMTGYTLPXXXXXXXTPNVLETHNMNFVPST--STVTSYR 552
           +  + +  TTP+S LVTPPY+ T +T+P       TP+  E   +N + ++  S   + R
Sbjct: 528 VHTTTTVATTPTSFLVTPPYFTTNFTIPTSTSNISTPSCGEVTQINNITNSNPSLKITSR 587

Query: 553 PSSNFSSF-DKEYSNENDASGEFSAFNTPMENIPALKGIPRSTLEENEEEDVLVQDIPNT 611
            + NFSSF +++ S END   E SA +TP E                             
Sbjct: 588 QTGNFSSFLERDTSAENDMLMELSALSTPQE----------------------------- 618

Query: 612 AHFQRRDIMGMDTHRKDDSLDFNSLMPHGSTTSSSIVDSVMXXXXXXXXXXXXXXYFQDQ 671
           + F RR+          + LD         ++S +I + V                 Q+ 
Sbjct: 619 SSFSRRNTTDSKLENHQNQLD-------NGSSSFNISNEV------NSSTAMRNNSMQNN 665

Query: 672 DKYTLVNTGLGLSDANLDHF--IRSQWKHASRSESNNNTGNRVSYSGSTPNNVDTTKTNL 729
           +KY L+NTGLGL D +L +F  +RS   +   S+ N    + +        N D      
Sbjct: 666 EKYQLINTGLGLDDIDLQNFGDLRSAGINTVNSQVN---LDELVAKSEPSTNFDPLS--- 719

Query: 730 QVYTEFDFENPESFFHEQSKLL 751
           Q+Y EFDFENP SFFHEQS+++
Sbjct: 720 QLYMEFDFENPNSFFHEQSRIV 741

>CAGL0L11836g 1267563..1270106 weakly similar to sp|P33306
           Saccharomyces cerevisiae YER167w suppressor of mutations
           in protein kinase C pathway components, hypothetical
           start
          Length = 847

 Score =  171 bits (434), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 222/732 (30%), Positives = 326/732 (44%), Gaps = 138/732 (18%)

Query: 25  NKWKIPHYYRRSAS-GSTQASPDRNSSTGSCSTPVLPTMN--VMSSPKKVLLEDPRDNHT 81
           NKW+IPHYY+R  S GST  S   NS       P+    N   +SSPKK+LLE+      
Sbjct: 18  NKWRIPHYYKRGKSVGSTPVSEVVNS-------PLRAVQNEPSVSSPKKILLEERNRATP 70

Query: 82  KAKKSSRKKSGEMVFVNYTVQD----------------TANENDTDLQTQPVSVXXXXX- 124
           +++KSS+K  G+MVFVNYTVQD                      T   TQ   +      
Sbjct: 71  RSRKSSKK--GQMVFVNYTVQDDDETGDKVDDDKADDVADVVPKTSAVTQAAILDNKHVL 128

Query: 125 XXXXXXXXXXXXXIFGSSKNEHIEDIVEEQPMVLQMDSESKPLSGTPISESG-------- 176
                        IFGSSK    E ++  +P   Q D++ K L+   I  S         
Sbjct: 129 TSKRKSSRRRMLKIFGSSK----EQVIPLEPESHQ-DAQ-KDLAARLIENSAESSSNTSN 182

Query: 177 ---IDASSLTTKRSYNSFLKHNRL----------NGKTPFSGNLSFPSLNMMGNTTDLPI 223
                ++  +  RSY SFLK+N+           N  T F+  L   + N M N   L  
Sbjct: 183 TSSSSSTPNSQGRSYGSFLKYNKFCSGSDRSKNNNASTDFNAML-INNQNKMSNHLALNY 241

Query: 224 DN--------NDFCSEKEVVPKSTHDPSLAKPPSRFTESETNSTPNLSSIPLMNTKNTRL 275
                     N F  E E+VPKS  DP+LAKP  R   ++   + + S+IP+    +T L
Sbjct: 242 SAAKSAEGLLNHFA-EDEMVPKSLPDPNLAKPAIRVGPTDRKRSVSSSAIPMKAASSTSL 300

Query: 276 KYNKVAPQSSDRQKSQESGL----YHSTESFNFKDQNYXXXXXXXXXXXXXXTPHFAKHS 331
                 P    R+ S  + L     H+T    F++ N                P+ +++S
Sbjct: 301 TSKVTKPA---RKMSTTTTLSNPSSHNTPFTEFENSNLTDSYQYSD-------PYISRNS 350

Query: 332 PDSPRTSRSF----NCGDSQSKVKLP-----------------------EENDASIAFSK 364
             S  +  SF    N G+S +   L                        EENDAS+AF+K
Sbjct: 351 NMSNASITSFISSMNVGNSTNITPLTESTKVDTNDNFNALMKGHISEPGEENDASVAFTK 410

Query: 365 MFTRKRANTGGSTCSLASPTIAQTIQQSNIK--VNKLPTQRTTSVGSLSSMSNRYSPIRV 422
           +F RKRANTGGST S  S T  Q   Q+  K  V+K+   RTTS+ SL+S++NR+SPIR 
Sbjct: 411 LFHRKRANTGGSTSSSNSNTTFQNSTQNITKSGVSKISAHRTTSLNSLASIANRFSPIRT 470

Query: 423 ASPGRARSATRGSSLYRLSRDLNSLPSVTDLPEMDSTTPVNEIFLDGQPQHKSGSVKGGH 482
           ASP R RS TR SS  R SRDL+ L  +T  PE    +   E++LD Q +         H
Sbjct: 471 ASPVRPRSNTRSSSTCRHSRDLSGLVPLT-TPEYLGPSTGTEVYLDTQSKRTV-----NH 524

Query: 483 RKKQESISDAQRIQ--------HSNSYITTPSSSLVTPPYYMTGYTLPXXXXXXXTPNVL 534
           +KKQESIS+  + Q        H+ +  TTPSS L T  Y+              TP   
Sbjct: 525 KKKQESISELSKFQNTPTSNNHHTANLATTPSSFLGT-SYFANHPGQQTSYSNTSTPAAT 583

Query: 535 ETHNMN--FVPSTSTVTSYRPSSNFSSFDKEYSNENDASGEFSAFNTPMENIPALKGIPR 592
           + ++++  +    + V + R +S+ S   ++  + +    + +   TP+E + +++GI  
Sbjct: 584 DINSLSTTYFSGKTAVGNSRQTSDISYMTEKEFHTDSEPFDTNDVPTPIEGVSSMRGISN 643

Query: 593 STLEENEEEDVLVQDIPNTAHFQRRDIMGMDTHRKDDSL------------DFNSLMPHG 640
           + ++E +EE+   +D  +T   +   +  +DT+  D  L            DFN     G
Sbjct: 644 NAIQELDEEERPNEDCSDTRKSEIDLMRLLDTNISDRKLAVNNNTKHFDDNDFNRSANSG 703

Query: 641 STTSSSIVDSVM 652
            T S++ +DS M
Sbjct: 704 GTRSNTAMDSFM 715

>Kwal_56.23462
          Length = 695

 Score =  149 bits (377), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 186/614 (30%), Positives = 261/614 (42%), Gaps = 146/614 (23%)

Query: 26  KWKIPHYYRRSASGSTQASPDRNSSTGSCSTPVLPTMNVMSSPKKVLLEDPRDNHTKAKK 85
           KWKIPHYYR+S     +     N+S  S S      +N+M++PK V L++      +  K
Sbjct: 26  KWKIPHYYRKSTGAPVRQELGSNTSLKSESNRANGNINIMTTPKHVQLDESGGGSKRGSK 85

Query: 86  SSRKKSGEMVFVNYTVQDTANENDTDLQTQPVSVXXXXXXXXXXXXXXXXXXIFGSSKNE 145
           S  KK GEMVFVNYTV+D A   D  L  +  S                   +F S  N 
Sbjct: 86  SKAKK-GEMVFVNYTVKD-AKSADAPLPKKKSS-------------KSRMLKLFSSGHNS 130

Query: 146 HIEDIVEEQPMVLQMDSESKPLSGTPISESGIDASSL---TTKRSYNSFLKHNRLNGKTP 202
            +++  +      Q+D  +   S   + +S    S+     TKRSY+SFLK+    G   
Sbjct: 131 GMDESFDN---FSQLDVSTPQDSSDAVQKSRSSGSTPSSQATKRSYSSFLKY----GHAG 183

Query: 203 FSGNLSFPSLNMMGN---TTDLPIDNNDFCSEKEVVPKSTHDPSLAK------------- 246
            S  ++ P++   G+   +T LP+        +  V + +  PSL+              
Sbjct: 184 SSSTITSPAITPPGDGVSSTSLPL--------RSTVQRPSLGPSLSSNVSLVNNNGKASL 235

Query: 247 ------PPSRFTESETNSTPNLSSIPLMNTKNTRLKYNKVAPQSSDRQKSQESGLYHSTE 300
                 P S F  S +    NL+  P      + L YN    Q +DRQ            
Sbjct: 236 ALGTNDPASNFYHSPSKEKSNLNEAP-----RSDLHYND---QYNDRQG----------- 276

Query: 301 SFNFKDQNYXXXXXXXXXXXXXXTPHFAKHSPDSPRTSRSFNCGDSQSKVKLPEENDASI 360
                                    H A   P         N   + +  K  +ENDASI
Sbjct: 277 -------------------------HLATFRPQ-------LNHMHTSAYPKSGDENDASI 304

Query: 361 AFSKMFTRKRANTGGSTCSLASPTIAQTIQQSNIKVNKLPT-QRTTSVGSLSSMSNRYSP 419
           AFSKMFTRKRANTGGS  SL S T +          N LPT  R  S  S+SSMSNRYSP
Sbjct: 305 AFSKMFTRKRANTGGSMSSLVSSTAS----------NNLPTLHRNMSTHSISSMSNRYSP 354

Query: 420 IRVASPGRARSATRGSSLYRLSRDLNSLPSVTDLPEMDSTTPVNEIFLDGQPQHKSGSVK 479
           IR  SP R  S  R +S  R SRD   L   ++  ++   T   EI+LD Q + +  +  
Sbjct: 355 IRAGSPARNNSILRSNS-NRYSRDCTLLQGSSNYADL---TGGMEIYLDSQTKQRHTT-- 408

Query: 480 GGHRKKQESISDAQRIQHSNSYITTPSSSLVTPPYYMTGYTLPXXXXXXXTPNVLETHNM 539
             H+KKQ+SISD+ R   +N+ +          PY  T  +         TP ++E   +
Sbjct: 409 --HKKKQDSISDSYRALPNNTALG---------PYPSTVSS----LSSASTPCLVEGGTI 453

Query: 540 NFVPSTSTVTSYRPSSNFSSFDKEYS-NENDASGEFSAFNTPMENIPALKGIPRSTLEEN 598
                T+T    R +S   S D+E S        +    N+P    PA++GIP++TLE  
Sbjct: 454 -----TNTSGVDRQNSIILSLDRESSLENEILEEQEETANSP-NGRPAIQGIPKTTLEVG 507

Query: 599 EEEDVLVQDIPNTA 612
           E E   +  +PNT+
Sbjct: 508 ERELDNIS-LPNTS 520

>AGR119C [4430] [Homologous to ScYER167W (BCK2) - SH]
           (969101..971506) [2406 bp, 801 aa]
          Length = 801

 Score = 88.6 bits (218), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 106/348 (30%), Positives = 153/348 (43%), Gaps = 93/348 (26%)

Query: 354 EENDASIAFSKMFTRKRANTGGSTCSLASPTIAQTIQQSNIKVNKLPTQRTTSVGSLSSM 413
           +ENDASIAFSKMFTRKRANTGGS  S  S T  QTI   NI  N         + + S  
Sbjct: 392 DENDASIAFSKMFTRKRANTGGSLSSFVSNT--QTISPYNIPGN---------ISTHSIP 440

Query: 414 SNRYSPIRVASPGRARSATRGSSLYRLSRDLNS----------LPSVTDLPEMDSTTPV- 462
           S RYSPIR  SPGR RS TRGS  +R +RDL+S          L S +     + + PV 
Sbjct: 441 SQRYSPIRSHSPGRPRSNTRGSLTHRNTRDLSSAYLSANNVSGLSSQSGAALFNPSEPVV 500

Query: 463 -NEIFLDGQPQHKSGSVKGGHRKKQESISDAQRIQHSNSYITTPSSSLVTPPYYM-TGYT 520
             + F+D Q  +KS   + G +KK + + D ++                  PY    G++
Sbjct: 501 GMDTFIDSQ--YKS---RYGQKKKHDGVCDTRK------------------PYQAPAGFS 537

Query: 521 LPXXXXXXXTPNVLETHNMNFVPSTSTVTSYRPSSNFSSFDKEYSNENDASGEFSAFNTP 580
                    TP+V +   +   P +  +  +      +SF  +  +E             
Sbjct: 538 STSSTSHASTPSVADAGGLGSGPLSMDLNGFWALERDTSFIHDVYDE------------- 584

Query: 581 MENIPALKGIPRSTLEENEEEDVLVQDIPNTAHFQRRDIMGMDTHRKDDSLDFNSLMPHG 640
            + +P+ KGI  +T+EE+EE +V +  +PNT++  +   +              SL P  
Sbjct: 585 -QPLPSAKGIQAATIEEDEEVEVDLGSLPNTSNSSKCIEL--------------SLEPST 629

Query: 641 STTSSSIVDSVMXXXXXXXXXXXXXXYFQDQDKYTLVNTGLGLSDANL 688
           S  SSS                    Y+ +   +TL+NTGLG +   L
Sbjct: 630 SVGSSSC------------------QYYHETQGFTLINTGLGATTVAL 659

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/189 (36%), Positives = 94/189 (49%), Gaps = 42/189 (22%)

Query: 24  TNKWKIPHYYRRSASGSTQASPDRNSSTGS--CSTPVLPTM---------NVMSSPKKVL 72
           T+KWKIPHYY++++S +     D N +T S  C+T   PTM         N+M++P  V 
Sbjct: 22  TSKWKIPHYYKKASSVTQTVISDLNPATSSQQCAT-YSPTMALNGGNNRINIMNTPVAVQ 80

Query: 73  LEDPRDNHT-KAKKSSRKKSGEMVFVNYTVQDTANENDTDLQTQPVSVXXXXXXXXXXXX 131
           LEDP    T K +K+  KK+GEMVFVN+TVQDT     T+   +P S             
Sbjct: 81  LEDPDQPKTRKGQKAKAKKNGEMVFVNFTVQDT-----TESPKKPKS-----------SR 124

Query: 132 XXXXXXIFGSSKNEHIE--DIVEEQPMVLQMDSESKPLSGTPISESGIDASSLTTKRSYN 189
                 IF SS+   +   D+ E  P  L  +  S P S TP S S         KR+Y+
Sbjct: 125 REKMLRIFKSSEQLKLRPHDLGELAP-SLSKEPRSAPAS-TPASAS---------KRNYS 173

Query: 190 SFLKHNRLN 198
           SFLK  ++ 
Sbjct: 174 SFLKCGKIG 182

>KLLA0C17666g 1562996..1565368 some similarities with sp|P33306
           Saccharomyces cerevisiae YER167w BCK2 suppressor of
           mutations in protein kinase C pathway components
           singleton, hypothetical start
          Length = 790

 Score = 87.0 bits (214), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 87/154 (56%), Gaps = 23/154 (14%)

Query: 354 EENDASIAFSKMFTRKRANTGGSTCSLASPTIAQTIQQSNIKVNKLPT----QRTTSVGS 409
           +ENDAS+AFSK+FTRKR NTGGS  SL S +  Q           +P     Q +TSV S
Sbjct: 415 DENDASVAFSKLFTRKRTNTGGSISSLLSLSATQP---------SIPALDRHQSSTSVTS 465

Query: 410 LSSMSNRYSPIRVASPGRARSATRGSSLYRLSRDLNSLPSVTDLPEMDST-TPVNEIFLD 468
               S RYSPIR  S  R RS TR S+ +RLSRDL SL +   +   DS+  P  E +LD
Sbjct: 466 ----SMRYSPIRSGSQNRTRSNTRTSN-HRLSRDLTSLQTSMKISNTDSSELPGMESYLD 520

Query: 469 GQPQHKSGSVKGGHRKKQESISDAQRIQHSNSYI 502
               H  G+ K  HRKKQESISD  R+  +   +
Sbjct: 521 ---THNKGN-KPTHRKKQESISDMARLHSAQGAV 550

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 12/55 (21%)

Query: 62  MNVMSSPKKVLL-EDPRDNHTKAKKSSRKKS-----------GEMVFVNYTVQDT 104
           +N+M+SP ++ L E P    TKA K+S+ K             EMVFVNY+VQDT
Sbjct: 104 VNIMASPVQIKLSEPPALRETKAVKTSKSKKNGAGGSGSNGKNEMVFVNYSVQDT 158

>Scas_636.16d
          Length = 620

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 65/125 (52%), Gaps = 12/125 (9%)

Query: 352 LPEENDASIAFSKM-----FTRKRANTGGSTCSLASPTIAQTIQQSNIKVNKLPTQRTTS 406
           + EENDA+IAF+++     F  +         S  +   +Q++ Q     + +   R  S
Sbjct: 232 ISEENDAAIAFNRIHSAEPFPIEERMDAIRAFSKITNKRSQSLSQVPTMKSNIQKNRNMS 291

Query: 407 VGSLSS-MSN--RYSPIRVASPGRARSATRGSSLYRLSRDLNSLPSVTDLPEMDSTTPVN 463
           V S+SS MSN  +YSP+   +PGR RS+ +  S YR S++  SL ++ D  E    T  +
Sbjct: 292 VTSVSSNMSNLSKYSPLGTVTPGRRRSSVQRHSFYRSSKEWLSLYNIHDHVE----TQQD 347

Query: 464 EIFLD 468
           E FLD
Sbjct: 348 ETFLD 352

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 19/23 (82%)

Query: 731 VYTEFDFENPESFFHEQSKLLGE 753
            Y+EFDF+NP SFFHEQ +L+ +
Sbjct: 566 AYSEFDFDNPNSFFHEQCRLIND 588

>KLLA0A00715g complement(69861..71636) similar to sp|P43620
           Saccharomyces cerevisiae YFR048w, hypothetical start
          Length = 591

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 380 LASPTIAQTIQQSNIKVNKLPTQRTTSVGSLSSMSNRYSPIRVASPGRARSATRGSSLYR 439
           L + T++  I QS +K+++   +     GS+S +  R +        R +   +   L++
Sbjct: 430 LTALTLSHAIAQS-VKLSRFEARIVPIFGSVSKLPKRLALYGTLGLKREQLLKKSGKLFK 488

Query: 440 LSRDLNSLPSVTDLPEM 456
           L  D+N   SV D PE 
Sbjct: 489 LRVDVNLSSSVLDTPEF 505

>KLLA0A08734g 763946..767434 similar to sp|P34111 Saccharomyces
           cerevisiae YAL001c TFC3 TFIIIC (transcription initiation
           factor) subunit 138 kD singleton, start by similarity
          Length = 1162

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 59/128 (46%), Gaps = 10/128 (7%)

Query: 156 MVLQMDSESKPLSGTPISESGIDASSLTTKRSYNSFLKHNRLNGKTPFSGNLSFPSLNM- 214
           M ++ D      +GT I+ +G   SSL + +   + L   + +G   F G+  + S++  
Sbjct: 523 MKIEHDEPQIARNGTSITVNGFTGSSLKSIQRQKALLTVLKNSGGVRFIGDKFYDSISKS 582

Query: 215 MGNTTDLPIDNNDFCSEKEVVPKSTHDPSLAKPPSRFTESETNSTPNLSSIP----LMNT 270
           MG  TD+ +D      E E++ +S     +  P +R         P +S       L+++
Sbjct: 583 MG--TDMILDKKTLKKESEILAESGKLKIVEDPNTR---RRLLCLPEISDEKIEEYLIDS 637

Query: 271 KNTRLKYN 278
           K+TR K+N
Sbjct: 638 KDTRGKFN 645

>YPL167C (REV3) [5280] chr16 complement(232592..237106) DNA
           polymerase zeta catalytic subunit, involved in mutagenic
           translesion DNA repair synthesis [4515 bp, 1504 aa]
          Length = 1504

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 558 SSFDKE---YSNENDASGEFSAFNTPMENIPALK-GIPRSTLEENEEEDVLVQDIPNTAH 613
           S+FD +   + N  D + +FSA NTP E +P L   +P+  +  N  +D    D  N A 
Sbjct: 361 STFDGQIPNFENFIDKNQKFSAINTPYEALPQLWPRLPQIEINNNSMQDKKNDDQVN-AS 419

Query: 614 FQRRDIMGMD 623
           F   +I G+D
Sbjct: 420 FTEYEICGVD 429

>AFR265C [3457] [Homologous to ScYFR048W - SH] (910793..912568)
           [1776 bp, 591 aa]
          Length = 591

 Score = 30.0 bits (66), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 384 TIAQTIQQSNIKVNKLPTQRTTSVGSLSSMSNRYSPIRVASPGRARSATRGSSLYRLSRD 443
           T++  I QS  K+++   + T  +G++S +  R +        R +   +   L++L  D
Sbjct: 433 TLSHAIAQST-KLSRFEKRITPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVD 491

Query: 444 LNSLPSVTDLPEM 456
           +N   SV D PE 
Sbjct: 492 VNLSSSVLDTPEF 504

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.307    0.123    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,255,180
Number of extensions: 1227130
Number of successful extensions: 4697
Number of sequences better than 10.0: 103
Number of HSP's gapped: 4765
Number of HSP's successfully gapped: 129
Length of query: 837
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 727
Effective length of database: 12,788,129
Effective search space: 9296969783
Effective search space used: 9296969783
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)