Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER166W (DNF1)1571154383390.0
Scas_576.81591156563100.0
CAGL0L11814g1576156860630.0
YDR093W (DNF2)1612157758960.0
Scas_636.161554155256800.0
KLLA0C17644g1576157954200.0
CAGL0G08085g1578157152920.0
AGR120C1547143850300.0
CAGL0G06270g1328103917440.0
Kwal_26.70701315104217310.0
KLLA0A04015g1343104217250.0
YAL026C (DRS2)1355104617120.0
ADR350W1311105816800.0
ADL079C11669939281e-104
Kwal_56.234672802868421e-102
YIL048W (NEO1)11518929051e-101
Kwal_23.578911338899011e-101
Sklu_2193.111438918991e-100
CAGL0L00715g11448918981e-100
Scas_704.3811618948787e-98
KLLA0C08393g11489328432e-93
CAGL0H04477g16265778225e-89
Kwal_23.355615975418145e-88
KLLA0E01650g15505387974e-86
YMR162C (DNF3)16565407951e-85
AFL191W15755637611e-81
Scas_669.316386767565e-81
Scas_505.410253766191e-65
Scas_89.12712904032e-43
Kwal_26.920714693251682e-11
Scas_665.3014393341664e-11
AFR567W14494231655e-11
CAGL0M11308g14523291611e-10
Kwal_47.1754712406501593e-10
KLLA0B08217g14393221558e-10
YOR291W14723361442e-08
YEL031W (SPF1)12153521432e-08
YGL006W (PMC1)11733441387e-08
CAGL0L01419g12143261361e-07
AFR354C12103601361e-07
KLLA0E22352g12063151315e-07
KLLA0A08910g12801911234e-06
Scas_583.14*8753231163e-05
AFL011W12421911154e-05
CAGL0I04312g9511851092e-04
KLLA0F20658g10824201083e-04
AEL301W9571941073e-04
YDR040C (ENA1)10916691046e-04
CAGL0A00517g11221871030.001
YDR039C (ENA2)10916711000.002
KLLA0E14630g1082667970.004
YGL167C (PMR1)950182930.012
YDR038C (ENA5)1091422920.018
KLLA0A03157g938174890.036
Kwal_14.1498939208880.057
Scas_297.180067860.075
Scas_710.4190454860.098
Kwal_23.31601100407850.11
CAGL0A00495g90254850.12
Scas_688.191354850.12
YPL036W (PMA2)94754840.17
YGL008C (PMA1)91854830.19
Scas_707.48*741181820.24
AGL097C1096411820.25
AGL085C90954810.37
YDR270W (CCC2)1004115790.53
Kwal_47.1752289954790.58
KLLA0A09031g89954790.61
CAGL0J01870g94656780.81
Scas_502.444657751.3
CAGL0M07293g151564761.5
AGL041C123356733.0
CAGL0K12034g1087410733.1
KLLA0F07447g975166723.9
Scas_569.0d468162714.0
KLLA0D04092g115265724.2
Sklu_2128.2106076724.2
CAGL0D03410g543133714.5
Scas_227.0d307291705.4
ADR117W42651697.9
YGR125W1036158698.8
YNL272C (SEC2)75997699.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER166W
         (1543 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...  3216   0.0  
Scas_576.8                                                           2435   0.0  
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...  2340   0.0  
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...  2275   0.0  
Scas_636.16                                                          2192   0.0  
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...  2092   0.0  
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...  2043   0.0  
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...  1942   0.0  
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...   676   0.0  
Kwal_26.7070                                                          671   0.0  
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...   669   0.0  
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...   664   0.0  
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...   651   0.0  
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...   362   e-104
Kwal_56.23467                                                         328   e-102
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...   353   e-101
Kwal_23.5789                                                          351   e-101
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement         350   e-100
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...   350   e-100
Scas_704.38                                                           342   7e-98
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...   329   2e-93
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...   321   5e-89
Kwal_23.3556                                                          318   5e-88
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...   311   4e-86
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...   310   1e-85
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...   297   1e-81
Scas_669.3                                                            295   5e-81
Scas_505.4                                                            243   1e-65
Scas_89.1                                                             159   2e-43
Kwal_26.9207                                                           69   2e-11
Scas_665.30                                                            69   4e-11
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    68   5e-11
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    67   1e-10
Kwal_47.17547                                                          66   3e-10
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    64   8e-10
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    60   2e-08
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    60   2e-08
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    58   7e-08
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    57   1e-07
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    57   1e-07
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    55   5e-07
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    52   4e-06
Scas_583.14*                                                           49   3e-05
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    49   4e-05
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    47   2e-04
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    46   3e-04
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    46   3e-04
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    45   6e-04
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    44   0.001
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    43   0.002
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    42   0.004
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    40   0.012
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    40   0.018
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    39   0.036
Kwal_14.1498                                                           39   0.057
Scas_297.1                                                             38   0.075
Scas_710.41                                                            38   0.098
Kwal_23.3160                                                           37   0.11 
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    37   0.12 
Scas_688.1                                                             37   0.12 
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    37   0.17 
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    37   0.19 
Scas_707.48*                                                           36   0.24 
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    36   0.25 
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    36   0.37 
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    35   0.53 
Kwal_47.17522                                                          35   0.58 
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    35   0.61 
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    35   0.81 
Scas_502.4                                                             33   1.3  
CAGL0M07293g complement(733072..737619) similar to sp|Q02785 Sac...    34   1.5  
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    33   3.0  
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    33   3.1  
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    32   3.9  
Scas_569.0d                                                            32   4.0  
KLLA0D04092g complement(344666..348124) some similarities with s...    32   4.2  
Sklu_2128.2 YCR092C, Contig c2128 573-3755 reverse complement          32   4.2  
CAGL0D03410g complement(351075..352706) highly similar to sp|P40...    32   4.5  
Scas_227.0d                                                            32   5.4  
ADR117W [1858] [Homologous to ScYOL097C (WRS1) - SH] complement(...    31   7.9  
YGR125W (YGR125W) [2082] chr7 (742328..745438) Member of the sul...    31   8.8  
YNL272C (SEC2) [4337] chr14 complement(126803..129082) Guanine n...    31   9.1  

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 3216 bits (8339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1543/1543 (100%), Positives = 1543/1543 (100%)

Query: 1    MSGTFHGDGHAPMSPFEDTFQFEDNSSNEDTHIAPTHFDDGATSNKYSRPQVSFNDETPK 60
            MSGTFHGDGHAPMSPFEDTFQFEDNSSNEDTHIAPTHFDDGATSNKYSRPQVSFNDETPK
Sbjct: 1    MSGTFHGDGHAPMSPFEDTFQFEDNSSNEDTHIAPTHFDDGATSNKYSRPQVSFNDETPK 60

Query: 61   NKREDAEEFTFNDDTEYDNHSFQPTPKLNNGSGTFDDVELDNDSGEPHTNYDGMKRFRMG 120
            NKREDAEEFTFNDDTEYDNHSFQPTPKLNNGSGTFDDVELDNDSGEPHTNYDGMKRFRMG
Sbjct: 61   NKREDAEEFTFNDDTEYDNHSFQPTPKLNNGSGTFDDVELDNDSGEPHTNYDGMKRFRMG 120

Query: 121  TKRNKKGNPIMGRSKTLKWARKNIPNPFEDFTKDDIDPGAINRAQELRTVYYNMPLPKDM 180
            TKRNKKGNPIMGRSKTLKWARKNIPNPFEDFTKDDIDPGAINRAQELRTVYYNMPLPKDM
Sbjct: 121  TKRNKKGNPIMGRSKTLKWARKNIPNPFEDFTKDDIDPGAINRAQELRTVYYNMPLPKDM 180

Query: 181  IDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNP 240
            IDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNP
Sbjct: 181  IDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNP 240

Query: 241  GLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVENENVSTDNISLWRRFK 300
            GLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVENENVSTDNISLWRRFK
Sbjct: 241  GLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVENENVSTDNISLWRRFK 300

Query: 301  KANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQKTVGTSGPRSSLDSIDSYRVSAD 360
            KANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQKTVGTSGPRSSLDSIDSYRVSAD
Sbjct: 301  KANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQKTVGTSGPRSSLDSIDSYRVSAD 360

Query: 361  YGRPSLDYDNLEQGAGEANIVDRSLPPRTDCKFAKNYWKGVKVGDIVRIHNNDEIPADII 420
            YGRPSLDYDNLEQGAGEANIVDRSLPPRTDCKFAKNYWKGVKVGDIVRIHNNDEIPADII
Sbjct: 361  YGRPSLDYDNLEQGAGEANIVDRSLPPRTDCKFAKNYWKGVKVGDIVRIHNNDEIPADII 420

Query: 421  LLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRTSKDIARTKFWIESEGPHSNLYT 480
            LLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRTSKDIARTKFWIESEGPHSNLYT
Sbjct: 421  LLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRTSKDIARTKFWIESEGPHSNLYT 480

Query: 481  YQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMGVVMFTGGDTKIMLNSGITPT 540
            YQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMGVVMFTGGDTKIMLNSGITPT
Sbjct: 481  YQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMGVVMFTGGDTKIMLNSGITPT 540

Query: 541  KKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKKGRSRFSYEFGTIAGSAATNGFV 600
            KKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKKGRSRFSYEFGTIAGSAATNGFV
Sbjct: 541  KKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKKGRSRFSYEFGTIAGSAATNGFV 600

Query: 601  SFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQ 660
            SFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQ
Sbjct: 601  SFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQ 660

Query: 661  VEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVETEGRREKAEIA 720
            VEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVETEGRREKAEIA
Sbjct: 661  VEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVETEGRREKAEIA 720

Query: 721  KDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASGEVQQRCCEHFMLALALCHSV 780
            KDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASGEVQQRCCEHFMLALALCHSV
Sbjct: 721  KDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASGEVQQRCCEHFMLALALCHSV 780

Query: 781  LVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLIIEMQGIQKEFEILNIL 840
            LVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLIIEMQGIQKEFEILNIL
Sbjct: 781  LVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLIIEMQGIQKEFEILNIL 840

Query: 841  EFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEKTALHL 900
            EFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEKTALHL
Sbjct: 841  EFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEKTALHL 900

Query: 901  EQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIERELILLGG 960
            EQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIERELILLGG
Sbjct: 901  EQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIERELILLGG 960

Query: 961  TAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKTTGD 1020
            TAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKTTGD
Sbjct: 961  TAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKTTGD 1020

Query: 1021 DVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIVIDGDALKLA 1080
            DVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIVIDGDALKLA
Sbjct: 1021 DVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIVIDGDALKLA 1080

Query: 1081 LYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQS 1140
            LYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQS
Sbjct: 1081 LYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQS 1140

Query: 1141 ADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFAL 1200
            ADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFAL
Sbjct: 1141 ADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFAL 1200

Query: 1201 ALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQDVNDTISLVVPQLYRVGI 1260
            ALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQDVNDTISLVVPQLYRVGI
Sbjct: 1201 ALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQDVNDTISLVVPQLYRVGI 1260

Query: 1261 LRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLDHRYFVGVYVTTIAV 1320
            LRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLDHRYFVGVYVTTIAV
Sbjct: 1261 LRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLDHRYFVGVYVTTIAV 1320

Query: 1321 ISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAIASREFFKAAARIYGAPSFWA 1380
            ISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAIASREFFKAAARIYGAPSFWA
Sbjct: 1321 ISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAIASREFFKAAARIYGAPSFWA 1380

Query: 1381 VFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHGHFDHYPPGYDPTDPNRPKVTKA 1440
            VFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHGHFDHYPPGYDPTDPNRPKVTKA
Sbjct: 1381 VFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHGHFDHYPPGYDPTDPNRPKVTKA 1440

Query: 1441 GQHGEKIIEGIALSDNLGGSNYSRDSVVTEEIPMTFMHGEDGSPSGYQKQETWMTSPKET 1500
            GQHGEKIIEGIALSDNLGGSNYSRDSVVTEEIPMTFMHGEDGSPSGYQKQETWMTSPKET
Sbjct: 1441 GQHGEKIIEGIALSDNLGGSNYSRDSVVTEEIPMTFMHGEDGSPSGYQKQETWMTSPKET 1500

Query: 1501 QDLLQSPQFQQAQTFGRGPSTNVRSSLDRTREQMIATNQLDNR 1543
            QDLLQSPQFQQAQTFGRGPSTNVRSSLDRTREQMIATNQLDNR
Sbjct: 1501 QDLLQSPQFQQAQTFGRGPSTNVRSSLDRTREQMIATNQLDNR 1543

>Scas_576.8
          Length = 1591

 Score = 2435 bits (6310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1165/1565 (74%), Positives = 1348/1565 (86%), Gaps = 29/1565 (1%)

Query: 1    MSGT---FHGDGHAPMSPFEDTFQFED-NSSNEDTHIAPTHFDDGATSNKY---SRPQVS 53
            MSG    F  +G+ PMSPF+D FQFED +   +  H + T  ++ ++SN Y   S    S
Sbjct: 1    MSGNTNPFEDNGNNPMSPFDDNFQFEDIDFDAQPNHSSNTTANNTSSSNAYHGDSTHLTS 60

Query: 54   FNDETPKNKREDAEEFTFNDDTEYDNHSFQPTPKLNNGSGTFDDVELDNDSGEPH----- 108
            F+D   K      E  +F++D + D HSF+PTP++   +G FDD+ L+ND  +P      
Sbjct: 61   FDDSKEK------ESLSFHEDVDNDIHSFEPTPRIGTSNGAFDDISLENDDHDPSSSHHH 114

Query: 109  -TNYDGMKRFRMGTKRNKKGNPIMGRSKTLKWARKNIPNPFEDFT-KDDI--DPGAINRA 164
             T+ + MKR RMGT+RNKKG P +GR+KTLKWA+K   NPFE+   +DDI  D G  NRA
Sbjct: 115  STSENIMKRLRMGTQRNKKGKPTVGRAKTLKWAQKTFVNPFEESNNRDDIFDDAGLTNRA 174

Query: 165  QELRTVYYNMPLPKDMIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFL 224
             ELRTVYYNMPLPK+M+DE+G PI  YPRNKIRTTKY+PL F PKNI+FQF NFANVYFL
Sbjct: 175  SELRTVYYNMPLPKEMVDEDGKPITDYPRNKIRTTKYSPLNFFPKNIMFQFQNFANVYFL 234

Query: 225  VLIILGAFQIFGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVE 284
            VLIILGAFQIFGVTNPGL+AVPL+VIVIITAIKDAIEDSRRT+LD+EVNNT+THILEGV+
Sbjct: 235  VLIILGAFQIFGVTNPGLAAVPLIVIVIITAIKDAIEDSRRTLLDMEVNNTRTHILEGVD 294

Query: 285  NENVSTDNISLWRRFKKANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQKTV---G 341
            N NVS DN+SLWRRFKKAN+RLL KFI+YCK H TEEG++KR Q KRH LR Q      G
Sbjct: 295  NGNVSVDNVSLWRRFKKANTRLLMKFIEYCKSHFTEEGRQKRRQHKRHILRSQTAAINGG 354

Query: 342  TSGPRSSLDSIDSYRVSADYGRPSLDYDNLEQGA---GEANIVDRSLPPRTDCKFAKNYW 398
                R+SLDSI SYR+S DYGRPSL+YD + Q A     ANI+DRSLPPR+DCKF+K+YW
Sbjct: 355  IDMARNSLDSIGSYRMSGDYGRPSLEYDTVGQSALKTDNANIMDRSLPPRSDCKFSKDYW 414

Query: 399  KGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRT 458
            K VKVGDIVRIHNNDEIPADIILLSTSD+DG CY+ETKNLDGETNLKVR+SLKC+++IR 
Sbjct: 415  KNVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRESLKCSHSIRN 474

Query: 459  SKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWA 518
            S+DIARTKFW+ESEGPH+NLY+YQGN+KW +  DG+++NEP+TINN+LLRGCTLRNTKWA
Sbjct: 475  SRDIARTKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLRGCTLRNTKWA 534

Query: 519  MGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKK 578
            MG+V+FTG DTKIMLNSG TPTKKSRISRELN SV +NF+ LFI+CF+S I NGV YDK 
Sbjct: 535  MGMVVFTGDDTKIMLNSGATPTKKSRISRELNLSVSLNFLFLFIICFISAIINGVDYDKH 594

Query: 579  GRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 638
             RSR  +EFGT+AGSA+TNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL
Sbjct: 595  PRSRDFFEFGTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 654

Query: 639  YNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 698
            YNAKLDYPCTPKSWNISDD+GQ+EYIFSDKTGTLTQNVMEFKKCTING+SYGRAYTEALA
Sbjct: 655  YNAKLDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKKCTINGISYGRAYTEALA 714

Query: 699  GLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGA 758
            GLRKRQGIDVE EGRREK EIAKDRDTMI+ LR LS NSQFYP+++TF+SKEFV DLKGA
Sbjct: 715  GLRKRQGIDVEEEGRREKEEIAKDRDTMINTLRNLSHNSQFYPDDITFISKEFVNDLKGA 774

Query: 759  SGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGK 818
            SG++QQ+CCEHFMLALALCHSVLVE N  + KKLD+KAQSPDEAALV TARDVGFSF+GK
Sbjct: 775  SGDMQQKCCEHFMLALALCHSVLVEPNKHDSKKLDVKAQSPDEAALVCTARDVGFSFIGK 834

Query: 819  TKKGLIIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIY 878
            TK GLIIE+QG+QKEF+ILN LEFNS+RKRMSCIVKIPG NP DEPRALLICKGADSIIY
Sbjct: 835  TKTGLIIEVQGVQKEFQILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSIIY 894

Query: 879  SRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLA 938
            SRL  ++G+NSE +LEKTALHLEQYATEGLRTLCIAQRELSW EY +WN++YDIAAAS+ 
Sbjct: 895  SRLGTKNGANSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAASVT 954

Query: 939  NREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAIN 998
            NRE++LE V+D IEREL LLGGTAIEDRLQDGVP+ I +LA+AGIKLWVLTGDKVETAIN
Sbjct: 955  NREEQLEAVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVETAIN 1014

Query: 999  IGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAK 1058
            IGFSCNLLNN+MELLV+KT GDDV+EFG++P+EI ++L++KYL+E F LTGSE E+ +AK
Sbjct: 1015 IGFSCNLLNNDMELLVVKTNGDDVQEFGNDPAEIAESLITKYLREKFGLTGSEMELADAK 1074

Query: 1059 KDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVK 1118
            K+H+FP+G++A+VIDG+ALKLAL GE IRRKFLLLCKNC+AVLCCRVSP+QKAAVVKLV 
Sbjct: 1075 KNHDFPRGDFAVVIDGEALKLALNGESIRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVM 1134

Query: 1119 DSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGR 1178
             SLDVMTLAIGDGSNDVAMIQSADVG+GIAGEEGRQAVMCSDYAIGQFRYL RLVLVHGR
Sbjct: 1135 TSLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYLTRLVLVHGR 1194

Query: 1179 WSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLG 1238
            WSY+RLAEMIP FFYKN+IF LALFWYGIYN+FDGSYL+EYT++MFYNLAFTSLPVIF+G
Sbjct: 1195 WSYRRLAEMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMFYNLAFTSLPVIFMG 1254

Query: 1239 ILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIV 1298
            I+DQDV+DT+SLV+PQLYR GILR +WNQ KFLWYMLDGLYQS ICFFFPY +YHKN IV
Sbjct: 1255 IMDQDVSDTVSLVMPQLYRSGILRLDWNQTKFLWYMLDGLYQSCICFFFPYCLYHKNQIV 1314

Query: 1299 TSNGLGLDHRYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSS 1358
            ++NGLGLDHR++VGV VT++AV+SCN Y+LLHQYRWDWFS LFI LSC+++F WTG+WSS
Sbjct: 1315 SNNGLGLDHRFYVGVMVTSLAVVSCNIYMLLHQYRWDWFSCLFIGLSCIILFFWTGVWSS 1374

Query: 1359 AIASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHG 1418
            ++ S+EFFKAA+RIYGAPSFW VFFV +++CLLPRFT D F+KFFYPTDVEIVREMWQ G
Sbjct: 1375 SLTSKEFFKAASRIYGAPSFWGVFFVGIVYCLLPRFTLDCFRKFFYPTDVEIVREMWQRG 1434

Query: 1419 HFDHYPPGYDPTDPNRPKVTKAGQHGEKIIEGIALSDNLGGSNYSRDSVVTEEIPMTFMH 1478
             F HYPPGYDPTDPNRPKV K+G+ GE+I+EGI LS + G +N+S +SV TEEIPM  +H
Sbjct: 1435 DFSHYPPGYDPTDPNRPKVAKSGKFGERIVEGIHLSQSFGENNFSHESVATEEIPMNILH 1494

Query: 1479 GEDGSPSGYQKQETWMTSPKETQDLLQSPQFQQAQTFGRGPSTNVRSSLDRTREQMIATN 1538
             + G       Q+ W +SPKETQDLL SP+  Q Q   R  S   RSSL+RTRE M+ATN
Sbjct: 1495 TDAGQTIRRDTQDQWASSPKETQDLLFSPRLNQEQE-QRQKSNLGRSSLERTREDMLATN 1553

Query: 1539 QLDNR 1543
            QLDNR
Sbjct: 1554 QLDNR 1558

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 2340 bits (6063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1128/1568 (71%), Positives = 1326/1568 (84%), Gaps = 48/1568 (3%)

Query: 1    MSGTFH-GDGHAPMSPFEDTFQFE--DNSSNEDTHIAPTHFDDGATSNKYSRPQVSFNDE 57
            MSG+   G+G    SPF+D F+FE  DN+ N  +          +  N ++    ++ND 
Sbjct: 1    MSGSNKPGNGDFITSPFDDAFEFEEGDNTVNNSS----------SNGNGHTSGSGNWND- 49

Query: 58   TPKNKREDAEEFTFNDDTEYDNHSFQPTPKLNNG-SGTFDDVELDNDSGEPHTNYDGMKR 116
                 + + +E T  DDT+ +  S QPTP L    +G FDDV LDND     +    MKR
Sbjct: 50   ---GHKMEEKETTLADDTDIEISSIQPTPHLGGAKTGMFDDVALDNDDHNDSSRE--MKR 104

Query: 117  FRMGTKRNKK-----GNPIMGRSKTLKWARKNIPNPFEDFTKDDIDPG--AINRAQELRT 169
             RMGT+R K      GN  M R+KTLKWA+KNI NPF+DF++D+ +    + NRA +LRT
Sbjct: 105  LRMGTRRVKGHKSQFGN--MSRNKTLKWAKKNIKNPFDDFSRDEEEENDRSTNRADQLRT 162

Query: 170  VYYNMPLPKDMIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIIL 229
            VY+N+PLP++M+DEEGNPIM+YPRNKIRTTKYTPL+F PKN+LFQF NFANVYFLVLIIL
Sbjct: 163  VYHNLPLPEEMLDEEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIIL 222

Query: 230  GAFQIFGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVENENVS 289
            GAFQIFGVTNPGLSAVPL+VIVIITAIKD IEDSRRT+LDLEVNNT+THILEGV NENVS
Sbjct: 223  GAFQIFGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHILEGVVNENVS 282

Query: 290  TDNISLWRRFKKANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQKTVGTSGPRSSL 349
             DN+SLWRRFKKANSRLL +FIQ+CKE +TE+GK++R+QR+R +LR     G  GPR+SL
Sbjct: 283  VDNVSLWRRFKKANSRLLMQFIQWCKERMTEDGKRRRLQRQRRKLRKSTRNG-HGPRNSL 341

Query: 350  DSIDSYRVSADY-GRPSLDYDNLEQGAGE---ANIVDRSLPPRTDCKFAKNYWKGVKVGD 405
            DS+DSYR SADY  RPSLDYDN+    GE    +I+DR+LPPRTD +FA++YWK VKVGD
Sbjct: 342  DSMDSYRPSADYYNRPSLDYDNMGHIVGEDEDVDIIDRTLPPRTDTRFARDYWKSVKVGD 401

Query: 406  IVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRTSKDIART 465
            IVRIHNNDEIPADIILLSTSD+DG CYVETKNLDGETNLKVRQ+LKC+  I+TS+DIART
Sbjct: 402  IVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKTSRDIART 461

Query: 466  KFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMGVVMFT 525
            +FWIESEGPH+NLY+YQGN+KW++  + E+RNEP+TINN+LLRGCTLRNTKWAMG+V+FT
Sbjct: 462  RFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWAMGIVVFT 521

Query: 526  GGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKKGRSRFSY 585
            G DTKIMLN+G+TPTKKSRISRELNFSV+INF++LFILCF+SG+ANG+ YDK  RSR  +
Sbjct: 522  GDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKHPRSRDFF 581

Query: 586  EFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDY 645
            EFGT+AG+ ATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDY
Sbjct: 582  EFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDY 641

Query: 646  PCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQG 705
            PCTPKSWNISDDLGQ+EYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQG
Sbjct: 642  PCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQG 701

Query: 706  IDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASGEVQQR 765
            IDVE EGRREK EIAKDRD MI++LR LS N+QF+P+E+TF+SKE V+D KG +G++Q++
Sbjct: 702  IDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGRNGDIQKK 761

Query: 766  CCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLII 825
            CCEHFMLALALCHSVL E +P NP KL++KAQSPDEAALV TARD+GF F+GKTK G+++
Sbjct: 762  CCEHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGKTKTGMVV 821

Query: 826  EMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQS 885
            E+QGIQKEFEILNILEFNS+RKRMSCI+KIPG  P DEPRALLICKGADS+IYSRLS ++
Sbjct: 822  EIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKA 881

Query: 886  GSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELE 945
            G N E +LEKTALHLEQYATEGLRTLC+AQREL+WSEY +WN +YDIAAASL NRE++LE
Sbjct: 882  GENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLE 941

Query: 946  VVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNL 1005
            +V+DSIER+LILLGGTAIEDRLQDGVP+ I LLAEAGIKLWVLTGDKVETAINIGFSCNL
Sbjct: 942  IVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNL 1001

Query: 1006 LNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPK 1065
            LNN+MELLV+KT G+DV E+G +P E+V++L+SKYL+E F L+GSE E+  AK DH FPK
Sbjct: 1002 LNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPK 1061

Query: 1066 GNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMT 1125
            G++A+VIDGDALK+AL G+D++RKFLLLCKNC+AVLCCRVSP+QKAAVVKLVK++LDVMT
Sbjct: 1062 GDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMT 1121

Query: 1126 LAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKRLA 1185
            LAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYL RL+LVHGRWSYKRL+
Sbjct: 1122 LAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLVHGRWSYKRLS 1181

Query: 1186 EMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQDVN 1245
            EMIPEFFYKN+IF LALFWYGIYN+FDGSYL+EYTY+MFYNLAFTS+PVI LGILDQDVN
Sbjct: 1182 EMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLGILDQDVN 1241

Query: 1246 DTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGL 1305
            DTISLVVPQLYRVGILR EWNQ KFLWYM DGLYQS+ICFFFPYL+Y +N +VT NG+GL
Sbjct: 1242 DTISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVTKNGMGL 1301

Query: 1306 DHRYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAIASREF 1365
            +HRY+VG+ VTTIAV +CN Y+L+HQYRWDWFSG FI LSC+VV  WTGIW+S+  S + 
Sbjct: 1302 EHRYYVGIIVTTIAVFACNLYILIHQYRWDWFSGFFIFLSCIVVIGWTGIWTSSFTSLDL 1361

Query: 1366 FKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHGHFDHYPP 1425
            +KA  RIY +PSFWAVFF+ V FCLLPRFT+D + +FF P+DV+I+REMW+ G +DHYP 
Sbjct: 1362 WKAGERIYDSPSFWAVFFIGVFFCLLPRFTWDCYTQFFNPSDVQIIREMWKRGDYDHYPV 1421

Query: 1426 GYDPTDPNRPKVTKAGQHGEKIIEGIALSD-NLGGSNYSRDSVVTEEIPMTFMHGEDGSP 1484
            GYDPTDPNRPK++K  + GE++ +GI L D    G N SRDSV TEEIPM  + G DG+P
Sbjct: 1422 GYDPTDPNRPKISKGAKFGERLGQGIVLEDETYAGGNVSRDSVFTEEIPMNIISGTDGTP 1481

Query: 1485 SGYQ--------KQETWMTSPKETQDLLQSPQFQQAQTFGRGP-STNVRSSLDRTREQMI 1535
             G++         Q  W +  +E Q+LL SPQ       G G     VR S+DRTR+ M+
Sbjct: 1482 RGFEMSGRTPDIPQTQWESPEREEQNLLNSPQ----ANVGLGTFEQTVRQSIDRTRDSML 1537

Query: 1536 ATNQLDNR 1543
            A  +LDNR
Sbjct: 1538 ANRELDNR 1545

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 2275 bits (5896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1091/1577 (69%), Positives = 1303/1577 (82%), Gaps = 58/1577 (3%)

Query: 8    DGHAPMSPFEDTFQFEDNSS-NEDTHIAPTHFDDGATSNKYSRP----------QVSFN- 55
            +G + MSPF+D+FQFE  SS + +  +A T    G+   + S+P          +V+F+ 
Sbjct: 24   NGLSSMSPFDDSFQFEKPSSAHGNIEVAKT---GGSVLKRQSKPMKDISTPDLSKVTFDG 80

Query: 56   -------------DETPKNKREDAEEFTFNDDTEYDNHSFQPTPKLNNGSGTFDDVELDN 102
                         DE    K E  E     DD   D HSFQ TP  N  +G F+DVELDN
Sbjct: 81   IDDYSNDNDINDDDELNGKKTEIHEHENEVDD---DLHSFQATPMPN--TGGFEDVELDN 135

Query: 103  DSGEPHTNY--DGMKRFRMGTKRNKKGNPIMGRSKTLKWARKNIPNPFEDFT--KDDIDP 158
            + G  + +     +KR R GT+RNK G   + RSKTLKWA+KN  N  ++F+  +D ++ 
Sbjct: 136  NEGSNNDSQADHKLKRVRFGTRRNKSGRIDINRSKTLKWAKKNFHNAIDEFSTKEDSLEN 195

Query: 159  GAI-NRAQELRTVYYNMPLPKDMIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHN 217
             A+ NR+ ELRTVYYN+PLP+DM+DE+G P+  YPRNKIRTTKYTPLTF PKNILFQFHN
Sbjct: 196  SALQNRSDELRTVYYNLPLPEDMLDEDGLPLAVYPRNKIRTTKYTPLTFFPKNILFQFHN 255

Query: 218  FANVYFLVLIILGAFQIFGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKT 277
            FAN+YFL+L+ILGAFQIFGVTNPG ++VPL+VIVIITAIKD IEDSRRTVLDLEVNNT+T
Sbjct: 256  FANIYFLILLILGAFQIFGVTNPGFASVPLIVIVIITAIKDGIEDSRRTVLDLEVNNTRT 315

Query: 278  HILEGVENENVSTDNISLWRRFKKANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQ 337
            HIL GV+NENV+ DN+SLWRRFKKAN+R L K  +Y  E+LT  G++K++Q+KR ELR +
Sbjct: 316  HILSGVKNENVAVDNVSLWRRFKKANTRALIKIFEYFSENLTAAGREKKLQKKREELRRK 375

Query: 338  KTVGTSGPRSSLDSIDSYRVSADYGRPSLDYDNLEQGAGEAN-------IVDRSLPPRTD 390
            +   + GPR SLDSI SYR+SAD+GRPSLDY+NL Q   +AN       +VDR+L P  +
Sbjct: 376  RNSRSFGPRGSLDSIGSYRMSADFGRPSLDYENLNQTMSQANRYNDGENLVDRTLQPNPE 435

Query: 391  CKFAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSL 450
            C+FAK+YWK VKVGDIVR+HNNDEIPAD+ILLSTSD DGACYVETKNLDGETNLKVRQSL
Sbjct: 436  CRFAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSL 495

Query: 451  KCTNTIRTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGC 510
            KC+  I++S+DI RTKFW+ESEGPH+NLY+YQGN KW++  +G IRNEP+ INN+LLRGC
Sbjct: 496  KCSKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGC 555

Query: 511  TLRNTKWAMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIA 570
            TLRNTKWAMG+V+FTG DTKIM+N+G+TPTKKSRISRELNFSV++NFVLLFILCF +GI 
Sbjct: 556  TLRNTKWAMGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIV 615

Query: 571  NGVYYDKKGRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAA 630
            NGVYY +K RSR  +EFGTI GSA+TNGFVSFWVAVILYQSLVPISLYISVEIIKTAQA 
Sbjct: 616  NGVYYKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAI 675

Query: 631  FIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYG 690
            FIY DVLLYNAKLDYPCTPKSWNISDDLGQ+EYIFSDKTGTLTQNVMEFKKCTINGVSYG
Sbjct: 676  FIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYG 735

Query: 691  RAYTEALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKE 750
            RAYTEALAGLRKRQG+DVE+EGRREK EIAKDR+TMIDELR++S N+QF PE++TFVSKE
Sbjct: 736  RAYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKE 795

Query: 751  FVRDLKGASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARD 810
             V DLKG+SG+ QQ+CCEHF+LALALCHSVLVE N D+PKKLD+KAQSPDE+ALV+TAR 
Sbjct: 796  IVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQ 855

Query: 811  VGFSFVGKTKKGLIIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLIC 870
            +G+SFVG +K GLI+E+QG+QKEF++LN+LEFNSSRKRMSCI+KIPG  P DEP+ALLIC
Sbjct: 856  LGYSFVGSSKSGLIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLIC 915

Query: 871  KGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKY 930
            KGADS+IYSRL R    N   +LEKTALHLE+YATEGLRTLC+AQREL+WSEYE+W + Y
Sbjct: 916  KGADSVIYSRLDRTQ--NDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTY 973

Query: 931  DIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTG 990
            D+AAAS+ NRE+EL+ V D IERELILLGGTAIEDRLQDGVPD I LLAEAGIKLWVLTG
Sbjct: 974  DVAAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTG 1033

Query: 991  DKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGS 1050
            DKVETAINIGFSCN+LNN+MELLV+K +G+DV+EFGS+P ++V+ L++KYL+E F ++GS
Sbjct: 1034 DKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGS 1093

Query: 1051 EEEIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQK 1110
            EEE+ EAK++H  P+GN+A++IDGDALK+AL GE++RRKFLLLCKNC+AVLCCRVSP+QK
Sbjct: 1094 EEELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPAQK 1153

Query: 1111 AAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLA 1170
            AAVVKLVK +LDVMTLAIGDGSNDVAMIQSADVG+GIAGEEGRQAVMCSDYAIGQFRY+ 
Sbjct: 1154 AAVVKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVT 1213

Query: 1171 RLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFT 1230
            RLVLVHG+W YKRLAEMIP+FFYKN+IF L+LFWYGIYN+FDGSYL+EYTY+ FYNLAFT
Sbjct: 1214 RLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFT 1273

Query: 1231 SLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYL 1290
            S+PVI L +LDQDV+DT+S++VPQLYRVGILRKEWNQ KFLWYMLDG+YQS+ICFFFPYL
Sbjct: 1274 SVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPYL 1333

Query: 1291 VYHKNMIVTSNGLGLDHRYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALSCLVVF 1350
             YHKNM+VT NGLGLDHRYFVGV+VT IAV SCN YV + QYRWDWF GLFI LS  V +
Sbjct: 1334 AYHKNMVVTENGLGLDHRYFVGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSLAVFY 1393

Query: 1351 AWTGIWSSAIASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQKFFYPTDVEI 1410
             WTGIW+S+ +S EF+K AAR++  P++WAV FV VLFCLLPRFT D  +K FYP D+EI
Sbjct: 1394 GWTGIWTSSSSSNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIFYPKDIEI 1453

Query: 1411 VREMWQHGHFDHYPPGYDPTDPNRPKVTKAGQHGEKIIEGIALSDNLGGSNYSRDSVVTE 1470
            VREMW  G FD YP GYDPTDP+RP++ +     +   E I+L  +  G ++S++++VTE
Sbjct: 1454 VREMWLRGDFDLYPQGYDPTDPSRPRINEIRPLTD-FKEPISLDTHFDGVSHSQETIVTE 1512

Query: 1471 EIPMTFMHGEDGSPSGYQKQETW----MTSPKETQDLLQSPQFQQAQTFGRGPSTNVRSS 1526
            EIPM+ ++GE GS  GY+   T       SP  T + L  P+   A   G      +R+S
Sbjct: 1513 EIPMSILNGEQGSRKGYRVSTTLERRDQLSPVTTTNNL--PRRSMASARG----NKLRTS 1566

Query: 1527 LDRTREQMIATNQLDNR 1543
            LDRTRE+M+A +QLD R
Sbjct: 1567 LDRTREEMLANHQLDTR 1583

>Scas_636.16
          Length = 1554

 Score = 2192 bits (5680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1056/1552 (68%), Positives = 1264/1552 (81%), Gaps = 46/1552 (2%)

Query: 5    FHGDGH---APMSPFEDTFQFEDNSSNEDTHIAPTHFDDGATSNKYSRPQVSFNDETPKN 61
            F   GH    P+SPF+D+FQFED                               D+T   
Sbjct: 6    FQDRGHDRENPLSPFDDSFQFED------------------------------KDKTNSF 35

Query: 62   KREDAEEFTFNDDTEYDN-HSFQPTPKLNNGSGTFDDVELDNDSGEPHTNYDGMKRFRMG 120
             + DA      ++T+YD+  S  PTP +  G+  F+D+EL+++   P+++   MKR R+G
Sbjct: 36   LKGDAVTVEDVEETKYDDSSSILPTPVV-GGTAQFEDIELNSEL--PNSSETEMKRLRLG 92

Query: 121  TKRNKK-GNPIMGRSKTLKWARKNIPNPF----EDFTKDDIDPGAINRAQELRTVYYNMP 175
            TKR K+  N    ++KT+KWA+KN+  PF    ED   DD + G +NR+ E RT+Y+NMP
Sbjct: 93   TKRVKRETNFDRNKTKTIKWAQKNVHIPFKKHDEDADVDDNETGLLNRSDEFRTIYHNMP 152

Query: 176  LPKDMIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIF 235
            LP +M+ E+G PIM+YPRNKIRTTKYTPLTF PKN++ QF+NFAN+YFL++IILGAFQIF
Sbjct: 153  LPDEMLYEDGLPIMEYPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIF 212

Query: 236  GVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVENENVSTDNISL 295
            GVTNPGL+AVPL+VI+I+TAIKDAIEDSRRT+LD+EVNNT+THIL+G EN NV  DN+S 
Sbjct: 213  GVTNPGLAAVPLIVIIILTAIKDAIEDSRRTLLDMEVNNTRTHILQGPENPNVPIDNVSS 272

Query: 296  WRRFKKANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQKTVGTSGPRSSLDSIDSY 355
            WR+FKKAN++L+ KF Q+  E  T  GK+ R QR+    R +K   T  PR+SLDS  S 
Sbjct: 273  WRKFKKANTKLMLKFFQFINERFTATGKEARKQRQMKRRRAKKLGKTELPRTSLDSYQST 332

Query: 356  RVSADYGRPSLDYDNLEQG--AGEANIVDRSLPPRTDCKFAKNYWKGVKVGDIVRIHNND 413
            R+SADY RPSL+  N++     GE +++D SLPP  + KFA ++WK V+VGDIVRIHNND
Sbjct: 333  RMSADYYRPSLEQSNIDSTFENGEISVLDPSLPPMANSKFANDFWKNVRVGDIVRIHNND 392

Query: 414  EIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRTSKDIARTKFWIESEG 473
            EIPAD+ILLSTSD DG CYVETKNLDGE+NLKVRQSL+CTN IR S+DI RTKFW+ESEG
Sbjct: 393  EIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNSRDICRTKFWVESEG 452

Query: 474  PHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMGVVMFTGGDTKIML 533
            PH+NLY YQGN+KW +  DG+  NEPITINN+LLRGCTLRNTKWAMG+V+FTG DTK M+
Sbjct: 453  PHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWAMGIVVFTGDDTKTMI 512

Query: 534  NSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKKGRSRFSYEFGTIAGS 593
            N+G+TPTKKSRISRELNFSV+INFV LFILC ++G+ANG YY KK RSR  +EFGTIAG+
Sbjct: 513  NAGVTPTKKSRISRELNFSVLINFVFLFILCLIAGVANGAYYRKKPRSRDFFEFGTIAGN 572

Query: 594  AATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWN 653
              TNGFVSFWVAVILYQSLVPISLYISVEIIKTAQA FIY DVLLYN +LDYPCTPKSW+
Sbjct: 573  PTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPKSWS 632

Query: 654  ISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVETEGR 713
            ISDDLGQ+EYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGID E EGR
Sbjct: 633  ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDTEKEGR 692

Query: 714  REKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASGEVQQRCCEHFMLA 773
             E+  IA+DR+ MID+LR +S NSQFYPEE+TFVSKEF +DL G +GEVQQ+ C+HFMLA
Sbjct: 693  IEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGNNGEVQQKRCQHFMLA 752

Query: 774  LALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLIIEMQGIQKE 833
            LALCHSVLVE + ++P KL+L AQSPDE ALV TARD+GFSF+GKTK+GL++E+QGIQKE
Sbjct: 753  LALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQGLLVEVQGIQKE 812

Query: 834  FEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAIL 893
            F+ILNILEFNSSRKRMSCIVK+P     DEPRALLICKGADS+IYSRLSR+ G N E +L
Sbjct: 813  FQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLL 872

Query: 894  EKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIER 953
            EKTALHLEQYATEGLRTLC+ QRE+SWSEY++WNEKY+IAAASLA RE+EL+ VAD IER
Sbjct: 873  EKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIER 932

Query: 954  ELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELL 1013
            +L+LLGGTAIEDRLQDGVPD I LLAEAGIKLWVLTGDKVETAINIGFSCNLLN +MELL
Sbjct: 933  DLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELL 992

Query: 1014 VIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIVID 1073
            VIKTTG+DVKEFG +P+EIV+AL+SKYL E FN+TGSEEE+  AKKDH  P+G +AI+ID
Sbjct: 993  VIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEFAIIID 1052

Query: 1074 GDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSN 1133
            G+ALK+AL G+ ++RKFLLLCKNC+AVLCCRVSP+QKAAVVKLVKD+LDVMTLAIGDGSN
Sbjct: 1053 GEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSN 1112

Query: 1134 DVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKRLAEMIPEFFY 1193
            DVAMIQSADVG+GIAGEEGRQAVMCSDYAIGQFRY+ RLVLVHG+W YKRLAEMIP+FFY
Sbjct: 1113 DVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFY 1172

Query: 1194 KNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQDVNDTISLVVP 1253
            KN+IF LALFWYG++NDFDGSYL+EYTY+ FYNLAFTSLPVIFLGILDQDV+ T+S++VP
Sbjct: 1173 KNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQDVSATVSMIVP 1232

Query: 1254 QLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLDHRYFVGV 1313
            QLYR GILR+EWNQ KFLWYM DG+YQS+IC+FFPYL+Y K  I+T NGLGLDHRY+VG+
Sbjct: 1233 QLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGLDHRYYVGI 1292

Query: 1314 YVTTIAVISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAIASREFFKAAARIY 1373
             VT IAV SCN YVL+ QYRWDWF+  F  LS +V F WTGIWSS+IAS EF+K A+R+Y
Sbjct: 1293 PVTGIAVTSCNFYVLMEQYRWDWFTTFFAFLSTIVYFGWTGIWSSSIASYEFWKGASRMY 1352

Query: 1374 GAPSFWAVFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHGHFDHYPPGYDPTDPN 1433
            G PSFWAV+FV  LFC+LPRFTYD F K+ YP+DVEI+REMWQHG F  YP  YDPTDPN
Sbjct: 1353 GTPSFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQHGDFARYPDDYDPTDPN 1412

Query: 1434 RPKVTKAGQHGEKIIEGIALSDNLGGSNYSRDSVVTEEIPMTFMHGEDGSPSGYQKQETW 1493
            +PKV KA + G+  I   ++ D +  ++ S+ ++VTEEIPM+F+  +  S +   +++  
Sbjct: 1413 KPKVEKAHEWGQYKIVDESIGDAVVCASDSQGTIVTEEIPMSFLDVKKDSSNQVTREKQV 1472

Query: 1494 MTSPKETQDLLQSP--QFQQAQTFGRGPSTNVRSSLDRTREQMIATNQLDNR 1543
                 +  D  +      + +  F    S+ VR+SLDRTR++M+A+NQLD R
Sbjct: 1473 SRDSLDEDDARRDSMNNARNSMQFRPSSSSRVRTSLDRTRDEMLASNQLDTR 1524

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 2092 bits (5420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1030/1579 (65%), Positives = 1220/1579 (77%), Gaps = 80/1579 (5%)

Query: 2    SGTFHGDGHAPMSPFEDTFQFEDN---SSNEDTHI--------------APTHFDDGATS 44
            SG+F  D  +P SPF D F FE     +SN D  I                +   +G+TS
Sbjct: 15   SGSFKDDS-SPDSPFNDRFVFEQGNQFASNLDGTIDNEADGSKTKLKGRQGSILKNGSTS 73

Query: 45   N-----KYSRPQVSFND--ETPKNKREDAEEFTFNDDTEYDNHSFQPTPKLNNGSGTFDD 97
            +     K    Q++F D  +T   K E+ EE +F      D  S+  TP +N G+   D+
Sbjct: 74   SPSKIGKKKNQQLTFGDTGKTSDLKNEEFEEISFETTGADDQRSYVNTPIINQGNFAVDE 133

Query: 98   VELDNDSGEPHTNYDG--MKRFRMGTKRNKKGNPIMGRSKTLKWARKNIPNPFEDFTK-- 153
             +      +  +  D   +KR R GT+R+KKG P MGR+KTL+W +KN  NPF D T   
Sbjct: 134  EDEREKDRQLSSAEDSKHVKRMRWGTRRDKKGKPAMGRAKTLRWTKKNFHNPFADDTNLA 193

Query: 154  -------DDIDPG--AINRAQELRTVYYNMPLPKDMIDEEGNPIMQYPRNKIRTTKYTPL 204
                   DD D      +R +E RT+YYN+PLP+D++DE+GN  + YPRNKIRTTKYTPL
Sbjct: 194  AEGHSSDDDNDENYDKSHRQRETRTIYYNLPLPEDILDEDGNSTIYYPRNKIRTTKYTPL 253

Query: 205  TFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPGLSAVPLVVIVIITAIKDAIEDSR 264
            TF PKNI FQF N ANVYFLVLII+G FQIFGV NPGL+ VPL+VIV++T+ KDAIEDSR
Sbjct: 254  TFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVIVVLTSFKDAIEDSR 313

Query: 265  RTVLDLEVNNTKTHILEGVENENVSTDNISLWRRFKKANSRLLFKFIQYCKEHLTEEGKK 324
            RT+LD+EVNN  THIL+GVEN NVS D +SLWR+FKKAN+R+LF+FI  C+E  TEEGKK
Sbjct: 314  RTILDMEVNNAPTHILKGVENVNVSNDKVSLWRKFKKANTRVLFRFIHLCQELFTEEGKK 373

Query: 325  KRMQRKRHELRVQKTVGTSGPRSSLDSIDSYRVSADYGRPSLDYDNLEQGAGEANIVDRS 384
            +R QRKRHE+   K   T  PR+SLDS+ SYR S +        D  E+G  +  ++D S
Sbjct: 374  QRAQRKRHEMH-NKIRQTQTPRNSLDSVGSYRNSME---SEFGGDLTERGKDDLCLLDPS 429

Query: 385  LPPRTDCKFAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNL 444
            LP   DCKFAK+YWK V VGDIVR+HNNDEIPADIILLS+SD+DGACYVETKNLDGETNL
Sbjct: 430  LPVLPDCKFAKDYWKSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNL 489

Query: 445  KVRQSLKCTNTIRTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINN 504
            KVRQSLKC++ IR S++I RTKF +ESEGPHSNLY+YQGN+KW +   G  +NEP+ INN
Sbjct: 490  KVRQSLKCSHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINN 549

Query: 505  VLLRGCTLRNTKWAMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILC 564
            +LLRGCTLRNTKWAMG+V+FTG DTKIMLN+G+TPTK SRISRELN SV +NF LLF+LC
Sbjct: 550  LLLRGCTLRNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLC 609

Query: 565  FVSGIANGVYYDKKGRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEII 624
            F +GI NGVYY     SR  +EFG+IAGSAA NG VSFWVA+ILYQS+VPISLYIS+EII
Sbjct: 610  FAAGIVNGVYYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEII 669

Query: 625  KTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTI 684
            KTAQA FIYGDV LYN +LDYPCTPKSW ISDDLGQ+EYIFSDKTGTLTQNVMEFKKCTI
Sbjct: 670  KTAQALFIYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTI 729

Query: 685  NGVSYGRAYTEALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEV 744
            NGVSYGRAYTEALAGLRKRQGIDVE EG  EK  IA+D++ M+  L+ L  NSQ  PE V
Sbjct: 730  NGVSYGRAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENV 789

Query: 745  TFVSKEFVRDLKGASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAAL 804
            TFVSKEFV+D  GA+GE Q++C E+FMLALALCH+VLVE N D+P+ +D KAQSPDEAAL
Sbjct: 790  TFVSKEFVQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAAL 849

Query: 805  VATARDVGFSFVGKTKKGLIIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEP 864
            V TARD+GFSFVG+TK G+I+++QG+QKE+ +LN+LEFNS+RKRMSCI+KIP  NP +EP
Sbjct: 850  VGTARDMGFSFVGRTKNGVIVDIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEP 909

Query: 865  RALLICKGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYE 924
            RALLICKGADSIIYSRLS+   +N E +LEKTALHLEQYATEGLRTLCIAQRELSW EY+
Sbjct: 910  RALLICKGADSIIYSRLSK---NNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQ 966

Query: 925  KWNEKYDIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIK 984
            +WNEK++IAAA+L +REDE+E VAD IEREL LLGGTAIEDRLQDGVPD I  L EAGIK
Sbjct: 967  EWNEKHEIAAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIK 1026

Query: 985  LWVLTGDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEY 1044
            LWVLTGDKVETAINIGFSCNLLNNEMELLVIK +GDDV  +GS+P+EIV  L+ KYL+E 
Sbjct: 1027 LWVLTGDKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEK 1086

Query: 1045 FNLTGSEEEIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCR 1104
            F ++GS EE+ EAKK HE P GN+ ++IDGDALKLAL  +D++R+FLLLCK C+AVLCCR
Sbjct: 1087 FQMSGSYEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCR 1146

Query: 1105 VSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIG 1164
            VSP+QKAAVVKLVK++LDVMTLAIGDGSNDVAMIQSAD+G+GIAGEEGRQAVM SDYAIG
Sbjct: 1147 VSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIG 1206

Query: 1165 QFRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMF 1224
            QFRYL RLVLVHGRWSYKR+AEMIP FFYKN+IF L+LFWYG+YN++DGSYL+EYTY+  
Sbjct: 1207 QFRYLTRLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTL 1266

Query: 1225 YNLAFTSLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIIC 1284
            +NLAFTSLPVIFLGILDQDVND +S+VVPQLYRVGILR EWNQ KF  YM D +YQS+IC
Sbjct: 1267 FNLAFTSLPVIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVIC 1326

Query: 1285 FFFPYLVYHKNMIVTSNGLGLDHRYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIAL 1344
            FF PYL Y+K  IVT NG GLDHRY+VGV+V TIAV+SCNTYVLLHQYRWDWFS LFIAL
Sbjct: 1327 FFLPYLCYYKTGIVTQNGFGLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDWFSSLFIAL 1386

Query: 1345 SCLVVFAWTGIWSSAIASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQKFFY 1404
            SCL +FAWTGIWSS  +S EF+K+AA IYG P FWA+ F  +LFCLLPRF  D+F + + 
Sbjct: 1387 SCLCIFAWTGIWSSFTSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYM 1446

Query: 1405 PTDVEIVREMWQHGHFDHYPPGYDPTDPNRPKVTKAGQHGEKIIEGIALSDNLGGSNYSR 1464
            P D++I+RE W+ G FDHYP GYDPTDP+RPKV  A             + ++  +  S 
Sbjct: 1447 PKDIDIIRECWKRGDFDHYPEGYDPTDPDRPKVKNA----------FVYNKDIEMAQSST 1496

Query: 1465 DSVVTEEIPMTFMHGEDGSPSGYQKQETWMTSPKETQDLLQSPQFQQAQTFGRGPSTNVR 1524
            DS+ TEEIPM  +                 TSP+        P  +  ++ G       R
Sbjct: 1497 DSIQTEEIPMDELFNSSA------------TSPR------SYPHNRHQRSSG-------R 1531

Query: 1525 SSLDRTREQMIATNQLDNR 1543
             SL+ TR +M  +NQLDNR
Sbjct: 1532 PSLEITRAEMRNSNQLDNR 1550

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 2043 bits (5292), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1008/1571 (64%), Positives = 1232/1571 (78%), Gaps = 63/1571 (4%)

Query: 14   SPFED--------TFQFEDNSSNEDTHIAPTHFDDGATSNKYSRPQVSFNDETPKNKRED 65
            SPFED        +  F+D++  +D  + P   D   T+         F D  P  + +D
Sbjct: 5    SPFEDGVGGKEPISSPFDDSNRFQDVEMVPMEEDVKDTNTTVYD---EFGD-GPYKEEDD 60

Query: 66   AEEFTFNDDTEYDNHSFQPTPKLNNG-SGTF-----------DDVELDNDSGEPHTNYDG 113
             +          D++S +PTP +    +G F           DD+E     G+   +  G
Sbjct: 61   MD----------DDYSMEPTPIVGRSDNGQFNDDNRVLMFGPDDLERRAQPGKNRESKSG 110

Query: 114  --MKRFRMGTKRNKKG--NPIMGRSKTLKWARKNIPNPFEDFTKDDIDP----GAINRAQ 165
              +KR R GT+R +K      +GRSKTLKWA+KNI +P E+   ++ +     G  N+A 
Sbjct: 111  DQIKRLRWGTQRRRKSFKRYDIGRSKTLKWAKKNIQDPLEELIGNENEATDETGMRNKAD 170

Query: 166  ELRTVYYNMPLPKDMIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLV 225
            ELR +Y+N PLP+DM+DE+  P+  YPRNKIRTTKYTPLTFLPKNIL QFHNFAN+YFL+
Sbjct: 171  ELRNIYFNQPLPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLI 230

Query: 226  LIILGAFQIFGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVEN 285
            LIILGAFQIFGVTNPG SAVPL+VI+IITAIKD IEDSRRTVLDLEVNNTKTH+L G+EN
Sbjct: 231  LIILGAFQIFGVTNPGFSAVPLIVIIIITAIKDGIEDSRRTVLDLEVNNTKTHVLTGIEN 290

Query: 286  ENVSTDNISLWRRFKKANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQKTVGTSGP 345
             NVS D+ISLWRRFKKANSR++  F+Q C+E LT++G+ ++ QRKR     +K +     
Sbjct: 291  YNVSADDISLWRRFKKANSRIIASFVQVCRETLTKKGRLEKAQRKRQMANHKKNLNRKF- 349

Query: 346  RSSLDSIDSYRVSADYG-----RPSLDYDNLEQGAGEANIVDRSLPPRTDCKFAKNYWKG 400
            R+SL+S  S R+S D       RPS D +  +Q   E  +++++LP   + +F+K+YWK 
Sbjct: 350  RNSLNSYRSNRMSRDVRPSMDFRPSTDINGYQQN--EDTLINKTLPTDMEWRFSKDYWKN 407

Query: 401  VKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRTSK 460
            VKVGDIVRIHNN+EIPADIILLSTSD+DGACYVETKNLDGETNLKVRQS+KCT+ IR+S 
Sbjct: 408  VKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRSSI 467

Query: 461  DIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMG 520
            DIART+FWIESEGPH+NLY+YQGN +W +L D +++NEP+ INN+LLRGCTLRNTKWAMG
Sbjct: 468  DIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWAMG 527

Query: 521  VVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKKGR 580
            VV FTG DTKIMLN+G+TPTKKSRIS+ELN SV+ NF LLF+LCF++G+ NG+Y++K  R
Sbjct: 528  VVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKHPR 587

Query: 581  SRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYN 640
            SR  ++FGT  G +AT+GFVSFWVAVILYQSLVPISLYISVEIIKTAQA FIY DV++YN
Sbjct: 588  SRDFFDFGTGTGGSATSGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMMYN 647

Query: 641  AKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGL 700
             KLDYPCTPKSWNISDDLGQ+EYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGL
Sbjct: 648  EKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGL 707

Query: 701  RKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASG 760
            RKRQG+DV  E + EK  I +DR+ MI++L+ L+ NSQFY +EVTFVSKEFV DL G SG
Sbjct: 708  RKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGGSG 767

Query: 761  EVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTK 820
             VQQ+ C+HFMLALALCHSVL E + ++P KL++KAQSPDEAALV TARD+GFSF+ KTK
Sbjct: 768  SVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFSFLKKTK 827

Query: 821  KGLIIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSR 880
            +G+++E+QGI+KEF+ILNILEFNSSRKRMSCIVKIPG +   +P+ALLICKGADS+IYSR
Sbjct: 828  EGMVLEVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSR 887

Query: 881  LSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANR 940
            L + +G N E++LEKTALHLEQYATEGLRTLC+AQRELSW EYE+WN+KYDIAAA++ +R
Sbjct: 888  LDK-TGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDR 946

Query: 941  EDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIG 1000
            E+ELE V+D IER LILLGGTAIEDRLQDGVPD I LL EAGIKLWVLTGDKVETAINIG
Sbjct: 947  EEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIG 1006

Query: 1001 FSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKD 1060
            FSCNLLNN+MELLVIKTTG DV++ G+ P +IVD L+S+YL + F + GSEEE+ +AK +
Sbjct: 1007 FSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAE 1066

Query: 1061 HEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDS 1120
            H+ P+G +A++IDG+ALK AL  ED++RKFLLLCKNC++VLCCRVSP+QKAAVVKLVK++
Sbjct: 1067 HDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNT 1126

Query: 1121 LDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWS 1180
            LDVMTLAIGDGSNDVAMIQSA++G+GIAGEEGRQAVM SDYAIGQFRYL RL+LVHG+W 
Sbjct: 1127 LDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWC 1186

Query: 1181 YKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGIL 1240
            YKRLAEMIP+FFYKNMIF LALFW+GIYND+DGSYL+EYTY+ FYNLAFTS+PVI LGI 
Sbjct: 1187 YKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIF 1246

Query: 1241 DQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIVTS 1300
            DQDV+DTISLV PQLYRVGILRKEW+Q KFLWYMLDGLYQS+I FFFPYL+Y ++MIVTS
Sbjct: 1247 DQDVSDTISLVFPQLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTS 1306

Query: 1301 NGLGLDHRYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAI 1360
            NGLGLDHRY+VGV VT IA ISCN Y+L+ Q  WD F   F+ +S ++ F WTGIWSSA 
Sbjct: 1307 NGLGLDHRYYVGVPVTAIACISCNLYILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSSAS 1366

Query: 1361 ASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHGHF 1420
             S EF+  AAR++G P+FWAV FV ++FCLLPRFT D F+++FYP D++I+REMW  G F
Sbjct: 1367 RSNEFYHGAARVFGTPTFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREMWSRGDF 1426

Query: 1421 DHYPPGYDPTDPNRPKVTKAGQHGEKIIEGIALSDNLGGSNYSRDSVVTEEIPMTFMHG- 1479
            D +P  YDPTDP   K+  +        E    + N   S+ S + +++EEIP+    G 
Sbjct: 1427 DSFPKKYDPTDPEVHKIAMSDIRVFSGAESKEFNSNSNTSSSSSEDILSEEIPLELGKGM 1486

Query: 1480 -EDGSPSGYQKQ------ETWMTSPKETQDLLQSPQFQQAQTFGRGPSTNVRSSLDRTRE 1532
             + G  S Y+        + ++        +L   Q ++  T+ R  +   R+SLDRTRE
Sbjct: 1487 NDSGKKSEYESGVGDEILKYYLGKDSNRNTILTDNQ-KRLSTYSRASN---RTSLDRTRE 1542

Query: 1533 QMIATNQLDNR 1543
             M+ATNQLD R
Sbjct: 1543 DMLATNQLDTR 1553

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 1942 bits (5030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 940/1438 (65%), Positives = 1146/1438 (79%), Gaps = 46/1438 (3%)

Query: 114  MKRFRMGTKRNKKGNPIMGRSKTLKWARKNIPNPFEDFTK--DDIDPGAI--NRAQELRT 169
            MK  R GT+R++ G P+ GR++TL+W +KN  N  ED      D D G    +RA E R 
Sbjct: 123  MKILRWGTQRHRTGRPV-GRARTLRWGKKNYDNLPEDRGSGGSDTDAGVAGKSRAAEKRA 181

Query: 170  VYYNMPLPKDMIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIIL 229
            VY+NMPLP ++  E G P++ YPRNKIRTTKYTPL+FLPKN+ +QF N AN+YFL+L+ L
Sbjct: 182  VYFNMPLPPELTGENGRPVVNYPRNKIRTTKYTPLSFLPKNLAYQFKNAANIYFLLLVCL 241

Query: 230  GAFQIFGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVENENVS 289
                IFGVTNP L+A+PL+ IV+IT +KDA EDSRRT+LDLEVNN ++HIL GVEN NVS
Sbjct: 242  SFVSIFGVTNPALAAIPLIAIVVITGLKDAFEDSRRTILDLEVNNMRSHILHGVENNNVS 301

Query: 290  TDNISLWRRFKKANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQKTVGTSGPRSSL 349
             DN+SLWR+FKK N+RLL   +++ +E  TE G+++R QR R E ++  +   S PR SL
Sbjct: 302  ADNVSLWRKFKKLNTRLLIATVRFFRESFTEAGRRRRAQRAREESQMAASRLGSDPRMSL 361

Query: 350  DSIDSYRVSADYGRPSLDYDNLEQ--GAGEANIVDRSLPPRTDCKFAKNYWKGVKVGDIV 407
            DS+ SYR       PSLD+DN+ Q   + + ++++R+LPP  DC+F K++WK ++VGDIV
Sbjct: 362  DSMGSYR-------PSLDFDNIGQLVSSDQVSVLNRNLPPVPDCRFGKSHWKDIRVGDIV 414

Query: 408  RIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRTSKDIARTKF 467
            RIHNNDEIPADIILLSTSD DGACYVETKNLDGETNLKVRQSLKC++ IR SKDI+R KF
Sbjct: 415  RIHNNDEIPADIILLSTSDADGACYVETKNLDGETNLKVRQSLKCSHRIRNSKDISRCKF 474

Query: 468  WIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMGVVMFTGG 527
            W+ESEGPH+NLY+YQGN KW +   G + NEP+ INN+LLRGC+LRNTKWAMG+VMFTG 
Sbjct: 475  WVESEGPHANLYSYQGNFKWVDSETGVMHNEPVNINNMLLRGCSLRNTKWAMGIVMFTGT 534

Query: 528  DTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKKGRSRFSYEF 587
            DTKIMLN+G+TPTK+SRISRELN+SV++NFV LF+LC  +G+ NG+YY +   SR  +EF
Sbjct: 535  DTKIMLNAGVTPTKRSRISRELNYSVILNFVFLFVLCLAAGLVNGIYYRRDATSRTFFEF 594

Query: 588  GTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPC 647
            GT+AG+   NG ++F+VA+ILYQSLVPISLYIS+EIIKTAQAAFIYGDVLLYN KLDYPC
Sbjct: 595  GTVAGTPFANGILAFFVALILYQSLVPISLYISIEIIKTAQAAFIYGDVLLYNPKLDYPC 654

Query: 648  TPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGID 707
            TP++WNISDDLGQ+EYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQG+D
Sbjct: 655  TPRTWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVD 714

Query: 708  VETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASGEVQQRCC 767
            +E EG RE+AEI +D+  M++ L  L  NSQ  P  VTFVSKE V+DL GA+ + Q+   
Sbjct: 715  IEEEGARERAEIEEDKKQMVELLLKLGKNSQLDPHTVTFVSKELVQDLGGANSQEQKEAV 774

Query: 768  EHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLIIEM 827
            EHFML+LALCHSV+VE N +NP+KLD+KAQSPDEAALV TARD+GFSFVG+TK G+IIE+
Sbjct: 775  EHFMLSLALCHSVVVEENKNNPEKLDIKAQSPDEAALVETARDMGFSFVGRTKNGVIIEI 834

Query: 828  QGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGS 887
            QG+QKEF ILN+LEFNS+RKRMSCIVKIP  +   +P+ALL+CKGADS+IYSRL R    
Sbjct: 835  QGVQKEFRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLLCKGADSVIYSRLDRSR-- 892

Query: 888  NSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVV 947
            N   +LE+TALHLEQ+ATEGLRTLC+AQRE+ W EY  WNE+ ++AAASL NRE+ LE V
Sbjct: 893  NDPKLLERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERRELAAASLDNREEALERV 952

Query: 948  ADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLN 1007
            AD+IER+L+LLGGTAIEDRLQDGVPD I +LA+AGIKLWVLTGDKVETAINIGFSCNLL 
Sbjct: 953  ADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKVETAINIGFSCNLLG 1012

Query: 1008 NEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGN 1067
            ++MELLVIK++G+DV+  G + S++V AL+ KYL+ +FN+ GS EE+  A+KDH  P+  
Sbjct: 1013 SDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNMKGSPEELAAARKDHTPPQSA 1072

Query: 1068 YAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLA 1127
            + +VIDGDALKLAL+GEDIRRKFLLLCKNC+AVLCCRVSPSQKAAVVKLVK+SLDV+TLA
Sbjct: 1073 FGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVLCCRVSPSQKAAVVKLVKESLDVVTLA 1132

Query: 1128 IGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKRLAEM 1187
            IGDGSNDVAMIQ+ADVGIGIAGEEGRQAVM +DYAIGQFRYL RLVLVHGRWSYKRLAEM
Sbjct: 1133 IGDGSNDVAMIQAADVGIGIAGEEGRQAVMSADYAIGQFRYLTRLVLVHGRWSYKRLAEM 1192

Query: 1188 IPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQDVNDT 1247
            IP+FFYKN+ F LALFW+GI +++DGSYL+EYTY+MFYNLAFTSLPVIFLGI+DQD +D 
Sbjct: 1193 IPQFFYKNITFTLALFWFGICSNYDGSYLFEYTYLMFYNLAFTSLPVIFLGIMDQDASDV 1252

Query: 1248 ISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLDH 1307
            +S+VVPQLY+VGILR EW Q KF WY  DG+YQSIICFFFPYL Y++  ++T N  GLDH
Sbjct: 1253 LSVVVPQLYKVGILRTEWTQNKFWWYCFDGVYQSIICFFFPYLCYYRTGLITKNAYGLDH 1312

Query: 1308 RYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAIASREFFK 1367
            RY  GV+VT+IAV+SCN YVL+HQYRWDWF+ LFI LSC ++F WTG+WSSA  S EF+K
Sbjct: 1313 RYTFGVFVTSIAVVSCNLYVLIHQYRWDWFTTLFIFLSCGILFFWTGVWSSATYSGEFYK 1372

Query: 1368 AAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHGHFDHYPPGY 1427
             A R+Y  P FWAV FV V+FCLLPRFT+D+ QK F+P D++IVRE W  G FD YP  Y
Sbjct: 1373 TAVRLYAQPVFWAVLFVGVIFCLLPRFTWDAVQKLFFPRDIDIVRECWWRGDFDMYPEDY 1432

Query: 1428 DPTDPNRPK--VTKAGQHGEKIIEGIALSDNLGGSNYSRDSVVTEEIPMTFMHGEDGSPS 1485
            DPTDPNRP+  V+  G       E      +LG    +R +V++E+IPM  +        
Sbjct: 1433 DPTDPNRPRINVSHTGVDRASDDERSRTGSDLG---VTRTTVISEDIPMGLID------- 1482

Query: 1486 GYQKQETWMTSPKETQDLLQSPQFQQAQTFGRGPSTNVRSSLDRTREQMIATNQLDNR 1543
                     T+P    D           T   G   + R SL+ TR +M+ T+QLD+R
Sbjct: 1483 --------KTAPHSRAD----------PTTPLGSEDSARYSLEVTRREMLQTHQLDSR 1522

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/1039 (38%), Positives = 579/1039 (55%), Gaps = 90/1039 (8%)

Query: 393  FAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKC 452
            F +  W  +KVGDI+R+++ + IPADII+LS+S+ +G CY+ET NLDGETNLK++Q+   
Sbjct: 277  FIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTE 336

Query: 453  TNTIRTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTL 512
            T  I  S+++   K  I SE P+S+LYTY+G ++            P++   ++LRG TL
Sbjct: 337  TAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEMNG------TKIPLSPEQMILRGATL 390

Query: 513  RNTKWAMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANG 572
            RNT W  G+V+FTG +TK+M N+  TP K++ + + +N  ++  F +L +L  +S I N 
Sbjct: 391  RNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNV 450

Query: 573  VYYDKKGRS-RFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAF 631
            +      +   + Y  GT         F++FW   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 451  IMSTADAKHLSYLYLQGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQAFM 507

Query: 632  IYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 691
            I  D+ LY  + D P   K+ ++ ++LGQ+EYIFSDKTGTLT+N+MEFK C+I G  Y  
Sbjct: 508  IGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAE 567

Query: 692  AYTEALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEF 751
               E  A   +  GI+V   G R   ++ K   T  D+ + +                  
Sbjct: 568  HIPEDKAATFE-DGIEV---GYRSFDDLKKQLTTNSDDCKII------------------ 605

Query: 752  VRDLKGASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDV 811
                            + F+  LA CH+V+ E   D   K   +A SPDE ALV     +
Sbjct: 606  ----------------DEFLTLLATCHTVIPEFQADGSIKY--QAASPDEGALVEGGALL 647

Query: 812  GFSFVGKTKKGLIIEM-QGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLIC 870
            G+ F+ +    + I + +  ++E+++LNI EFNS+RKRMS I + P      +    L+C
Sbjct: 648  GYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFP------DDSIKLLC 701

Query: 871  KGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKY 930
            KGADS+I  RLS       +A    T  HLE YATEGLRTLC+A +++   EY  WN+KY
Sbjct: 702  KGADSVILERLSETGNFYVDA----TTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKY 757

Query: 931  DIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTG 990
              AA +L +R ++L+ VA+ IE  L L+G TAIED+LQ+GVPD I  L EAGIK+WVLTG
Sbjct: 758  MDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTG 817

Query: 991  DKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGS 1050
            DK ETAINIG SC LL+ +M LL+I     +      E  E + AL    L E+      
Sbjct: 818  DKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNME--EKLAALHEHSLSEH------ 869

Query: 1051 EEEIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQK 1110
                              A+VIDG +L  AL   D+   FL + K C+AV+CCRVSP QK
Sbjct: 870  -------------DMNTLALVIDGHSLSFALEA-DLEDYFLAIGKMCKAVICCRVSPLQK 915

Query: 1111 AAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLA 1170
            A VVK+VK   + + LAIGDG+NDV+MIQ+A VG+GI+G EG QA   +D ++GQFR+L 
Sbjct: 916  ALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFLK 975

Query: 1171 RLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFT 1230
            +L+LVHG WSY+R++  I   FYKN    +  FWY   N F G  + E   M  YN+ FT
Sbjct: 976  KLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFT 1035

Query: 1231 SLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYL 1290
             LP   +G+ DQ VN  +    PQLY++G   + ++   F  ++++G Y S + F    L
Sbjct: 1036 VLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTIL 1095

Query: 1291 VYHKNMIVTSNGLGLDH-RYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALSC--- 1346
             Y     +  +G   DH  + + +Y +++ ++     ++ +Q  W  F+   I  S    
Sbjct: 1096 FYRYGFALRKHGETADHWSWGIAIYTSSVIIVLGKAALVTNQ--WTKFTLFAIPGSLFFW 1153

Query: 1347 LVVFAWTG-IWSSAIASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQKFFYP 1405
            L+ F   G I+  A  SRE+F      YG+ +FW    V   F L   F +  +++ + P
Sbjct: 1154 LIFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKRMYAP 1213

Query: 1406 TDVEIVREMWQHGHFDHYP 1424
                +++EM ++   D+ P
Sbjct: 1214 ESYHLIQEMQKYNVSDYRP 1232

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 57/105 (54%)

Query: 175 PLPKDMIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQI 234
           P    + D E N    Y  N I TTKY   TFLPK +  +F  +AN++FL    +     
Sbjct: 165 PREIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPH 224

Query: 235 FGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHI 279
              TN   +   L+V++I++AIK+++ED +R   D E+NN+K  I
Sbjct: 225 VSPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEI 269

>Kwal_26.7070
          Length = 1315

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/1042 (38%), Positives = 589/1042 (56%), Gaps = 94/1042 (9%)

Query: 393  FAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKC 452
            F  + W  + VGDI+++++ + IPAD+I++++S+ +G CY+ET NLDGETNLK++Q+   
Sbjct: 293  FTLSKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIE 352

Query: 453  TNTIRTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTL 512
            T+      D+A  +  + SE P+S+LYTY+G M   NL    I   P     ++LRG TL
Sbjct: 353  TSKFIDKDDLAGMRGKVLSEHPNSSLYTYEGTM---NLNGKNISLSP---EQMVLRGATL 406

Query: 513  RNTKWAMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANG 572
            RNT W  G+V+FTG +TK+M N+  TP K++ + R +N  +V  F +L +L  +S I N 
Sbjct: 407  RNTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNV 466

Query: 573  VYYDKKGRS-RFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAF 631
            +          + Y  GT          +++W   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 467  IKVTSDAEHLTYLYLQGTNKVGLFFKDILTYW---ILFSNLVPISLFVTVEMIKYYQAYM 523

Query: 632  IYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 691
            I  D+ LY+   D P   ++ ++ ++LGQ+EYIFSDKTGTLT+NVMEFK C+I G  Y  
Sbjct: 524  IASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIE 583

Query: 692  AYTEALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEF 751
               E  A   +  GI++   G R+        D+M                      KE 
Sbjct: 584  TIPEDKAATTE-DGIEI---GFRK-------FDSM----------------------KET 610

Query: 752  VRDLKGASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDV 811
            + D +     +       F+  LA CH+V+ E   D   K   +A SPDE ALV  A  +
Sbjct: 611  LNDTQDPDSHI----INDFLTLLATCHTVIPEFQEDGSIKY--QAASPDEGALVEGAASL 664

Query: 812  GFSFVGKTKKGL--IIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLI 869
            G+ F+ +    +  +IE  G ++E+++LNI EFNS+RKRMS I ++P           L 
Sbjct: 665  GYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLPN------GEIKLF 718

Query: 870  CKGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEK 929
            CKGAD++I  RL  ++G N    +E T  HLE YA EGLRTLC+A R ++ SEY +W + 
Sbjct: 719  CKGADTVILERL--KAGEN--PYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDI 774

Query: 930  YDIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLT 989
            YD A+ +L +R  +L+  A+ IE++L LLG TAIED+LQDGVP+ I  L +AGIK+WVLT
Sbjct: 775  YDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLT 834

Query: 990  GDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTG 1049
            GD+ ETA+NIG SC LL+ +M LL+I            E  E     L++ LK       
Sbjct: 835  GDRQETAVNIGMSCRLLSEDMNLLII----------NEEDKEATRKNLTEKLK------- 877

Query: 1050 SEEEIFEAKKDHEFPK---GNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVS 1106
                   A  DH+  +    + A+VIDG +L  AL   D+    L + K C+AV+CCRVS
Sbjct: 878  -------AISDHQISQQDMNSLALVIDGKSLGFALEA-DLEDYLLAIGKLCKAVICCRVS 929

Query: 1107 PSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQF 1166
            P QKA VVK+VK   D + LAIGDG+NDV+MIQ+A VG+GI+G EG QA   +D+AI QF
Sbjct: 930  PLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQF 989

Query: 1167 RYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYN 1226
            +YL +L+LVHG WSY+R+++ I   FYKN+   +  FWY   N + G  + E   M FYN
Sbjct: 990  KYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYN 1049

Query: 1227 LAFTSLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFF 1286
            + FT LP   +G+ DQ V+  +    PQLY++G   + ++ R F  ++++G Y S + F 
Sbjct: 1050 VFFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFI 1109

Query: 1287 FPYLVYHKNMIVTSNGLGLDHRYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALSC 1346
               L Y    ++ S+G   DH +  GV + T +VI       L   +W  F+   I  S 
Sbjct: 1110 GSTLFYRNGNVLNSHGETADH-WAWGVSIYTCSVIIVIGKAALVTNQWTKFTAFAIPGSL 1168

Query: 1347 LVVFAWTGIWSS----AIASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQKF 1402
            +    +  I++S    A  S+E++   + +YG+ +FW +  V   F L+    +  +++ 
Sbjct: 1169 VFWLVFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKRT 1228

Query: 1403 FYPTDVEIVREMWQHGHFDHYP 1424
            + P    +V+EM ++   D+ P
Sbjct: 1229 YTPESYHVVQEMQKYNIGDYRP 1250

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 55/99 (55%)

Query: 182 DEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPG 241
           D+E N    +  N I TTKY   TF+PK +  +F  +AN++FL    +        TN  
Sbjct: 188 DKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRY 247

Query: 242 LSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHIL 280
            +   L++++I++AIK+ +ED +R   D E+N+++  + 
Sbjct: 248 TTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVF 286

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/1042 (37%), Positives = 585/1042 (56%), Gaps = 93/1042 (8%)

Query: 392  KFAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLK 451
            +F +  W  + VGDI+R+ + + IPAD+I+LS+S+ +G CY+ET NLDGETNLK++Q+ +
Sbjct: 297  EFVRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQ 356

Query: 452  CTNTIRTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCT 511
             T      K + +    ++SE P+S+LYTY+G M             P++ + +LLRG T
Sbjct: 357  ETANYLDEKALCKLHGRVQSEHPNSSLYTYEGTMTLNG------STFPLSPDQMLLRGAT 410

Query: 512  LRNTKWAMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIAN 571
            LRNT W  G+++FTG +TK+M N+  TP K++ + R +N  ++  F +L +L  +S   N
Sbjct: 411  LRNTAWIFGLIVFTGHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGN 470

Query: 572  GVYYDKKGRSRFSYEF--GTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQA 629
             V   K+  +   Y +  GT          ++FW   IL+ +LVPISL+++VE+IK  QA
Sbjct: 471  -VIMTKRDSAHLGYLYIEGTNKAGLFFKDILTFW---ILFSNLVPISLFVTVEMIKYYQA 526

Query: 630  AFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSY 689
              I  D+ LY+ + D P   ++ ++ ++LGQ+EYIFSDKTGTLT+NVMEFK  +I G   
Sbjct: 527  YMIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAG--- 583

Query: 690  GRAYTEALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSK 749
             R Y E +             E RR   E         D +            E+ F S 
Sbjct: 584  -RCYIETIP------------EDRRATVE---------DGI------------EIGFHSF 609

Query: 750  EFVRDLKGASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATAR 809
            E ++D      + +      F+  LA CH+V+ E   D   K   +A SPDE ALV  A 
Sbjct: 610  ESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKY--QAASPDEGALVQGAA 667

Query: 810  DVGFSFVGKTKKGLIIEMQ-GIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALL 868
            D+GF F  +    + I      Q E+++LNI EFNS+RKRMS I ++P      +    L
Sbjct: 668  DLGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMP------DGSIKL 721

Query: 869  ICKGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNE 928
             CKGAD++I  RL     S     ++ T  HLE YA EGLRTLCIA R +   EYE+W++
Sbjct: 722  FCKGADTVILERLD----SEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSK 777

Query: 929  KYDIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVL 988
             Y+ A+ ++ +R +EL+  A+ IE +L  LG TAIED+LQ+GVP+ I  L EAG+K+WVL
Sbjct: 778  IYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVL 837

Query: 989  TGDKVETAINIGFSCNLLNNEMELLVI-KTTGDDVKEFGSEPSEIVDALLSKYLKEYFNL 1047
            TGD+ ETAINIG SC LL+ +M LL++ + T +D +                      NL
Sbjct: 838  TGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRT---------------------NL 876

Query: 1048 TGSEEEIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSP 1107
                  I E+ +  +    + A+VIDG +L  AL  ED+  +FL + K C+AV+CCRVSP
Sbjct: 877  QSKLNAI-ESHQISQQDMNSLALVIDGKSLGYAL-EEDLEDQFLTIGKLCKAVICCRVSP 934

Query: 1108 SQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFR 1167
             QKA VVK+VK     + LAIGDG+NDV+MIQ+A VG+GI+G EG QA   +D+AIGQFR
Sbjct: 935  LQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIGQFR 994

Query: 1168 YLARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNL 1227
            +L +L++VHG WSY+R++  I   FYKNM   +  FWY   N F G  + E   + FYN+
Sbjct: 995  FLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANAFSGQSIMESWTLTFYNV 1054

Query: 1228 AFTSLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFF 1287
             FT +P   +GI DQ V   +    PQLY++G   + ++   F  ++L+G Y S + F  
Sbjct: 1055 FFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSVTIFWGWVLNGFYHSAVVFIG 1114

Query: 1288 PYLVYHKNMIVTSNGLGLDHRYF-VGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALSC 1346
              L Y     +   G   DH  + VG+Y T+I ++     ++  Q  W  F+ + I  S 
Sbjct: 1115 SVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKAALITSQ--WTKFTLVAIPGSL 1172

Query: 1347 LVVFAWTGIWSSAI----ASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQKF 1402
            ++   +   +S+       S+E++     +YG+ +FW +  V  +F LL  F +  +++ 
Sbjct: 1173 VIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCIVLPVFALLRDFVWKYYKRT 1232

Query: 1403 FYPTDVEIVREMWQHGHFDHYP 1424
            + P    +V+EM ++   D+ P
Sbjct: 1233 YSPESYHVVQEMQKYNISDYRP 1254

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 66/126 (52%), Gaps = 8/126 (6%)

Query: 163 RAQELRTVYYNMPLPKDMIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVY 222
           ++ E RT+  N        D   N    Y  N I TTKY   TFLPK +  +F  +AN++
Sbjct: 182 KSDEPRTILLN--------DSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLF 233

Query: 223 FLVLIILGAFQIFGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEG 282
           FL   I+        TN   +   L+V++I++A+K+++ED +R+  D E+N++   +L+ 
Sbjct: 234 FLFTSIIQQVPNVTPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDE 293

Query: 283 VENENV 288
              E V
Sbjct: 294 RSGEFV 299

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/1046 (38%), Positives = 584/1046 (55%), Gaps = 102/1046 (9%)

Query: 393  FAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKC 452
            F +  W  ++VGDI+R+ + + IPAD I+LS+S+ +G CY+ET NLDGETNLK++QS   
Sbjct: 294  FVEKRWIDIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVE 353

Query: 453  TNTIRTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTL 512
            T      K +      + SE P+S+LYTY+G M    L D +I   P++ + ++LRG TL
Sbjct: 354  TAKFIDVKTLKNMNGKVVSEQPNSSLYTYEGTM---TLNDRQI---PLSPDQMILRGATL 407

Query: 513  RNTKWAMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANG 572
            RNT W  G+V+FTG +TK++ N+  TP K++ + + +N  ++  F +L +L  +S I N 
Sbjct: 408  RNTAWIFGLVIFTGHETKLLRNATATPIKRTAVEKIINRQIIRLFTVLIVLILISSIGNV 467

Query: 573  VYYDKKGRS-RFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAF 631
            +      +   + Y  GT         F++FW   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 468  IMSTADAKHLSYLYLEGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQAFM 524

Query: 632  IYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 691
            I  D+ LY  K D P   ++ ++ ++LGQ+EYIFSDKTGTLT+N+MEFK C+I G  Y  
Sbjct: 525  IGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYID 584

Query: 692  AYTEALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEF 751
               E      +  GI+V   G R+  ++ K  +   DE                      
Sbjct: 585  KIPEDKTATVE-DGIEV---GYRKFDDLKKKLNDPSDE---------------------- 618

Query: 752  VRDLKGASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDV 811
                              F+  LA CH+V+ E   D   K   +A SPDE ALV    D+
Sbjct: 619  -----------DSPIINDFLTLLATCHTVIPEFQSDGSIKY--QAASPDEGALVQGGADL 665

Query: 812  GFSFVGKTKKG----LIIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRAL 867
            G+ F+   +KG    +++E  G +KE+++LNI EFNS+RKRMS I + P      +    
Sbjct: 666  GYKFI--IRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFP------DGSIK 717

Query: 868  LICKGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWN 927
            L CKGAD++I  RL  ++    EA    T  HLE YA+EGLRTLC+A R++S  EYE+WN
Sbjct: 718  LFCKGADTVILERLDDEANQYVEA----TMRHLEDYASEGLRTLCLAMRDISEGEYEEWN 773

Query: 928  EKYDIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWV 987
              Y+ AA +L NR ++L+  A+ IE+ LIL+G TAIED+LQDGVP+ I  L EAGIK+WV
Sbjct: 774  SIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWV 833

Query: 988  LTGDKVETAINIGFSCNLLNNEMELLVI-KTTGDDVKEFGSEPSEIVDALLSKYLKEYFN 1046
            LTGD+ ETAINIG SC LL+ +M LL+I + T DD +            LL K       
Sbjct: 834  LTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTER----------NLLEK------- 876

Query: 1047 LTGSEEEIFEAKKDHEFPKGNY---AIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCC 1103
                      A  +H+    +    A+VIDG +L  AL  E +    L + K C+AV+CC
Sbjct: 877  --------INALNEHQLSTHDMKSLALVIDGKSLGFALEPE-LEDYLLTVAKLCKAVICC 927

Query: 1104 RVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAI 1163
            RVSP QKA VVK+VK     + LAI  G+NDV+MIQ+A VG+GI+G EG QA   +D A+
Sbjct: 928  RVSPLQKALVVKMVKRKSSSLLLAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIAL 987

Query: 1164 GQFRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMM 1223
            GQF++L +L+LVHG WSY+R++  I   FYKN    +  FWY   N F G  + E   M 
Sbjct: 988  GQFKFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMS 1047

Query: 1224 FYNLAFTSLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSII 1283
            FYNL FT  P   +G+ DQ V+  +    PQLY++G   + ++   F  ++++G + S I
Sbjct: 1048 FYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAI 1107

Query: 1284 CFFFPYLVYHKNMIVTSNGLGLDH-RYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFI 1342
             F    L+Y     +  +G   DH  + V VY T++ ++     ++ +Q  W  F+ + I
Sbjct: 1108 VFIGTILIYRYGFALNMHGELADHWSWGVTVYTTSVIIVLGKAALVTNQ--WTKFTLIAI 1165

Query: 1343 ALSCL--VVF--AWTGIWSSAIASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDS 1398
              S L  ++F   +  I+  A  SRE++      YG+  FW    V  +F L+  F +  
Sbjct: 1166 PGSLLFWLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKY 1225

Query: 1399 FQKFFYPTDVEIVREMWQHGHFDHYP 1424
            +++ + P    +++EM ++   D  P
Sbjct: 1226 YKRMYEPETYHVIQEMQKYNISDSRP 1251

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 80/178 (44%), Gaps = 21/178 (11%)

Query: 132 GRSKTLKWARKNIPNPFE-----DFTKDDIDPGAINRAQE--LRTVYYNMPLPKDMIDEE 184
           G      + RK  P  FE       T +++D   ++   +  ++ ++    L K++ D E
Sbjct: 118 GLKNAFTFKRKKGPESFEMNHYNAVTNNELDDNYLDSRNKFNIKILFNRYILRKNVGDAE 177

Query: 185 GN--------------PIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILG 230
           GN                  Y  N I TTKY   TFLPK +  +F  +AN++FL    + 
Sbjct: 178 GNGEPRVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQ 237

Query: 231 AFQIFGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVENENV 288
                  TN   +   L+V++I++A+K+ IED +R   D E+NN+   I     ++ V
Sbjct: 238 QVPHVSPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFV 295

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/1058 (37%), Positives = 589/1058 (55%), Gaps = 105/1058 (9%)

Query: 392  KFAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLK 451
            +F    W  + VGDI+R+ + + IPAD+I+LS+S+ +G CY+ET NLDGETNLK++Q+  
Sbjct: 289  QFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARP 348

Query: 452  CTNTIRTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCT 511
             T+ I   ++++  +  I SE P+++LYTY+G M   N         P++ + +LLRG T
Sbjct: 349  ETSKILDVRELSAMRGKILSEQPNTSLYTYEGTMILHN------NRIPLSPDQILLRGAT 402

Query: 512  LRNTKWAMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIAN 571
            LRNT W  G+V+FTG +TK+  N+  TP K++ + R +N  +V  F +L  L  +S   N
Sbjct: 403  LRNTVWIFGIVIFTGHETKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGN 462

Query: 572  G-VYYDKKGRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAA 630
              V Y++K    + Y  GT   +      ++FW   IL+ +LVPISL+++VE+IK  QA 
Sbjct: 463  LIVMYNQKENLSYLYLQGTNMVALFFKNILTFW---ILFSNLVPISLFVTVEMIKYYQAY 519

Query: 631  FIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYG 690
             I  D+ L++ + + P   ++ ++ ++LGQ+EYIFSDKTGTLTQNVMEFK C+I G    
Sbjct: 520  MIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAG---- 575

Query: 691  RAYTEALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKE 750
            R Y ++                      I +D+D   DE             EV + + +
Sbjct: 576  RCYIQS----------------------IPEDKDAAFDE-----------GIEVGYRTYD 602

Query: 751  FVRDLKGASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARD 810
             + +L    G       + F+  L++CH+V+ E   +   K   +A SPDE ALV  A D
Sbjct: 603  DMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKY--QAASPDEGALVQGAAD 660

Query: 811  VGFSFVGKTKKGLIIEMQGIQKE--FEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALL 868
            +G+ F+ +    + I  + I +E  +E+LNI EFNS+RKRMS I + P      +    L
Sbjct: 661  LGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFP------DNSIRL 714

Query: 869  ICKGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNE 928
            +CKGAD++I  RL+  S     A L     HLE YA EGLRTLCIA R +  SEYE+W++
Sbjct: 715  LCKGADTVILERLAATSNPYVAATLR----HLEDYAAEGLRTLCIASRTIPESEYEEWSK 770

Query: 929  KYDIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVL 988
             YD AA ++ NR +EL+ VA+ IE+ L+LLG TAIED+LQDGVP+ I  L +AGIK+WVL
Sbjct: 771  LYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVL 830

Query: 989  TGDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLT 1048
            TGD+ ETAINIG SC LL+ +M LL++    +D KE  S  + ++D L            
Sbjct: 831  TGDRQETAINIGMSCKLLSEDMNLLIVN---EDTKE--STRNNLIDKL------------ 873

Query: 1049 GSEEEIFEAKKDHEFPKGNY---AIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRV 1105
                    A  DH+  + +    A+VIDG +L  AL   D+    L + K CRAV+CCRV
Sbjct: 874  -------RAINDHQISQQDMNTLALVIDGKSLGFAL-EPDLEEFLLAIGKMCRAVICCRV 925

Query: 1106 SPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQ 1165
            SP QKA VVK+VK     + LAIGDG+NDV+MIQ+A VG+GI+G EG QA   +D+A+GQ
Sbjct: 926  SPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFALGQ 985

Query: 1166 FRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFY 1225
            F+YL +L+LVHG WSY+R+++ I   FYKN+   +  FWY +YN F G  + E   + FY
Sbjct: 986  FKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNAFSGQSIMESWTLTFY 1045

Query: 1226 NLAFTSLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICF 1285
            N   T+ P       DQ     +     Q   VG   + W    F    ++G Y + I  
Sbjct: 1046 NWGGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQKGQFWPATIFRGSAINGNYHNWITI 1105

Query: 1286 FFPYLVYHKNMIVTSNGLGLDHRYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALS 1345
                + Y        +G   DH +  GV +   ++I       L   +W  F+ L I  S
Sbjct: 1106 DGWIMDYRYGAAGAMHGETADH-WVWGVAIQPTSIIFVLGKAALITNQWTKFTVLAIPGS 1164

Query: 1346 CLVVFAWTGIWSSAI----ASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQK 1401
             +    +  I++  +     S+E++   + +YG+ +FWA+ +V  +  LL    +  +++
Sbjct: 1165 LVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFTFWAMCYVLPVLALLRDLLWKYYKR 1224

Query: 1402 FFYPTDVEIVREMWQHGHFDHYPPGYDPTDPNRPKVTK 1439
             + P    +V+EM +          YD +D NRP++ +
Sbjct: 1225 TYTPESYHVVQEMQK----------YDISD-NRPRIEQ 1251

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 63/116 (54%), Gaps = 8/116 (6%)

Query: 164 AQELRTVYYNMPLPKDMIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYF 223
           A E R +Y N        +   N  M Y  N I TTKY   TFLPK +  +F  +AN++F
Sbjct: 175 AGEPRVIYIN--------ERRANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFF 226

Query: 224 LVLIILGAFQIFGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHI 279
           L   I+        TN   +   L+V+++++AIK+++ED +R+  D E+N+++  +
Sbjct: 227 LFTSIIQQVPNVTPTNRFTTIGTLIVVLVVSAIKESVEDLKRSNSDKELNHSRADV 282

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score =  362 bits (928), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 280/993 (28%), Positives = 483/993 (48%), Gaps = 152/993 (15%)

Query: 399  KGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRT 458
            K ++VGD+V++H +  IPAD+ILL +S+  G  +V+T  LDGET+ K+R +   T  +  
Sbjct: 286  KNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNL-- 343

Query: 459  SKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWA 518
            ++D   TK  I +  P  +++ + G + ++        + P++++N L     L ++   
Sbjct: 344  TQDEMLTKVHITASAPEKSIHMFTGKLTYKG------SSAPLSVDNTLWANTVLASSGTC 397

Query: 519  MGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKK 578
            +  V++TG DT+  +N+  +  K   +  E+N    I  + +F L  +  +  G+  DK 
Sbjct: 398  VACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDK- 456

Query: 579  GRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 638
                                +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 457  -------------------WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSI 497

Query: 639  YNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 698
             +  +      ++  I +DLG++EY+ SDKTGTLTQN M+ +K  +  VSY         
Sbjct: 498  PDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSY--------- 542

Query: 699  GLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGA 758
                     +ET             D + D ++ L+  +      V          + G+
Sbjct: 543  --------TMET------------MDMVTDYIQTLTSPANMGAAGVA---------VTGS 573

Query: 759  SGEVQQRCCEHFMLALALCHSVLVEANPD-NPKKLDLKAQSPDEAALVATARDVGFSFVG 817
              EV QR     ++ LA CH+V     P+    +L  +A SPDE A+V     VG S   
Sbjct: 574  RKEVSQRV-RDLVVTLATCHNV----TPNFEDNELAYQAASPDEIAIVKFTERVGLSLFK 628

Query: 818  KTKKGLII--EMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADS 875
            + +  L +  E  G+  +++IL++  F S  KRM  IV+    N         + KGAD+
Sbjct: 629  RDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKN-----EIWFLQKGADT 683

Query: 876  IIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAA 935
            +    +S+   SN    LE+    +   A EGLRTL IA+++LS   YE+++++Y  A+ 
Sbjct: 684  V----MSKIVQSNDW--LEE---EVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASL 734

Query: 936  SLANREDEL-EVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVE 994
            S+ NR++ + EVV   +E  L LLG T +ED+LQ  V   IELL  AG+K+W+LTGDKVE
Sbjct: 735  SMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVE 794

Query: 995  TAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEI 1054
            TA  +  S  L++                               +Y+     LT  +  +
Sbjct: 795  TARCVCVSAKLISR-----------------------------GQYVHTITKLTRRDGAL 825

Query: 1055 FEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVV 1114
              ++ ++     N  ++IDGD+L  A+Y    R +F  +      V+ CR +P QKA V 
Sbjct: 826  --SRLEYLKANRNSCLLIDGDSL--AIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVA 881

Query: 1115 KLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVL 1174
             L+++        IGDG NDV+MIQ ADVG+GI G+EG+QA + +DY+I QF +L +L+L
Sbjct: 882  LLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLL 941

Query: 1175 VHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPV 1234
             HGR SYKR A++     ++ ++ ++    Y I ++     LY+   M+ Y   +T  PV
Sbjct: 942  WHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPV 1001

Query: 1235 IFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYL---- 1290
              L  LD D++++++   P+LY+     +  + + F  +++  L+Q  +   F  L    
Sbjct: 1002 FSL-TLDHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFIGV 1060

Query: 1291 ---VYHKNMIVTSNGLGLDHRYFVGVYV----TTIAVISCNTYV-------LLHQYRWDW 1336
               V+ K + ++   L ++    V + +     T+A+    T+        LL +Y +D 
Sbjct: 1061 GSEVFKKMVALSFTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLGEY-FDL 1119

Query: 1337 FSGL----FIALSCLVVFAWTGIWSSAIASREF 1365
             S L    FI L+ ++  +   +W++    R  
Sbjct: 1120 TSMLALPFFIQLTIILTVSIFPVWAAKTIHRRL 1152

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 48/91 (52%)

Query: 190 QYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPGLSAVPLVV 249
           +YP N I   KY  +TFLP  +  QF  F N+YFL++ +  +     +       VPL  
Sbjct: 187 KYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPALRIGYLSSYIVPLAF 246

Query: 250 IVIITAIKDAIEDSRRTVLDLEVNNTKTHIL 280
           ++++T  K+A++D +R   D E NN    +L
Sbjct: 247 VLVVTMSKEAMDDIQRRRRDRETNNELYEVL 277

>Kwal_56.23467
          Length = 280

 Score =  328 bits (842), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 153/286 (53%), Positives = 196/286 (68%), Gaps = 33/286 (11%)

Query: 1261 LRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLDHRYFVGVYVTTIAV 1320
            +R EWN  KF  YM+DGLYQS+I FFFP+L Y+K  +V+ NGLGLDHRY+VG+ V +IA 
Sbjct: 1    MRSEWNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYWVGILVGSIAS 60

Query: 1321 ISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAIASREFFKAAARIYGAPSFWA 1380
            +SCN Y+L+HQ+RWDWFS LFIALSCLVV+ WTGIWS+   S EF+K+AA +YG+P +WA
Sbjct: 61   VSCNLYILIHQFRWDWFSTLFIALSCLVVYGWTGIWSTFTTSGEFYKSAAHVYGSPIYWA 120

Query: 1381 VFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHGHFDHYPPGYDPTDPNRPKVTKA 1440
            +FFV VLFCLLPRFT+D FQK F+P D++I+RE W  GHFD YP  YDPTDPNRP++ KA
Sbjct: 121  IFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKA 180

Query: 1441 GQ--HGEKIIEGIALSDNLGGSNY-SRDSVVTEEIPMTFMHGEDGSPSGYQKQETWMTSP 1497
                H   + EG   +  +  +N+ SRD+V TEEIPMTFM  +D +P  +          
Sbjct: 181  DTKLHPRYVEEGSDYAHAITTANHGSRDTVYTEEIPMTFMEADDNNPEPFH--------- 231

Query: 1498 KETQDLLQSPQFQQAQTFGRGPSTNVRSSLDRTREQMIATNQLDNR 1543
                                 P +N+R+SLDRTR QM A+N+LD R
Sbjct: 232  ---------------------PRSNIRTSLDRTRMQMRASNELDGR 256

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score =  353 bits (905), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 261/892 (29%), Positives = 446/892 (50%), Gaps = 125/892 (14%)

Query: 399  KGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRT 458
            K +KVGD++++H  D IPAD++LL +S+  G  +++T  LDGET+ K+R +   T  +  
Sbjct: 268  KDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSE 327

Query: 459  SKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWA 518
            +  I R    I +  P  +++ + G + +++       + P++++N L     L ++ + 
Sbjct: 328  NDLINRIS--ITASAPEKSIHKFLGKVTYKDST-----SNPLSVDNTLWANTVLASSGFC 380

Query: 519  MGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKK 578
            +  V++TG DT+  +N+     K   +  E+N    I    +F L  +            
Sbjct: 381  IACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSIL------------ 428

Query: 579  GRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 638
                        AG    + ++     +IL+ +++P+SL +++++ K+  A  I  D   
Sbjct: 429  --------LVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD--- 477

Query: 639  YNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 698
               K       ++  I +DLG++EY+ SDKTGTLTQN M+ KK  +  VSY         
Sbjct: 478  ---KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY--------- 525

Query: 699  GLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGA 758
                 + +D+ ++    ++ ++   D++ +   ALS   +    +++F     VRD+   
Sbjct: 526  ---TSETLDIVSD--YVQSLVSSKNDSLNNSKVALSTTRK----DMSFR----VRDM--- 569

Query: 759  SGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGK 818
                        +L LA+CH+V      D   +L  +A SPDE A+V     VG S   +
Sbjct: 570  ------------ILTLAICHNVTPTFEDD---ELTYQAASPDEIAIVKFTESVGLSLFKR 614

Query: 819  TKKG--LIIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSI 876
             +    L+ E  G    +EIL +  FNS  KRM  IV+   L+         + KGAD++
Sbjct: 615  DRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLD-----EYWFMQKGADTV 669

Query: 877  IYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAAS 936
                +S+   SN + + E+T       A EGLRTL I +++L+   YE++ ++Y+ A+ S
Sbjct: 670  ----MSKIVESN-DWLEEETG----NMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLS 720

Query: 937  LANREDEL-EVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVET 995
            + NR+ ++ +V+   +E +L LLG T +ED+LQ  V   IELL  AGIK+W+LTGDKVET
Sbjct: 721  MLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVET 780

Query: 996  AINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIF 1055
            A  +  S  L++    +  I           + P    + L  +YLK             
Sbjct: 781  ARCVSISAKLISRGQYVHTITKV--------TRPEGAFNQL--EYLK------------- 817

Query: 1056 EAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVK 1115
                       N  ++IDG++L   ++ +   ++F  +  +   V+ CR +P QKA V  
Sbjct: 818  --------INRNACLLIDGESL--GMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVAL 867

Query: 1116 LVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLV 1175
            +++         IGDG NDV+MIQ ADVG+GI G+EG+QA + +D++I QF +L  L+L 
Sbjct: 868  VIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLW 927

Query: 1176 HGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVI 1235
            HGR SYKR A++     ++ +I A+    Y I + F+   LY+   M+ Y   +T  PV 
Sbjct: 928  HGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVF 987

Query: 1236 FLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQ-SIICFF 1286
             L  LD D+ ++++ + P+LY+     K  + + F  ++L  L+Q S+I  F
Sbjct: 988  SLT-LDHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLF 1038

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 48/91 (52%)

Query: 190 QYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPGLSAVPLVV 249
           +Y  N++   KY  +TF+P  +  QF  F N+YFLV+ +  A     +       VPL  
Sbjct: 169 RYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAF 228

Query: 250 IVIITAIKDAIEDSRRTVLDLEVNNTKTHIL 280
           ++ +T  K+AI+D +R   D E NN   H++
Sbjct: 229 VLTVTMAKEAIDDIQRRRRDRESNNELYHVI 259

>Kwal_23.5789
          Length = 1133

 Score =  351 bits (901), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 258/889 (29%), Positives = 435/889 (48%), Gaps = 131/889 (14%)

Query: 399  KGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRT 458
            K +KVGD+++I      PAD++LL +S+  G  +++T  LDGET+ K+R  + C  T   
Sbjct: 254  KDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLR--IACPLTQHL 311

Query: 459  SKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWA 518
            S+D    +  I +  P  ++  + G + +     GEI+++P++++N +       +   A
Sbjct: 312  SQDDLLYRISITASVPEKSINNFLGKLTF-----GEIQSQPLSVDNTMWANTVFASAGTA 366

Query: 519  MGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKK 578
            +  V++TG DT+  +N+ ++  K   +  E+N    I    +FIL               
Sbjct: 367  IACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFIL--------------- 411

Query: 579  GRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 638
                 S      AG    + +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 412  -----SVALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTI 466

Query: 639  YNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 698
                +      ++  I +DLG++EY+ SDKTGTLTQN ME KK  +  VSY         
Sbjct: 467  PETIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSY--------- 511

Query: 699  GLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGA 758
                                     D + D +RA+S N       V   SK   +DL G 
Sbjct: 512  --------------------TMDTMDIVTDYVRAMSDN--LNSSAVPSASK---KDLPGR 546

Query: 759  SGEVQQRCCEHFMLALALCHSVLVEANPD-NPKKLDLKAQSPDEAALVATARDVGFSFVG 817
                        +L LALCH V     P     +L  +A SPDE A+V     VG +   
Sbjct: 547  --------VRDLVLTLALCHQV----TPTFEDGELTYQAASPDEIAIVKFTESVGLTLFR 594

Query: 818  KTKKG--LIIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADS 875
            + +    L+ +  G   E++IL++  FNS  KRM  ++         +     + KGAD 
Sbjct: 595  RDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVI-----FDKQKDEYWFLQKGAD- 648

Query: 876  IIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAA 935
            ++ S++ +++    + + E+T       A EGLRTL I ++ LS    + + + Y+ A+ 
Sbjct: 649  VVMSKIVQKN----DWLEEETG----NLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASL 700

Query: 936  SLANREDELE-VVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVE 994
             + NRE  +  V++  +E +L +LG T +ED+LQ+ V   IELL  AGIK+W+LTGDKVE
Sbjct: 701  MMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVE 760

Query: 995  TAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEI 1054
            TA  +  S  L++    +  +           ++P   +  L                E+
Sbjct: 761  TARCVSISAKLVSRGQYVHTVTKV--------NKPEGALTHL----------------EL 796

Query: 1055 FEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVV 1114
             +          N  ++IDG++L   LY E  R++F  +  N  AV+ CR +P QKA V 
Sbjct: 797  LKINT-------NSCLLIDGESL--GLYLEYYRQQFFEIVVNLPAVIACRCTPQQKADVA 847

Query: 1115 KLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVL 1174
              +++        IGDG NDV+MIQSADVG+GI G+EG+QA + +D++I QF +L++L+L
Sbjct: 848  TFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLL 907

Query: 1175 VHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPV 1234
             HGR SYKR A++     ++ ++ ++    Y I + F+   LY+   M+ Y   +T  PV
Sbjct: 908  WHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPV 967

Query: 1235 IFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSII 1283
              L  LD D++++++   P+LY+     K  + + F  +++  L+Q  +
Sbjct: 968  FSL-TLDHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCV 1015

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 48/91 (52%)

Query: 190 QYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPGLSAVPLVV 249
           +Y  N I   KY P+TF+PK +  QF  F N+YFL++ +  A     +       VPL  
Sbjct: 155 KYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAF 214

Query: 250 IVIITAIKDAIEDSRRTVLDLEVNNTKTHIL 280
           ++ +T  K+A++D +R   D E NN    +L
Sbjct: 215 VLTVTMSKEALDDIQRRRRDRESNNELYEVL 245

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score =  350 bits (899), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 253/891 (28%), Positives = 435/891 (48%), Gaps = 140/891 (15%)

Query: 399  KGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRT 458
            K +KVGD+++IH    IPAD++LL +S+  G  +++T  LDGET+ K+R  + C+ T   
Sbjct: 264  KDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLR--VACSLTQNL 321

Query: 459  SKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWA 518
            S D    K  I +  P  +++ + G + +++ +     +  ++++N +     L +    
Sbjct: 322  STDDLLNKISITASSPEKSIHRFLGKLTYKDSS-----SNALSVDNTMWANTVLASVGSC 376

Query: 519  MGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKK 578
            +G V++TG DT+  +N+ ++  K   +  E+N    I    +F+L  V            
Sbjct: 377  IGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIV------------ 424

Query: 579  GRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 638
                        AG    + +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 425  --------LVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATI 476

Query: 639  YNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 698
             +  +      ++  I +DLG++EY+ SDKTGTLTQN M+ KK  +  VSY         
Sbjct: 477  PDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSY--------- 521

Query: 699  GLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEF---VRDL 755
                                     D + D ++ L  +S   P   +   K+    VRDL
Sbjct: 522  --------------------TMDTMDIVTDYVQELVSSSTTTPMPQSTAKKDLPNRVRDL 561

Query: 756  KGASGEVQQRCCEHFMLALALCHSVLVEANPD-NPKKLDLKAQSPDEAALVATARDVGFS 814
                           ++ LA+CH+V     P     +L  +A SPDE A+V     VG S
Sbjct: 562  ---------------VVTLAICHNV----TPTFEDGELTYQAASPDEIAIVKFTESVGLS 602

Query: 815  FVGKTKKG--LIIEMQGIQKEFEILNILEFNSSRKRMSCIV--KIPGLNPGDEPRALLIC 870
               + +    L  +      E++IL +  FNS  KRM  IV  K+ G           + 
Sbjct: 603  LFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKG-------EHWFMQ 655

Query: 871  KGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKY 930
            KGAD+++ +R+ + +    E +           A EGLRTL I +++LS   YE++ ++Y
Sbjct: 656  KGADTVM-ARIVQSNDWLDEEV--------GNMAREGLRTLVIGRKKLSPKSYEQFRKEY 706

Query: 931  DIAAASLANREDELE-VVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLT 989
              A+ S+ NR++ +  V+   +E  L LLG T +ED+LQ+ V   IELL  AG+K+W+LT
Sbjct: 707  HDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLT 766

Query: 990  GDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTG 1049
            GDKVETA  +  S  L++    +  +           S P   ++AL      EY  +  
Sbjct: 767  GDKVETARCVSISAKLISRGQYVHTVTKL--------SRPEGALNAL------EYLKINK 812

Query: 1050 SEEEIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQ 1109
            S                   ++IDG++L   ++    +++F  +  +  AV+ CR +P Q
Sbjct: 813  SS-----------------CLLIDGESL--GMFLTYYKQEFFDIVVDLPAVIACRCTPQQ 853

Query: 1110 KAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYL 1169
            KA V  L+++        IGDG NDV+MIQ ADVG+GI G+EG+QA + +D+++ QF +L
Sbjct: 854  KADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHL 913

Query: 1170 ARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAF 1229
             +L+L HGR SYKR A++     ++ +I ++    Y + + F+   LY+   M+ Y   +
Sbjct: 914  TKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCY 973

Query: 1230 TSLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQ 1280
            T  PV  L  LD D++++++ + P+LY+        + + F  +++  L+Q
Sbjct: 974  TMAPVFSL-TLDHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQ 1023

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 104/238 (43%), Gaps = 22/238 (9%)

Query: 65  DAEEFTFNDDTEYDNHSFQPTPKLNNGSGTFDDVELDNDSGEP----HTNY----DGMKR 116
           D+ +  F D  +    S Q    LN     F+   +D D  +     H+      D  K 
Sbjct: 26  DSFDLQFEDSLDAALESLQINNSLNTSGENFEMRTIDQDGDDTQSFKHSRVSSLNDSAKN 85

Query: 117 FRMGTKRNKKGNPIMGRSKTLKWA---RKNIPNPFEDFTKDDIDPGAINRAQELRTVYYN 173
             + + R+ +  P++G ++   W+   + +  +P+  F +    P   + ++  R+   +
Sbjct: 86  THLSSGRDTQ--PLIGTTQE-PWSNNQQGSNQSPWSKFIRLIKTPTTTDLSK-YRSTNSS 141

Query: 174 MPLPKDMIDEEGNPIM-------QYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVL 226
           + L    ++ E +P         +YP N I   KY P+TF+P  +  QF  F N+YFL++
Sbjct: 142 IELTDQHVEREIHPDTTPIYDKNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLV 201

Query: 227 IILGAFQIFGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVE 284
            +  A     +       VPL  ++++T  K+A++D +R   D E NN    +L   +
Sbjct: 202 ALSQAIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQ 259

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score =  350 bits (898), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 258/891 (28%), Positives = 438/891 (49%), Gaps = 131/891 (14%)

Query: 399  KGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRT 458
            K +KVGD+++I     +PAD+ILL +S+  G  +++T  LDGET+ K+R  + CT T   
Sbjct: 262  KDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLR--IACTLTQNL 319

Query: 459  SKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWA 518
            ++D    K  I +  P  +++++ G + ++     +     +TI+N L     L ++ + 
Sbjct: 320  NEDDLLEKITITASAPEKSIHSFLGRVTYK-----DTNTSGLTIDNTLWANTVLASSGFC 374

Query: 519  MGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKK 578
            +G V++TG DT+  +N+     K   +  E+N    I    +FIL  +  +  G++ D  
Sbjct: 375  IGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHND-- 432

Query: 579  GRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 638
                              + +V     +IL+ +++P+SL +++++ K+  A  I  D   
Sbjct: 433  ------------------DWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD--- 471

Query: 639  YNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 698
               K       ++  I +DLG++EY+ SDKTGTLTQN M+ KK  +  VSY         
Sbjct: 472  ---KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSY--------- 519

Query: 699  GLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGA 758
                            E A+I  D                 Y + +     + V +L G 
Sbjct: 520  --------------TTETADIVSD-----------------YIQGMIESKNDSVTNL-GP 547

Query: 759  SGEVQQRCCEH---FMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFSF 815
                ++    H    +  LA+CH+V      D   +L  +A SPDE A+V     VG S 
Sbjct: 548  RSTTRKDAATHVIDLITTLAICHNVTPTFEDD---ELTYQAASPDEIAIVKFTESVGLSL 604

Query: 816  VGKTKKG--LIIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGA 873
              + +    L+ E  G    +++L +  FNS  KRM  IV         + +   + KGA
Sbjct: 605  FKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVY-----DKQKDQYWFLQKGA 659

Query: 874  DSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIA 933
            D+++      +  +N++ + E+T       A EGLRTL I +++L+   YE++ ++Y+  
Sbjct: 660  DTVM-----NRIVANNDWLEEETG----NMAREGLRTLVIGRKKLTKKIYEQFKKEYEEV 710

Query: 934  AASLANREDEL-EVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDK 992
            +AS+ NRE E+   ++  +E +L LLG T +ED+LQ  V   IELL  AGIK+W+LTGDK
Sbjct: 711  SASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDK 770

Query: 993  VETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEE 1052
            VETA  +  S  L++    + V+           S+P    + L  +YLK          
Sbjct: 771  VETARCVSISAKLISRGQYVHVVTKL--------SKPEGAFNQL--EYLK---------- 810

Query: 1053 EIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAA 1112
                          N  ++IDG++L + L  +  R++F  +  +   V+ CR +P QKA 
Sbjct: 811  -----------VNKNACLLIDGESLGMFL--KYYRQEFFDVVVHLPTVIACRCTPQQKAD 857

Query: 1113 VVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARL 1172
            V  ++++        IGDG NDV+MIQ ADVG+GI G+EG+QA + +D++I QF +L  L
Sbjct: 858  VALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTEL 917

Query: 1173 VLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSL 1232
            +L HGR SYKR A++     ++ +I A+    + + + F+   LY+   M+ Y   +T  
Sbjct: 918  LLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYTMA 977

Query: 1233 PVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSII 1283
            PV  L  LD D++++++ + P+LY+     K  + + F  ++    YQ ++
Sbjct: 978  PVFSL-TLDHDIDESLTKMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLV 1027

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 37/70 (52%)

Query: 190 QYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPGLSAVPLVV 249
           ++P N++   KY  +TFLP  +  QF  F N+YFL++ +  A     +       VPL  
Sbjct: 163 RFPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAF 222

Query: 250 IVIITAIKDA 259
           ++ +T  K+A
Sbjct: 223 VLTVTMAKEA 232

>Scas_704.38
          Length = 1161

 Score =  342 bits (878), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 264/894 (29%), Positives = 442/894 (49%), Gaps = 136/894 (15%)

Query: 399  KGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRT 458
            K +KVGD+++I   D +PAD++LL +S+  G  +++T  LDGET+ K+R +   T  + T
Sbjct: 278  KDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNL-T 336

Query: 459  SKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWA 518
              D+   K  I +  P   ++ + G + +++ +     + P++I+N L     L +T + 
Sbjct: 337  EPDLMN-KVSITASAPEKAIHNFLGKVTYKDTS-----SNPLSIDNTLWANTVLASTGFC 390

Query: 519  MGVVMFTGGDTKIMLNSGITPTKKSRISRELN-FSVVIN---FVLLFILCFVSGIANGVY 574
            +G V++TG DT+  +N+     K   +  E+N  S ++    F L  IL   +G  N  +
Sbjct: 391  IGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCASVFALSIILVVFAGFHNSDW 450

Query: 575  YDKKGRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYG 634
            Y    R                         +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 451  YLDVMR------------------------YLILFSTIIPVSLRVNLDLAKSVYAHQIEH 486

Query: 635  DVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 694
            D  +    +      ++  I +DLG++EY+ SDKTGTLTQN M+ KK  +  VSY     
Sbjct: 487  DDTIPETIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY----- 535

Query: 695  EALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRD 754
                                E  +I  D    +D L   S ++    + V   S+     
Sbjct: 536  ------------------TSETLDIVSD---YVDALVNSSNSANPSGKSVPSTSR----- 569

Query: 755  LKGASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFS 814
             K  S  V+       ++ LA+CH+V      D   +L  +A SPDE A+V     VG S
Sbjct: 570  -KDLSARVRD-----MVVTLAICHNVTPTFEDD---ELTYQAASPDEIAIVKFTESVGLS 620

Query: 815  FVGKTKKG--LIIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPR--ALLIC 870
               + +    L+    G    +EIL +  FNS  KRM  IV        DE +     + 
Sbjct: 621  LFKRDRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGIIVH-------DEQKDEYWFMQ 673

Query: 871  KGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKY 930
            KGAD+++ +R+      N++ + E+T       A EGLRTL + +++LS + Y+++ + Y
Sbjct: 674  KGADTVM-ARIVE----NNDWLEEETG----NMAREGLRTLVVGRKKLSRNIYDQFKKDY 724

Query: 931  DIAAASLANREDELE-VVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLT 989
            D A+ S+ NR+ ++  V+   +E +L LLG T +ED+LQ+ V   IELL  AGIK+W+LT
Sbjct: 725  DDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLT 784

Query: 990  GDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTG 1049
            GDKVETA  +  S  L++    + +I           ++P   ++ L  +YLK       
Sbjct: 785  GDKVETARCVSISAKLISRGQYVHIITKL--------TKPEGALNQL--EYLK------- 827

Query: 1050 SEEEIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQ 1109
                           KG   ++IDG++L + L     +R+F  +      V+ CR +P Q
Sbjct: 828  -------------VNKGA-CLLIDGESLGMFL--RYYKREFFDVVICLPTVVACRCTPQQ 871

Query: 1110 KAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYL 1169
            KA V  ++++        IGDG NDV+MIQ ADVG+GI G+EG+QA + +D++I +F +L
Sbjct: 872  KADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHL 931

Query: 1170 ARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAF 1229
              L+L HGR SYKR A++     ++ ++ A+    Y I + F+   LY+   M+ Y   +
Sbjct: 932  TELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCY 991

Query: 1230 TSLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSII 1283
            T  PV F   LD D+ ++++ + P+LY+     K  + + F  +    L+Q  +
Sbjct: 992  TMAPV-FSMTLDHDIEESLTKIYPELYKDLTEGKSLSYKTFFVWCALSLFQGCV 1044

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 48/91 (52%)

Query: 190 QYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPGLSAVPLVV 249
           +YP N+I   KY   TF+P  +  QF  F N+YFLV+ +  A     +       VPL  
Sbjct: 179 RYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAF 238

Query: 250 IVIITAIKDAIEDSRRTVLDLEVNNTKTHIL 280
           ++ +T  K+A++D +R   D E N+   H+L
Sbjct: 239 VLTVTMSKEAMDDIQRRRRDNESNSELYHVL 269

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score =  329 bits (843), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 256/932 (27%), Positives = 447/932 (47%), Gaps = 143/932 (15%)

Query: 399  KGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRT 458
            K +KVGDI+++     +PAD+++L T++ +G  +++T  LDGET+ K+R  L C+ T   
Sbjct: 271  KDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLR--LACSLTQSL 328

Query: 459  SKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWA 518
            +++       I +  P  +++ + G + +++       + P++++N +     L ++   
Sbjct: 329  TENDLLNNITITASAPEHSIHNFLGKITYKDST-----SSPLSVDNTMWENTVLASSAAC 383

Query: 519  MGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKK 578
            +  +++TG +T+  LN+  +  K   +  E+N    I    +F+L               
Sbjct: 384  ICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLL--------------- 428

Query: 579  GRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 638
                 S      AG    + +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 429  -----SIMLVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQI 483

Query: 639  YNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 698
             +  +      ++  I +DLG++EY+ SDKTGTLTQN M+ KK  +  VSY         
Sbjct: 484  EDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY--------- 528

Query: 699  GLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGA 758
                            E  +I  D    I  + + + NS   P        + V DL   
Sbjct: 529  --------------TNETMDIVTD---FIQSMNSRTSNST--PTTTRKNISDRVIDL--- 566

Query: 759  SGEVQQRCCEHFMLALALCHSVLVEANPD-NPKKLDLKAQSPDEAALVATARDVGFSFVG 817
                        +  LA+CH+V     P     +L  +A SPDE A+V     VG S   
Sbjct: 567  ------------VTTLAICHNV----TPTFEDGELTYQAASPDEIAIVKFTESVGLSLFR 610

Query: 818  KTKKGLII--EMQGIQKEFEILNILEFNSSRKRMSCIV--KIPGLNPGDEPRALLICKGA 873
            + +  + +  +  G++ E++I  +  FNS  KRM  I+  K+       +     + KGA
Sbjct: 611  RDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKL-------KQEYWFLQKGA 663

Query: 874  DSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIA 933
            D+++ S + R      E             ATEGLRTL I +++LS + +E++ ++Y  A
Sbjct: 664  DTVMSSIVVRNDWLEEET---------SNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEA 714

Query: 934  AASLANREDELE-VVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDK 992
            + ++ +RE  ++ VV   +E +L LLG T +ED+LQ  V   IELL  AGIK+W+LTGDK
Sbjct: 715  SLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDK 774

Query: 993  VETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEE 1052
            VETA  +  S  L++    +  +           ++P   +  L      EY  +     
Sbjct: 775  VETARCVSISAKLISRGQYVHTVTKV--------NKPEGALHHL------EYLQV----- 815

Query: 1053 EIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAA 1112
                          N  ++IDG++L   LY +    +F  +  N   V+ CR +P QKA 
Sbjct: 816  ------------NQNSCLLIDGESL--GLYLQYFPDEFFDIVVNLPTVVACRCTPQQKAD 861

Query: 1113 VVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARL 1172
            V   ++ +       IGDG NDV+MIQ ADVG+GI G+EG+QA + +D++I QF +L +L
Sbjct: 862  VAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKL 921

Query: 1173 VLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSL 1232
            +L HGR SYK  A++     ++ +I ++    Y I + F+   LY+   M+ Y   +T  
Sbjct: 922  LLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMA 981

Query: 1233 PVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSII----CFFFP 1288
            PV  L  LD D++++++ + P+LY+   L K  + + F  ++   ++Q  +      FF 
Sbjct: 982  PVFSL-TLDHDIDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFFT 1040

Query: 1289 YLV---YHKNMIVTSNGLGLDHRYFVGVYVTT 1317
             L    + K + ++   L L+    VG+ + T
Sbjct: 1041 SLNDSDFTKMVAISFTALVLNELIMVGLEINT 1072

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 107/257 (41%), Gaps = 40/257 (15%)

Query: 45  NKYSRPQVSFNDETPKNKREDAEEFTFNDDTEYDNHSFQPTPKLNN---GSGTFDDVEL- 100
           NKYS+     N    ++   D+ +  F D  +    S Q  P+ ++    S  F+D E+ 
Sbjct: 13  NKYSKS----NQHQAQSTDRDSFDLQFEDSLDAALESLQ-LPEHSHRRENSTVFEDFEMK 67

Query: 101 ----DNDSGEPH---------TNYDGMKRFRMGTKRNKKG-NPIMGRSKTLKWARKNIPN 146
               D+ +G  H         TN+    R    + RN +  N I   SK   W       
Sbjct: 68  SMHGDHQTGMLHSDADTAPLITNHSNNGRMLSNSDRNAQNTNNITVWSKAKSW------- 120

Query: 147 PFE-DFTKDDIDPGAINRAQELRTVYYN-MPLPKDMIDEEGNPIM-------QYPRNKIR 197
            FE  FTK    P +++      +V  N + L    ++ E +P         +YP N I 
Sbjct: 121 -FEHSFTKAKSKPSSLSVYSSTNSVDGNKIELNDHNVEREIHPATTPIYDRKKYPSNVIS 179

Query: 198 TTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPGLSAVPLVVIVIITAIK 257
             KY P TF+P  +  QF  F N+YFL++ +  A     +       VPL  ++ +T  K
Sbjct: 180 NAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFVLTVTMSK 239

Query: 258 DAIEDSRRTVLDLEVNN 274
           +A++D  R   D E NN
Sbjct: 240 EAMDDINRRKRDREANN 256

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score =  321 bits (822), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 198/577 (34%), Positives = 310/577 (53%), Gaps = 58/577 (10%)

Query: 854  KIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCI 913
            K P ++ G++   LL   G+D++I         SN E +LEKT   +E ++TEGLRTL  
Sbjct: 930  KSPQVSNGND--VLLNYIGSDALI---------SNEEYVLEKTLEDIESFSTEGLRTLLF 978

Query: 914  AQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPD 973
            A + +S  ++E+W  +Y  A  SL+ R+ +++ V   IE EL LLG TAIED+LQ+GV +
Sbjct: 979  AHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEVGAQIEDELYLLGATAIEDKLQEGVSE 1038

Query: 974  CIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIV 1033
             IE +  AGIK+W+LTGDK ETAINIG+SC L+++   ++++ T+ +++    +  S+ V
Sbjct: 1039 AIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIHDYSTVVILTTSDENIISKMNAISQEV 1098

Query: 1034 DALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYA---IVIDGDALKLALYGEDIRRKF 1090
            D+                              GN A   IVIDG  L +      +   F
Sbjct: 1099 DS------------------------------GNVAHCVIVIDGATLAMFEDNPTLMSVF 1128

Query: 1091 LLLCKNCRAVLCCRVSPSQKAAVVKLVKDS-LDVMTLAIGDGSNDVAMIQSADVGIGIAG 1149
              LC    +V+CCR SP+QKA +V  ++++   ++TLAIGDG+ND+AMIQSAD+G+GIAG
Sbjct: 1129 TELCTKTDSVVCCRASPAQKALMVSNIRNTDKSIVTLAIGDGANDIAMIQSADIGVGIAG 1188

Query: 1150 EEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYN 1209
            +EG QA   +DY+IGQFR++ +L+LVHGR++Y R A+ I   FYK + F L    Y  Y 
Sbjct: 1189 KEGLQASRSADYSIGQFRFILKLLLVHGRYNYIRTAKFILCTFYKELTFYLTQLIYQRYT 1248

Query: 1210 DFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRK 1269
             F G+ LYE   +  YN  FTSLPV+ +G+ ++D+     L VP+LY +G L K +N   
Sbjct: 1249 MFSGTSLYEPWSLSMYNTLFTSLPVLCVGMFEKDLKPVTLLTVPELYSMGRLSKAFNWSI 1308

Query: 1270 FLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLDHRYFVGV--YVTTIAVISCNTYV 1327
            F  ++  G   ++I  F   + + +  + + N L     Y +G   +  T+A+I+     
Sbjct: 1309 FAEWVFLGTANALIITFLNIVAWGETSL-SDNTL-----YPLGFVNFSATVALINVKAQF 1362

Query: 1328 LLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAIASREFFKAAARIYGA----PSFWAVFF 1383
            +  + R +W +   + LSC     W         S   +     +Y       +FW    
Sbjct: 1363 IEMRNR-NWLAFTSVILSCGGWLVWCCALPILNRSDGIYDVTYGLYHHFGRDITFWCTSL 1421

Query: 1384 VAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHGHF 1420
            +  +  ++    Y +F+    P+D +I  E+ Q    
Sbjct: 1422 ILAVLPIIVDVVYKTFKIMLAPSDSDIFAELEQKSEI 1458

 Score =  252 bits (643), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 211/768 (27%), Positives = 363/768 (47%), Gaps = 147/768 (19%)

Query: 181 IDEEGNPIMQ-----YPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIF 235
           +D  GN + +     Y  N I +++YT ++F P+ +  QF   ANVYF ++ IL      
Sbjct: 108 VDRHGNLVDERYGYAYCNNLITSSRYTIISFFPRQLYAQFSKLANVYFFIVAILQMI--- 164

Query: 236 GVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVENENVSTDNISL 295
               PG S       ++   +  AI  +R    D      + H L+  EN  ++      
Sbjct: 165 ----PGWSTTGTYTTIVPLCVFMAISMAREAYDDY-----RRHKLDKEENNKLT------ 209

Query: 296 WRRFKKANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQKTVGTSGPRSSLDSIDSY 355
                        K +Q   E            R+ ++L ++     S   ++ +SI + 
Sbjct: 210 -------------KVLQILHE------------REDNDLDLENNAQHSA--NNPESISN- 241

Query: 356 RVSADYGRPSLDYDNLEQGAGEANIVDRSLPPRTDCKFAKNYWKGVKVGDIVRIHNNDEI 415
                     L ++N +  A + N+           +  +  WK ++VGD V +  +D +
Sbjct: 242 ----------LYFNNFDLLAKKYNV-----------RIVEKKWKDIRVGDFVLLQQDDWV 280

Query: 416 PADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTI-RTSKDIARTKFWIESEGP 474
           PADI++L++   +   ++ET  LDGETNLK +      N + +++  +A     +  E P
Sbjct: 281 PADILILTSDGDNSEVFIETMALDGETNLKGKVPHPEINKLTKSASGLANINAQVTVEDP 340

Query: 475 HSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMGVVMFTGGDTKIMLN 534
           +++LY ++GN++  N      +  P+  +NV+ RG  +RNT+  +G+V+FTG ++KI +N
Sbjct: 341 NNDLYNFEGNLEL-NSGSSSKKKYPLGPDNVIYRGSIIRNTRNCVGMVIFTGEESKIRMN 399

Query: 535 SGITP-TKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKK-GRSRFSYEFGTIAG 592
           +   P TK  ++ R++N  VV    ++  +   S + + +   +    ++  Y     AG
Sbjct: 400 ALRNPRTKAPKLQRKINMIVVFMVFVVACMSLFSYLGHTIQIKRYVNNNKAWYLLQEDAG 459

Query: 593 SAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSW 652
           +A T   +SF   +I+Y +++P+SLY+++E+IK AQ+  +  D+ +Y+A+ D PC  ++ 
Sbjct: 460 TAPT--IMSF---IIMYNTIIPLSLYVTMELIKVAQSRMMEWDIDMYHAESDTPCAVRTA 514

Query: 653 NISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEAL-----AGLRKRQGID 707
            I ++LGQV YIFSDKTGTLT N M F+K +  G S+    T+ +     A L  +  ID
Sbjct: 515 TILEELGQVSYIFSDKTGTLTDNKMLFRKLSFCGTSWVHNATQDISEFKPAQLSNKNDID 574

Query: 708 V-----------------ETEGRREKAEIAKDRDTMID-------------ELRAL---- 733
           V                     R        DR T ++              +R+L    
Sbjct: 575 VISIDDQSFLSKLGYTSQSNPKRYMDINDFPDRRTSVEYKGNATVKYTGRPSMRSLYVPP 634

Query: 734 -----SGNSQ---FYPEEV--TFVSKEFVRDLKGASGEVQQRCCEHFMLALALCHSVL-- 781
                + NSQ     PE++  TF   E +  ++     +  +  + F+L+LA+CH  L  
Sbjct: 635 KKETNASNSQDASDIPEDIKSTF---ELIYYIQSNPKSLFAKKAKMFILSLAICHICLPK 691

Query: 782 -VEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLIIEM--QGIQ-----KE 833
             E   D    ++ ++ SPDE ALV  ARD+G+    +    L ++    G       + 
Sbjct: 692 RTEEGNDEDDIIEYQSSSPDELALVTAARDMGYIVYNRNANILTLKTFPDGFDELPRFEN 751

Query: 834 FEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRL 881
           FEIL +++FNS RKRMS IV++    P ++ R LL CKGAD++I  RL
Sbjct: 752 FEILELVDFNSQRKRMSVIVRV----PEEKDRVLLFCKGADNVILERL 795

>Kwal_23.3556
          Length = 1597

 Score =  318 bits (814), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 184/541 (34%), Positives = 292/541 (53%), Gaps = 51/541 (9%)

Query: 888  NSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVV 947
            N E +LE+T   +E ++T GLRTL  + + +   +YEKW++KY  A  SL NR++++  V
Sbjct: 952  NEEFVLERTLQAIEDFSTSGLRTLLYSYKWIPSEDYEKWSKKYHAAKTSLENRKEKMHSV 1011

Query: 948  ADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLN 1007
             + +E  L LLG TAIED+LQ+GV D I+ +  AGIK+W+LTGDK ETAINIG+SCNL++
Sbjct: 1012 GELVETSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIH 1071

Query: 1008 NEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGN 1067
            +   ++++    +++                        LT   +EI          +GN
Sbjct: 1072 DYSTVVILSAKDENISS---------------------KLTAVSQEI---------ERGN 1101

Query: 1068 YA---IVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDS-LDV 1123
             A   +VIDG  L        +   F+ LC    +V+CCR SPSQKA +V  ++++   +
Sbjct: 1102 IAHCVVVIDGSTLTTFESNPTLMSVFVELCTKTDSVICCRASPSQKALMVTHIRNTDKKL 1161

Query: 1124 MTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKR 1183
            +TLAIGDG+ND+AMIQSAD+G+GIAG+EG QA   SDY+I QFR+L +L+LVHGR++Y R
Sbjct: 1162 VTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSSDYSIAQFRFLLKLLLVHGRYNYVR 1221

Query: 1184 LAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQD 1243
              + +   FYK ++F L    Y  +  F G+ LYE   +  +N  FTSLPV+ +G+ ++D
Sbjct: 1222 TTKFVLCTFYKELLFYLTQMIYQRHTMFSGTSLYEPWSLSMFNTLFTSLPVLCIGMFEKD 1281

Query: 1244 VNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGL 1303
            +     L +P+LY +G L + +N R FL++M      S+I  F  + ++        + L
Sbjct: 1282 LKPMTLLAIPELYSIGRLSQSFNLRVFLYWMFLAALNSLIITFLNWKIW------AVSSL 1335

Query: 1304 GLDHRYFVGVY----VTTIAVISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSA 1359
              +  Y +GV     + T+  + C    LL  +  +  +   + +S      W  +    
Sbjct: 1336 SDNTVYPIGVINFTAIITLVNVKCQ---LLETHNRNVLAICSLVISVGGWLLWCCLLPGI 1392

Query: 1360 IASREFFKAAARIY----GAPSFWAVFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMW 1415
             +    +     +Y       +FW    V V+  L+    + + +   +P+D EI  E+ 
Sbjct: 1393 YSEDGMYDVLTGLYFQFGNDITFWCACLVLVVLPLIIDVVFKTVKIMIFPSDSEISMELE 1452

Query: 1416 Q 1416
            Q
Sbjct: 1453 Q 1453

 Score =  268 bits (686), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 228/785 (29%), Positives = 372/785 (47%), Gaps = 120/785 (15%)

Query: 182 DEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPG 241
           +  G P   Y  N I +++YT  TFLP+ +  QF   AN YF ++ +L          PG
Sbjct: 102 ERSGKP---YISNLITSSRYTIYTFLPRQLYAQFSRLANAYFFLVAVLQMI-------PG 151

Query: 242 LSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVENEN---VSTDNISLWRR 298
            S       ++   I   I  SR    D      + H L+  EN+    V   + S    
Sbjct: 152 WSTTGTYTTIVPLLIFMGISMSREAWDDF-----RRHKLDREENDKTARVLVKSSSPHTE 206

Query: 299 FKKANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQKTVGTSGPRSSLDSIDSYRVS 358
           F + NS  L+   Q+                   +     T   + P  +L+S      S
Sbjct: 207 FSRPNS--LYSLPQW-------------------QQSATSTSMLTNP--TLESTAEAATS 243

Query: 359 ADYGRPSLDYDNLEQGAGEANIVDRSLPPRTDCKFAKNYWKGVKVGDIVRIHNNDEIPAD 418
            +    + D                 L  +   +  +  WK +KVGD V +  ++ +PAD
Sbjct: 244 QNDDHTNWDL----------------LKSKYGVEAVEKKWKDIKVGDYVVLEQDEWVPAD 287

Query: 419 IILLSTSDTDGACYVETKNLDGETNLKVRQSL-KCTNTIRTSKDIARTKFWIESEGPHSN 477
           +++L+ SD    C+VET  LDGETNLK +Q L + +  ++T+  +   K  +  E P+ +
Sbjct: 288 MLVLTCSDEKNECFVETMALDGETNLKNKQPLTEVSEVMKTAAGLTEFKAKVTVEDPNID 347

Query: 478 LYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMGVVMFTGGDTKIMLNSGI 537
           L+ ++GN++      GE R   I  ++++ RG  +RNT  A+G+V+FTG +TKI +N+  
Sbjct: 348 LHNFEGNLELL----GENRKLTIGPDHIIYRGSIIRNTSNAVGMVVFTGEETKIRMNAIK 403

Query: 538 TP-TKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKK-GRSRFSYEFGTIAGSAA 595
            P  K  ++ R +N  V+    ++  +   S +   +   K    +R  Y F + AG A 
Sbjct: 404 NPRIKAPKLQRAINLIVLFMVFVVASMALFSLLGQRIIKKKYVDNNRAWYLFNSDAGLAP 463

Query: 596 TNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNIS 655
           T   +SF   +I+Y +L+P+SLY+++EIIK  Q+  +  D+ +Y+A+ + PC  ++  I 
Sbjct: 464 T--VMSF---IIMYNTLIPLSLYVTMEIIKAMQSKLMEWDIDMYHAETNTPCESRTATIL 518

Query: 656 DDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGID---VETEG 712
           ++LGQV YIFSDKTGTLT N M F+  ++ G S+   +  A   L K +  D   VE   
Sbjct: 519 EELGQVSYIFSDKTGTLTDNKMVFRALSVCGSSWIHDFDPAAEKLTKSESSDSNTVEVVS 578

Query: 713 RREKAEI----AKDRDTMIDELRAL--SGNS----------------------QFYPEEV 744
             +++ +    A DR    +   ++   GNS                      +  PE+ 
Sbjct: 579 VDDRSFLQNFGAADRKVPSNHKTSIDYKGNSSAIYTGRPSMASRICEEDKNPKKIEPEKS 638

Query: 745 TFV----SKEFVRDLKGASGEVQQRCCEHFMLALALCHSVLVEANP--DNPKKLDLKAQS 798
           +      S E +R ++        +    F+L+LALCH+ L +++   +    ++ +A S
Sbjct: 639 SKTGLRSSTELIRYIQQNPNTHFAKKVSFFILSLALCHACLPKSSSGVEGEDCVEYQASS 698

Query: 799 PDEAALVATARDVGFSFVGKTKKGLIIEM--QGIQKE-----FEILNILEFNSSRKRMSC 851
           PDE ALV  ARD+G++ + +    L I+    G   E     +EILN +EF+S RKRMS 
Sbjct: 699 PDELALVTAARDMGYAVMNRNSDVLTIKTYPNGFDAEPHLDKYEILNNIEFSSHRKRMSV 758

Query: 852 IVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTL 911
           +V++    P +E R LLICKGAD++I  RL     +N + I+E      E+ A E    L
Sbjct: 759 LVRL----PHEENRILLICKGADNVILERLHNSDLAN-QKIVELQETTSERKAAEA--DL 811

Query: 912 CIAQR 916
            + QR
Sbjct: 812 VLKQR 816

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score =  311 bits (797), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 190/538 (35%), Positives = 292/538 (54%), Gaps = 45/538 (8%)

Query: 888  NSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVV 947
            N E ILEKT   +++++TEGLRTL  + + +   EY+ W  KY  A  SL NR  ++  V
Sbjct: 932  NEEFILEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQIAEV 991

Query: 948  ADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLN 1007
               IE +L LLG TAIED+LQ+GVP+ I+ +  AGIK+W+LTGDK ETAINIG++C L+ 
Sbjct: 992  GGHIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYACKLIY 1051

Query: 1008 NEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGN 1067
            +   ++++K   D+              L+SK       +T   EE+   K  H      
Sbjct: 1052 DYSTVVILKKNDDN--------------LISK-------MTALGEELDTGKIAH------ 1084

Query: 1068 YAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVK-DSLDVMTL 1126
              +VIDG +L +      +   F+ LC    +V+CCR SPSQKA +V  ++  + D++TL
Sbjct: 1085 CVLVIDGASLAVFENNPTMMSVFIELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTL 1144

Query: 1127 AIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKRLAE 1186
            AIGDG+ND+AMIQSAD+G+GI G+EG QA   SDY+I QFRYL +L+ VHGR++Y R ++
Sbjct: 1145 AIGDGANDIAMIQSADIGVGITGKEGLQASRSSDYSIAQFRYLLKLLFVHGRYNYVRTSK 1204

Query: 1187 MIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQDVND 1246
             +   FYK ++F L    Y     F G+ LYE   +  +N  FTSLPVI +G+ ++D+  
Sbjct: 1205 FVLCTFYKEVLFYLTQMIYQRQTMFSGTSLYEPWSLSMFNTLFTSLPVICIGMFEKDLKP 1264

Query: 1247 TISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLD 1306
               L VP+LY +G   + +N + FL +ML     S++  F  + ++       S+    +
Sbjct: 1265 MTLLAVPELYTMGQKCQAFNLKIFLVWMLTAAGISVLITFLNFEIW--GFTAQSD----N 1318

Query: 1307 HRYFVGVY-VTTIAV---ISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAIAS 1362
              Y +GV   T+I     + C  ++      W  F+ L I  SC+    W  +       
Sbjct: 1319 SIYPIGVINFTSICFLINVKCQ-FIETRNRNWLAFASLLI--SCIGWILWCCLLPGIYGE 1375

Query: 1363 REFFKAAARIYGA----PSFWAVFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQ 1416
               +     +Y       ++WA   + ++F ++      +F+   +PTD +I  E+ Q
Sbjct: 1376 NAIYDVLIGLYHQFGRDITWWASCLILIMFPMMIDIVCQTFRAMIWPTDGDIFAELEQ 1433

 Score =  278 bits (710), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 238/786 (30%), Positives = 366/786 (46%), Gaps = 142/786 (18%)

Query: 180 MIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTN 239
           +IDE  +    Y  N I +++YT  +FLP+ +  QF   AN YFL++ IL     +  T 
Sbjct: 107 LIDERTD--RPYRDNVITSSRYTVYSFLPRQLYAQFSKLANAYFLLVAILQMIPSWSTTG 164

Query: 240 PGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVENENVSTDNISLWRRF 299
              + VPL + + I+  ++A +D +R  LD              E  N ST  +++ +  
Sbjct: 165 TYTTIVPLSIFLSISMAREAWDDFKRHRLD-------------KEENNKSTKVLTMGKDH 211

Query: 300 KKANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQKTVGTSGPRSSLDSIDSYRVSA 359
            +  S  ++                               V      + L   +S     
Sbjct: 212 DELESDSIYSL---------------------------SNVSARSTDAILSDFNSMHNLN 244

Query: 360 DYGRPSL--DYDNLEQGAGEANIVDRSLPPRTDCKFAKNYWKGVKVGDIVRIHNNDEIPA 417
           D   PS    + NL             L  + D    K  WK +KVG+ V ++++D +PA
Sbjct: 245 DVTEPSYTDHFTNLNL-----------LRSQFDIHIKKKEWKDLKVGEFVLLNSDDWVPA 293

Query: 418 DIILLSTSDTDGACYVETKNLDGETNLKVRQSL-----KCTNTIRTSKDIARTKFWIESE 472
           DI+LLST   +   +VET  LDGETNLK +  L     + T+    S   A T      E
Sbjct: 294 DILLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRMTSATGLSMHSATTTL----E 349

Query: 473 GPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMGVVMFTGGDTKIM 532
            P+++LY ++G ++     DGE+   P+  +NV+ RG  LRNT+  +G+V+FTG +TKI 
Sbjct: 350 DPNNDLYNFEGTVE----IDGELY--PLGSDNVVYRGSILRNTQSIVGIVIFTGEETKIR 403

Query: 533 LNSGITP-TKKSRISRELNFSVVINFVLLFILCFVSGIAN----GVYYDKKG---RSRFS 584
           +N+   P TK  ++  +      IN ++LF++  V+ +A     G +  KK     +R  
Sbjct: 404 MNAIKNPRTKAPKLQGK------INLIVLFMVFVVAAMAMFSYLGQHILKKNYVDNNRAW 457

Query: 585 YEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLD 644
           Y F   AG+A T   +SF   +I+Y +L+P+SLY++ EIIK  Q+  +  D+ +Y+ + D
Sbjct: 458 YLFQEDAGTAPT--IMSF---IIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYHIESD 512

Query: 645 YPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSY--------------- 689
            PC  ++  I ++LGQV YIFSDKTGTLT N M F+K +I G S+               
Sbjct: 513 TPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSICGSSWLHEIDEDLIDPIDDD 572

Query: 690 -------GRAYTEAL---AGLRKRQGIDVETEGR-------REKAEIAKDRDTMIDELRA 732
                   R++       +   K     +E +G        R    +   R  + ++L  
Sbjct: 573 IDVISIEDRSFLNEFDLRSTHSKNPRTSIEYKGNSGAVYSGRPSMALQIQRQELAEDLNT 632

Query: 733 LSGNSQFYPEEVTFVSKEFVRDL-----KGASGEVQQRCCEHFMLALALCHSVLVEANPD 787
              NS    EE   +      DL     K  + E   R  + F+L+LALCH+ L +   D
Sbjct: 633 TRTNSSRSSEEKNGLKTTV--DLLLYIQKHPNTEFSIR-AKFFILSLALCHTCLPKKTHD 689

Query: 788 NPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLIIEM-------QGIQKEFEILNIL 840
               +  ++ SPDE ALV  ARD+GF    +    L I         Q I +++E+L  +
Sbjct: 690 GTDSILYQSSSPDELALVTAARDMGFVVTNRNSSTLSIATYPNGFDDQPIVEDYEVLEYI 749

Query: 841 EFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEKTALHL 900
            F+S RKRMS  VK+    P D+ R LLICKGAD++I  RL R S      +LE+  L +
Sbjct: 750 NFDSQRKRMSVAVKM----PNDDDRVLLICKGADNVILERL-RNSELAQNKVLEQQNL-I 803

Query: 901 EQYATE 906
           EQ   E
Sbjct: 804 EQRKLE 809

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score =  310 bits (795), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 185/540 (34%), Positives = 293/540 (54%), Gaps = 49/540 (9%)

Query: 888  NSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVV 947
            N E ++E+T   +++++TEGLRTL  A + +   +YE WN++Y  A  SL +R+ +++  
Sbjct: 1013 NEEYVIERTLQAIDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEA 1072

Query: 948  ADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLN 1007
               IE  L LLG TAIED+LQDGV + IE +  AGIK+W+LTGDK ETAINIG+SC L+ 
Sbjct: 1073 GAEIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIK 1132

Query: 1008 NEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGN 1067
            +   ++++ TT +++    +  S+ VD+                              GN
Sbjct: 1133 DYSTVVILTTTDENIISKMNAVSQEVDS------------------------------GN 1162

Query: 1068 YA---IVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDS-LDV 1123
             A   +VIDG  + +          F+ LC    +V+CCR SPSQKA +V  ++++  ++
Sbjct: 1163 IAHCVVVIDGATMAMFEGNPTYMSVFVELCTKTDSVICCRASPSQKALMVSNIRNTDPNL 1222

Query: 1124 MTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKR 1183
            +TLAIGDG+ND+AMIQSAD+G+GIAG+EG QA   SDY+IGQFR+L +L+ VHGR++Y R
Sbjct: 1223 VTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQFRFLLKLLFVHGRYNYIR 1282

Query: 1184 LAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQD 1243
             ++ +   FYK + F      Y  Y  F GS LYE   +  +N  FTSLPV+ +G+ ++D
Sbjct: 1283 TSKFMLCTFYKEITFYFTQLIYQRYTMFSGSSLYEPWSLSMFNTLFTSLPVLCIGMFEKD 1342

Query: 1244 VNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGL 1303
            +     L VP+LY  G L + +N   F+ +++     S+I  F   +++        + L
Sbjct: 1343 LKPMTLLTVPELYSYGRLSQGFNWLIFMEWVILATTNSLIITFLNVVMWGM------SSL 1396

Query: 1304 GLDHRYFVGV--YVTTIAVISCNT-YVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAI 1360
              +  Y +G+  +   +A+I+  + +V +H   W  F+   + LSC     W        
Sbjct: 1397 SDNTMYPLGLINFTAIVALINVKSQFVEMHNRNWLAFTS--VVLSCGGWLVWCCALPILN 1454

Query: 1361 ASREFFKAAARIYGA----PSFWAVFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQ 1416
             + + +  A   Y       +FW    V  L  +     Y +F+   +P+D +I  E+ Q
Sbjct: 1455 NTDQIYDVAYGFYNHFGKDITFWCTSLVLALLPITLDIVYKTFKVMIWPSDSDIFAELEQ 1514

 Score =  241 bits (616), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 185/604 (30%), Positives = 305/604 (50%), Gaps = 105/604 (17%)

Query: 398 WKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTI- 456
           W+ ++VGD V +  +D +PAD++LL+    +  C+VET  LDGETNLK +Q     N + 
Sbjct: 299 WEKLRVGDFVLLTQDDWVPADLLLLTCDGENSECFVETMALDGETNLKSKQPHPELNKLT 358

Query: 457 RTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTK 516
           + +  +A     +  E P+ +LY ++GN++ +N  +  I   P+  +NV+ RG  LRNT+
Sbjct: 359 KAASGLANINAQVTVEDPNIDLYNFEGNLELKNHRNDTIMKYPLGPDNVIYRGSILRNTQ 418

Query: 517 WAMGVVMFTGGDTKIMLNSGITP-TKKSRISRELNFSVVINFVLLFILCFVSGIANGVYY 575
             +G+V+F+G +TKI +N+   P TK  ++ R++N  +V    ++  +   S + + V +
Sbjct: 419 NVVGMVIFSGEETKIRMNALKNPRTKAPKLQRKINMIIVFMVFVVATISLFSYLGH-VLH 477

Query: 576 DKK--GRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIY 633
            KK   +++  Y F   AG A T   +SF   +I+Y +++P+SLY+++EIIK  Q+  + 
Sbjct: 478 KKKYIDQNKAWYLFQADAGVAPT--IMSF---IIMYNTVIPLSLYVTMEIIKVVQSKMME 532

Query: 634 GDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVM---EFKKCT---INGV 687
            D+ +Y+A+ + PC  ++  I ++LGQV YIFSDKTGTLT N M   +F  C    ++ V
Sbjct: 533 WDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSWLHNV 592

Query: 688 SYG---------RAYTEALAGLRKRQ---GIDVETEGRR--------EKAEIAKDRDTMI 727
             G         R  T +L    K      IDV + G +          A I K     +
Sbjct: 593 DLGNSEDNFEDNRDNTNSLRLPPKAHNGSSIDVVSIGDQNVLDRLGFSDAPIEKGHRPSL 652

Query: 728 D-----------------------ELRALSG--NSQFYPE-EVTFVSKEFVRDLKGASGE 761
           D                        +R+L G  NS    +  V   S+ F  ++K +   
Sbjct: 653 DNFPKSRNSIEYKGNSSAIYTGRPSMRSLFGKDNSHLSKQASVISPSETFSENIKSSFDL 712

Query: 762 VQ--QRC--------CEHFMLALALCHSVLVEANPDNP---KKLDLKAQSPDEAALVATA 808
           +Q  QR          + F L+LALCHS L +   +       ++ ++ SPDE ALV  A
Sbjct: 713 IQFIQRYPTALFSQKAKFFFLSLALCHSCLPKKTHNESIGEDSIEYQSSSPDELALVTAA 772

Query: 809 RDVGFSFVGKTKKGLIIEM-------QGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPG 861
           RD+G+  + +  + L I+        +   + +EILN ++FNS RKRMS +V++P     
Sbjct: 773 RDLGYIVLNRNAQILTIKTFPDGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMP----- 827

Query: 862 DEP-RALLICKGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSW 920
           ++P + LLICKGAD++I  R                 LH  + A + +  +C + +E   
Sbjct: 828 NQPNQVLLICKGADNVIMER-----------------LHDRELAAKKMADICTSTKERKD 870

Query: 921 SEYE 924
           +E E
Sbjct: 871 AEAE 874

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 54/101 (53%), Gaps = 2/101 (1%)

Query: 180 MIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTN 239
           +IDE  N    Y  N+I +++YT  +FLP+ +  QF   AN YF ++ +L     +  T 
Sbjct: 129 LIDERFNK--PYCDNRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQMIPGWSTTG 186

Query: 240 PGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHIL 280
              + +PL V + I+  ++A +D RR  LD E NN    +L
Sbjct: 187 TYTTIIPLCVFMGISMTREAWDDFRRHRLDKEENNKPVGVL 227

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score =  297 bits (761), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 193/563 (34%), Positives = 292/563 (51%), Gaps = 62/563 (11%)

Query: 887  SNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEV 946
            +N E ++E+T   ++ + TEGLRTL  + + +   EYE WN +Y  A A+L NR ++++ 
Sbjct: 932  TNEEYVIERTLQDMDAFTTEGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQMDT 991

Query: 947  VADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLL 1006
            V + IER+L LLG   IED+LQ+GVPD I+ L  AGIK+W+LTGDK ETAINIG+SC L+
Sbjct: 992  VGEIIERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLI 1051

Query: 1007 NNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKG 1066
            ++   ++++    +++    S+ + I                             E   G
Sbjct: 1052 HDYSTVIILAPNDENM---ASKITTIT---------------------------QEIEAG 1081

Query: 1067 NYA---IVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVV-KLVKDSLD 1122
            N A   +VIDG  L +      +   F+ LC    +V+CCR SPSQKA +V K+ K    
Sbjct: 1082 NVAHCVVVIDGATLTIFEGNLTLMTLFIELCTKTDSVICCRSSPSQKALMVTKIRKTDKK 1141

Query: 1123 VMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYK 1182
            ++TLAIGDG+ND+AMIQSAD+G+ I G+EG QA   SDY+I QFRYL +L+LVHGR++Y 
Sbjct: 1142 LVTLAIGDGANDIAMIQSADIGVDITGKEGLQASRSSDYSIAQFRYLLKLLLVHGRYNYI 1201

Query: 1183 RLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQ 1242
            R ++ +   FYK  +F L    + I   F G+  YE   +  +N  FTSLPV+ +G+ ++
Sbjct: 1202 RTSKFVLCTFYKEFVFYLTQLIFQINTMFSGTSQYEPWCLTVFNTLFTSLPVLCIGMFEK 1261

Query: 1243 DVNDTISLVVPQLYRVGILRKEWNQRKFL-WYMLDGLYQSIICFFFPYLVYHKNMIVTSN 1301
            D+     L +P+LY  G   + +N   FL W  +  L   IICF         N    S 
Sbjct: 1262 DLKSVTLLSIPELYTTGRQSQAFNLVIFLRWMAIAALSSVIICF--------TNWQCWSL 1313

Query: 1302 GLGLDHR-YFVGVYVTTIAVISCNTYVLLHQY---RWDWFSGLFIALSCLVVFAWTGIWS 1357
                D+  Y +G+   T  V+  N    L +     W  F+  FI++   +   W  +  
Sbjct: 1314 TAQSDNTLYPIGLINYTAVVVLVNVKCQLLEMANRNWLAFASFFISVCGWL--CWCLLLP 1371

Query: 1358 SAIASREFFKAAARIYG--AP--SFWAVFFVAVLFCLLPRFTYDSFQKFFYPTDVEI--- 1410
            +       +     +Y    P  +FWA   V VL  ++    + + +   YP+D EI   
Sbjct: 1372 AIYKETLVYDVREGLYHQFGPDITFWATNLVLVLLPVMLDLLFKTCKVIIYPSDTEIFAE 1431

Query: 1411 ------VREMWQHGHFDHYPPGY 1427
                  VR+  + G F+    G+
Sbjct: 1432 LEQRDAVRKKLEFGAFNELKQGW 1454

 Score =  240 bits (612), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 175/541 (32%), Positives = 285/541 (52%), Gaps = 67/541 (12%)

Query: 398 WKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSL-KCTNTI 456
           WK V+VG+ V ++ +D +PAD+ LL+T   +  CYVET  LDGETNLK +  L K  +  
Sbjct: 241 WKDVEVGEFVLLNQDDWVPADLFLLATDGDNNECYVETMALDGETNLKCKHVLPKIASQT 300

Query: 457 RTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTK 516
           RT+  +A  +     E P+ +LY ++G ++      GE +   I ++NVL RG  +RNT+
Sbjct: 301 RTASGLATFRGMTTVEDPNIDLYNFEGKIEVET-DSGEQQAYSIGLDNVLFRGSIIRNTQ 359

Query: 517 WAMGVVMFTGGDTKIMLNSGITPTKKS-RISRELNFSVVINFVLLFILCFVSGIANGVYY 575
             +G+V+FTG +TKI +N+   P  KS ++  ++N  V+   +++ I  F+S      + 
Sbjct: 360 TVVGMVVFTGEETKIRMNAIKNPRIKSPKLQTQINLIVLFMILVVAIFSFLSFGLQRFFK 419

Query: 576 DKKGRS-RFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYG 634
           +++  S R  Y     AG A T   +SF   +I+Y +L+P+SLY+++EIIK  Q+  +  
Sbjct: 420 NREVDSDRAWYLMKVDAGLAPT--IMSF---IIMYNTLIPLSLYVTMEIIKDMQSRLMEW 474

Query: 635 DVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSY----G 690
           D+ +Y+ + +  CT ++  I ++LGQV YIFSDKTGTLT N M F+K +  G ++     
Sbjct: 475 DIDMYHLETNTGCTSRTATILEELGQVSYIFSDKTGTLTDNRMIFRKFSFCGTAWEHDVA 534

Query: 691 RAYTEALAGLRKR--QGIDVETEGRREKAEI-AKDRDTMID------------------- 728
           R   E      K+  + I VE+    +  E+ + D  T ++                   
Sbjct: 535 RKDQETGCSQTKKDVEVISVESNSFIKNFELNSTDTRTSVEYKGLASATYTGRPSIASQI 594

Query: 729 ELRALSGNS-----------------QFYPEEVTFVSKEFVRDLKGASGEVQQRCCEHFM 771
           EL  L  NS                    PE     S + +  ++     V  +  + F+
Sbjct: 595 ELMKLQQNSANTNKSSSPKISRLPTLDSSPEPKLKTSLDLIMHIQLNPNTVFSQRAKFFI 654

Query: 772 LALALCHSVLVE----ANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLII-- 825
           LALALCH+ L +    A+  +   ++ ++ SPDE ALV  ARD+G+  + +    L I  
Sbjct: 655 LALALCHTCLPKKRQGADSGDFDSVEYQSSSPDELALVTAARDMGYVVLNRNGDELTIKT 714

Query: 826 -----EMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSR 880
                E   + +++E+LN ++F+S RKRMS +V++   +P    + LLICKGAD++I  R
Sbjct: 715 YPDGFEADCVLEKYEVLNTIDFSSDRKRMSVLVRMHQ-HP---EKVLLICKGADNVILER 770

Query: 881 L 881
           L
Sbjct: 771 L 771

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 46/92 (50%)

Query: 189 MQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPGLSAVPLV 248
           + Y  N I +++Y+  +FLP+ +  QF    N YF  + IL     +  T    + VPL 
Sbjct: 108 LPYIGNAITSSRYSVYSFLPRQLCAQFSKVVNSYFFGMAILQMVPNWSTTGQYTTIVPLS 167

Query: 249 VIVIITAIKDAIEDSRRTVLDLEVNNTKTHIL 280
           + + I+  ++  ED RR  LD E NN    +L
Sbjct: 168 IFMGISIAREGWEDFRRHKLDREENNKLVKVL 199

>Scas_669.3
          Length = 1638

 Score =  295 bits (756), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 211/676 (31%), Positives = 335/676 (49%), Gaps = 91/676 (13%)

Query: 860  PGDEPRA---LLICKGADSIIYSRLSRQSGS-----NSEAILEKTALHLEQYATEGLRTL 911
            PG++P A   L      D+ +   +    GS     N   ++EKT   +++++TEGLRTL
Sbjct: 951  PGNKPNAKHYLKPVSTEDARVEKGMLEYIGSDDLLLNDGYVIEKTIQAIDEFSTEGLRTL 1010

Query: 912  CIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGV 971
              + + +   EY++W ++Y  A  SL NR+ ++  V + IE++L LLG TAIED+LQ+GV
Sbjct: 1011 VYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAEVGEEIEQDLQLLGATAIEDKLQEGV 1070

Query: 972  PDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSE 1031
             + IE +  AGIK+W+LTGDK ETAINIG+SC L+  +   +VI   GD+          
Sbjct: 1071 SEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLI-YDYSTVVILAKGDE---------- 1119

Query: 1032 IVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYA---IVIDGDALKLALYGEDIRR 1088
                          N+      I       E   GN A   I+IDG  L +      +  
Sbjct: 1120 --------------NIISKMNAI-----SQEVDSGNVAHCVIIIDGSTLAMFEGNPTLMS 1160

Query: 1089 KFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDS-LDVMTLAIGDGSNDVAMIQSADVGIGI 1147
             F+ LC    +V+CCR SPSQK+ +V  +++S  +++TLAIGDG+ND+AMIQSAD+GIGI
Sbjct: 1161 VFIELCTKTDSVICCRASPSQKSLMVTNIRNSNKNLVTLAIGDGANDIAMIQSADIGIGI 1220

Query: 1148 AGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGI 1207
             G+EG QA   +DY+I QFR++ +L+LVHGR++Y R A+ I   F+K + F L    +  
Sbjct: 1221 GGKEGLQASRTADYSIAQFRFILKLLLVHGRYNYIRTAKFILCTFFKEITFYLTQLIFQR 1280

Query: 1208 YNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQ 1267
            Y  F GS LYE   +  +N  FTSLPV+ +G+ ++D+     L +P+LY +G L + +N 
Sbjct: 1281 YTMFSGSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLTIPELYSMGRLSQGFNL 1340

Query: 1268 RKF-LWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLDHR-YFVGV--YVTTIAVISC 1323
              F  W +    Y  +I F         N+I+       DH  Y +GV  +   +A+++ 
Sbjct: 1341 IIFGEWVIQAAAYALLITFL--------NIIIWGETALSDHTMYPLGVINFTAIVALVNV 1392

Query: 1324 NT-YVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAIASREFFKAAARIYGAP------ 1376
               ++ ++   W  F+   + LSC       G W     +      +  IY  P      
Sbjct: 1393 KCQFIEMNNRNWVVFTS--VILSC-------GGWLVWCCALPILNRSDVIYDVPYGFFYH 1443

Query: 1377 -----SFWAVFFVAVLFCLLPRFTYDSFQKFFYPTDVEI---------VREMWQHGHFDH 1422
                 ++W   FV  +  +     Y +F+   +P+D +I         +R+  + G ++ 
Sbjct: 1444 FGKDITWWCSCFVLAVLPITIDIVYQTFKTMIWPSDADIFSVLEQKSEIRKKLEMGAYNE 1503

Query: 1423 YPPGYD-PTDPNRPK------VTKAGQHGEKIIEGIALSDNLGGSNYSRDSVVTEEIPMT 1475
               G+    DPN  K      +T   + G    E + +    G       + +  E+P+ 
Sbjct: 1504 MKQGWTWEHDPNAFKRYKEKILTAHSRSGSYTDEEMEIGTREGNPKVFSKTTMKAEVPLN 1563

Query: 1476 FMHGEDGSPSGYQKQE 1491
                 +G+ S Y  +E
Sbjct: 1564 VQSKMNGNFSKYNPEE 1579

 Score =  248 bits (634), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 179/566 (31%), Positives = 295/566 (52%), Gaps = 87/566 (15%)

Query: 385 LPPRTDCKFAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNL 444
           L  R   +  +  W  + VGD V +  ++ +PADI++L++   +  C+VET  LDGETNL
Sbjct: 272 LEERHGVRIQETTWSNLHVGDFVLLKQDNWVPADILVLTSDGDNNECFVETMALDGETNL 331

Query: 445 KVRQSLKCTNTIRTSKD-IARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITIN 503
           KV+Q     N +  S   +A     I  E P+S+LY ++GN++  +  +  ++  P+  +
Sbjct: 332 KVKQPHPELNKLACSASGLANINALITVEDPNSDLYNFEGNLELTDNNNNSLKKYPVGPD 391

Query: 504 NVLLRGCTLRNTKWAMGVVMFTGGDTKIMLNSGITP-TKKSRISRELNFSVVINFVLLFI 562
           NV  RG  +RNT   +G+V++TG +TKI +N+   P TK  ++ + +N  ++I F ++F+
Sbjct: 392 NVAYRGSIIRNTDNVIGMVIYTGKETKIRMNALNNPRTKAPKLQKNIN--IIITF-MVFV 448

Query: 563 LCFVSGIA--NGVYYDKKG--RSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLY 618
           +  +S  +    V  +KK    ++  Y     AG+A T   +SF   +I+Y +++P+SLY
Sbjct: 449 VAVISLFSYLGHVLQNKKAIDENQAWYLLTKDAGAAPT--IMSF---IIMYNTIIPLSLY 503

Query: 619 ISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVME 678
           +++EIIK  Q+  +  D+ +Y+++ + PC  ++  I ++LGQV Y+FSDKTGTLT N M 
Sbjct: 504 VTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMFSDKTGTLTDNKMI 563

Query: 679 FKKCTINGVSYGRAYTEALAGLRK------RQGID-------------VETEGRREKAEI 719
           F+K +I G S+  +       L K         ID             V+TEG  E    
Sbjct: 564 FRKFSICGSSWLHSTDLGSNALYKGSPNSNNSDIDVVSLENQSLLDKFVKTEGSTE---- 619

Query: 720 AKDRDTMIDELRA---LSGNS-----------QFYPEEVTF------------------- 746
             D  T     RA     G S             YP+++                     
Sbjct: 620 -LDARTNFPNFRASVEYKGTSSAVYTGRPSMRSLYPQDLHLTPNPSRSSRGTSDAPDNIK 678

Query: 747 VSKEFVRDLKGASGEVQQRCCEHFMLALALCHSVLVEAN--PDNPKK-LDLKAQSPDEAA 803
            S + ++ ++     +  +  + F+L+LALCH+ L + +  P+  +  ++ ++ SPDE A
Sbjct: 679 TSFDLIQFIQHNPNTLFAKKAKFFILSLALCHTCLPKKSNFPEGGEDVIEYQSSSPDELA 738

Query: 804 LVATARDVGFSFVGKTKKGLII-------EMQGIQKEFEILNILEFNSSRKRMSCIVKIP 856
           LV  ARD+G+  + K    L I       E + I ++++ILN ++FNS RKRMS +VK P
Sbjct: 739 LVTAARDLGYVVLNKNADVLTIKTYPDGFENEPIFEDYQILNYIDFNSQRKRMSVLVKTP 798

Query: 857 GLNPGDEP-RALLICKGADSIIYSRL 881
                DEP + LLICKGAD++I  RL
Sbjct: 799 -----DEPNKVLLICKGADNMILERL 819

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 54/101 (53%), Gaps = 2/101 (1%)

Query: 180 MIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTN 239
           +IDE  + +  Y  N I +++YT  +F PK +  QF   ANVYF V+ IL     +  T 
Sbjct: 131 LIDERTSSV--YCNNNITSSRYTIYSFFPKQLYAQFSKVANVYFFVVAILQMIPGWSTTG 188

Query: 240 PGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHIL 280
              + VPL + + I+  ++A +D RR  LD E NN    IL
Sbjct: 189 TYTTIVPLCIFMGISMAREAWDDFRRHRLDKEENNKTCSIL 229

>Scas_505.4
          Length = 1025

 Score =  243 bits (619), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 137/376 (36%), Positives = 209/376 (55%), Gaps = 11/376 (2%)

Query: 1057 AKKDHEFPK---GNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAV 1113
            A K+H+  +      A+VIDG +L  AL   D+    L L K C+AV+CCRVSP QKA V
Sbjct: 544  ALKEHKLSQHEMNTLALVIDGKSLSYAL-ESDLEDYLLALGKICKAVVCCRVSPLQKALV 602

Query: 1114 VKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLV 1173
            VK+VK     + LAIGDG+NDV+MIQ+A VG+GI+G EG QA   +D A+GQFR+L +L+
Sbjct: 603  VKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLL 662

Query: 1174 LVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLP 1233
            LVHG WSY+R++  I   FYKN    +  FW+   N F G  + E   M +YN+ FT  P
Sbjct: 663  LVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFP 722

Query: 1234 VIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYH 1293
               +G+ DQ V+  +    PQLY++G   K ++ R F  ++++G Y S + +    L Y 
Sbjct: 723  PFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYR 782

Query: 1294 KNMIVTSNGLGLDH-RYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALSCLVVFAW 1352
              M +  +G   DH  + + VY ++I ++     ++ +Q  W  F+   I  S +    +
Sbjct: 783  YGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQ--WTKFTLFAIPGSFIFWMIF 840

Query: 1353 TGIWSS----AIASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQKFFYPTDV 1408
              I++S    A  SRE+F      YG+ +FW    V  +F L+  F +  +++ + P   
Sbjct: 841  FPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEPESY 900

Query: 1409 EIVREMWQHGHFDHYP 1424
             +V+EM +    D+ P
Sbjct: 901  HLVQEMQKFNISDNRP 916

 Score =  156 bits (394), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 74/196 (37%), Positives = 124/196 (63%), Gaps = 7/196 (3%)

Query: 393 FAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKC 452
           F +  W  ++ GD++R+ + + IPAD+I++S+S+ +G CY+ET NLDGETNLK++Q+   
Sbjct: 333 FIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPE 392

Query: 453 TNTIRTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTL 512
           T  +  S+ +   K  + SE P+S+LYTY+G +++ N      R  P++   ++LRG TL
Sbjct: 393 TAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNN------RKIPLSPEQMILRGATL 446

Query: 513 RNTKWAMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANG 572
           RNT W  G+V+FTG +TK+M N+  TP K++ + R +N  +V  F +L +L  +S + N 
Sbjct: 447 RNTSWMFGLVIFTGHETKLMRNATATPIKRTAVERVINLQIVALFGVLIVLVLISSLGNA 506

Query: 573 VYYDKKGRSRFSYEFG 588
           +    + +   SY +G
Sbjct: 507 IISSTQEK-HLSYLYG 521

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 54/98 (55%)

Query: 182 DEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPG 241
           D   N    Y  N I TTKY   TFLPK +  +F  +AN++FL    +        TN  
Sbjct: 228 DRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSPTNRY 287

Query: 242 LSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHI 279
            +   L+V++I++A K++IED +R   D E+NN+KT I
Sbjct: 288 TTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEI 325

>Scas_89.1
          Length = 271

 Score =  159 bits (403), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 158/290 (54%), Gaps = 34/290 (11%)

Query: 923  YEKWNEKYDIAAASLANREDELE-VVADSIERELILLGGTAIEDRLQDGVPDCIELLAEA 981
            Y+K+ ++Y  A+ S+ N ++ +  V+   +E  L LLG T +ED+LQ+ V   IELL  A
Sbjct: 2    YDKFEKEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNA 61

Query: 982  GIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYL 1041
            G+K+W+LTGDKVETA  +  S  L++    +  +           S P   ++AL     
Sbjct: 62   GVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKL--------SRPEGALNAL----- 108

Query: 1042 KEYFNLTGSEEEIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVL 1101
             EY  +  S                   ++IDG++L   ++    +++F  +  +  AV+
Sbjct: 109  -EYLKINKSS-----------------CLLIDGESL--GMFLTYYKQEFFDIVVDLPAVI 148

Query: 1102 CCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDY 1161
             CR +P QKA V  L+++        IGDG NDV+MIQ ADVG+GI G+EG+QA + +D+
Sbjct: 149  ACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADF 208

Query: 1162 AIGQFRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDF 1211
            ++ QF +L +L+L HGR SYKR A++     ++ +I ++    Y + +  
Sbjct: 209  SVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKL 258

>Kwal_26.9207
          Length = 1469

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 78/325 (24%), Positives = 138/325 (42%), Gaps = 54/325 (16%)

Query: 836  ILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQS-GSNSEAILE 894
            ++   EF S  +RMS IVK     P  E       KGA  +I    ++ +  +N E IL+
Sbjct: 934  VIRSFEFVSELRRMSVIVK-----PYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQ 988

Query: 895  KTALHLEQYATEGLRTLCIAQREL---SWSEYEKWNEKYDIAAASLANREDELEVVADSI 951
                   QY   G R +  A + L   +W   +K             +RE+        +
Sbjct: 989  -------QYTHNGYRVIACAGKTLPKRTWRFAQK------------VSREE--------V 1021

Query: 952  ERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEME 1011
            E  +  LG    E++L+      +  L +AGI+  + TGD V TAI++G    L+     
Sbjct: 1022 ESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESH- 1080

Query: 1012 LLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEY-FNLTGSEEEIFEAKKDHEFPKGNYAI 1070
             + +    D++     +P+E  D ++ + + +    L G   E      D       Y I
Sbjct: 1081 -VFVPQINDNM-----DPNE--DLIIWRDVDDCDLILDGVTLEPMNGSSD-------YTI 1125

Query: 1071 VIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGD 1130
             + GD  +L     ++  +  +     ++ +  R+SP +K  +V  ++  LD +    GD
Sbjct: 1126 AVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQ-GLDYVVGFCGD 1184

Query: 1131 GSNDVAMIQSADVGIGIAGEEGRQA 1155
            G+ND   +++ADVG+ ++  E   A
Sbjct: 1185 GANDCGALKAADVGVSLSEAEASVA 1209

>Scas_665.30
          Length = 1439

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 83/334 (24%), Positives = 138/334 (41%), Gaps = 69/334 (20%)

Query: 836  ILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQS-GSNSEAILE 894
            I+   EF S  +RMS IVK     P +E       KGA  +I    ++ +  +N E +L 
Sbjct: 704  IIRSFEFLSELRRMSVIVK-----PSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLN 758

Query: 895  KTALHLEQYATEGLRTLCIAQREL---SWSEYEKWNEKYDIAAASLANREDELEVVADSI 951
                    Y  +G R +  A R L   +W   +K             +RE+        +
Sbjct: 759  -------YYTHKGYRVIACAGRVLPRNTWLYSQK------------VSREE--------V 791

Query: 952  ERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEM- 1010
            E  +  LG    E++L+      ++ L EA I+  + TGD V TAI++G  CNL+ ++  
Sbjct: 792  ESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKV 851

Query: 1011 ---ELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGN 1067
                L  I +TG        +   + D L S+ L    N + +                +
Sbjct: 852  YVPSLEEIDSTG-QTSIIWRDVDNMDDTLDSRTLLPINNSSST----------------S 894

Query: 1068 YAIVIDGDALKLAL------YGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSL 1121
            Y + I GD  ++          ED     LL     +  +  R+SP +K  +++ ++  L
Sbjct: 895  YTLAITGDIFRIIFGDENNSISEDYINTVLL-----KGTIYARMSPDEKHELMEQLQ-RL 948

Query: 1122 DVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQA 1155
            +      GDG+ND   +++ADVGI ++  E   A
Sbjct: 949  NYTVGFCGDGANDCGALKAADVGISLSEAEASVA 982

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 98/423 (23%), Positives = 171/423 (40%), Gaps = 90/423 (21%)

Query: 767  CEHFMLALALCHSVLV----------------------EANPDNPKKLDLKAQSPDEAAL 804
             ++F+++L  CHS+ +                      E    N K   L  +  D + +
Sbjct: 823  AKNFLVSLLTCHSLRMVDGELLGDPFDFKMVQFTKWSDEEETGNRKVHSLYEERHDGSTM 882

Query: 805  VATARDVGFSFVGKTKKGLIIEMQ-----GIQKEFEILNILEFNSSRKRMSCIVKIPGLN 859
               +R    + V  + KG  IE +     GI + FE L      S+ +RMS IVK     
Sbjct: 883  PENSR-FAPAIVHPSGKGRFIEREPSNVIGIVRSFEFL------SNLRRMSVIVK----- 930

Query: 860  PGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQREL- 918
            P  E   +   KGA  +I+   S+Q+       L+  AL L  Y   G R +  A ++L 
Sbjct: 931  PFSENVFMSFTKGAPEVIFELCSKQTLP-----LDYEAL-LHHYTHNGYRVIACAGKKLT 984

Query: 919  --SWSEYEKWNEKYDIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIE 976
              SW   +K             +RE+        IE  L  LG    E++L+    + +E
Sbjct: 985  RQSWLYSQK------------VSREE--------IESNLEFLGFIIFENKLKGTTKETLE 1024

Query: 977  LLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKE----FGSEPSEI 1032
             L  A I+  + TGD V TAI++G    L+ +    + +    D  +E         +  
Sbjct: 1025 SLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANS 1084

Query: 1033 VDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLL 1092
             D L S  L+    L+G  ++              Y + + G+  +L    +  + + ++
Sbjct: 1085 SDTLDSVTLRP---LSGDTDD--------------YTLAVTGEVFRLLFKTDKSQIEEVI 1127

Query: 1093 LCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEG 1152
                 +  +  R+SP +K  +V+ ++ S+       GDG+ND   +++AD+GI ++  E 
Sbjct: 1128 NNILLKTSIYARMSPDEKHELVERLQ-SIGYQVGFCGDGANDCGALKAADIGISLSEAEA 1186

Query: 1153 RQA 1155
              A
Sbjct: 1187 SVA 1189

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 78/329 (23%), Positives = 135/329 (41%), Gaps = 61/329 (18%)

Query: 836  ILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQS-GSNSEAILE 894
            I+   EF S  +RMS IVK     P +E       KGA  +I    +  +  S+ + IL 
Sbjct: 916  IIRSFEFLSELRRMSVIVK-----PNNENVYWAYTKGAPEVIIDICNPATLPSDYDDILN 970

Query: 895  KTALHLEQYATEGLRTLCIAQREL---SWSEYEKWNEKYDIAAASLANREDELEVVADSI 951
                    Y   G R +  A + L   +W   +K              RE+        +
Sbjct: 971  F-------YTHSGYRVIACAGKTLPKNTWLYSQK------------VRREE--------V 1003

Query: 952  ERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEME 1011
            E  +  LG    +++L+D     +  L  A I+  + TGD V TAI++G  C L+  +  
Sbjct: 1004 ESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRV 1063

Query: 1012 LLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIV 1071
             +      D   +     +EI +A   +++ + F L   ++             G Y + 
Sbjct: 1064 YVPTVAYSDMTVQPVIHWNEISNA---EHILDTFTLQPIDDY-----------SGPYTLA 1109

Query: 1072 IDGDALKLAL-----YGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTL 1126
            I G+  ++       Y E+   + LL     +  +  R+SP +K  +V+ ++  +D    
Sbjct: 1110 ITGEVFRIIFSNQDNYSEEYVNEILL-----KGSIFARMSPDEKHELVEQLQ-KMDYTVG 1163

Query: 1127 AIGDGSNDVAMIQSADVGIGIAGEEGRQA 1155
              GDG+ND   +++ADVGI ++  E   A
Sbjct: 1164 FCGDGANDCGALKAADVGISLSEAEASVA 1192

>Kwal_47.17547
          Length = 1240

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 145/650 (22%), Positives = 259/650 (39%), Gaps = 125/650 (19%)

Query: 401  VKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRTSK 460
            + VGDI+ +   D +PAD IL+      G+C  +   L GE+    + ++         K
Sbjct: 204  ILVGDILSLQTGDVVPADCILVK-----GSCECDESALTGESATIKKAAIDVC--YEKYK 256

Query: 461  DIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMG 520
             ++ T   I+   P +                 E   +P+ I+   L     R    ++G
Sbjct: 257  QLSATDAAIDIGTPGA-----------------EKVPDPMLISGSKLLSGLGRAVVTSVG 299

Query: 521  VVMFTGGD-TKIMLNSGITPTKKSRISRELNFSV--VINFVLLFILCFVSGIAN----GV 573
            V    G     + + +  TP ++   S   + SV      +LLF + F+  +AN    G 
Sbjct: 300  VNSMHGRTLMALKVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKGGE 359

Query: 574  YYD----KKGRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQA 629
             +D    +KG SRF   F            V   V V+     +P+++ +++    T  A
Sbjct: 360  LHDLTPAQKG-SRFMNIF-----------IVGITVIVVAVPEGLPLAVTLALAFATTRMA 407

Query: 630  AFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSY 689
                G+++            +     + +G    + SDKTGTLT+N M   K  +    +
Sbjct: 408  K--DGNLV------------RVLRACETMGSATAVCSDKTGTLTENRMTVVKGFLGSTFF 453

Query: 690  GRAYTEALAGLRKRQGIDVETEGRREKAEIAKDRDTMI-----------DELRALSGNSQ 738
              A  E++        +D+       + E+ KD  T I           +E   +S  + 
Sbjct: 454  DEA--ESVGPSDSETDVDLAIANECSE-ELKKDVLTNITLNSTAFENKENEEDKVSNENP 510

Query: 739  FY-PEEVTFVSKEFVRDLKGASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQ 797
            F+ P +  F    + R+ K       +   E+              A  D PK+  L ++
Sbjct: 511  FHKPRKSLF---PWSRNNKSKKPATAKELVEN--------------AAADQPKEPFLGSK 553

Query: 798  SPDEAALVATA-RDVGFSFVGKTKKGLIIEMQGIQKEFEILNILEFNSSRKRMSCIVKIP 856
            +  E AL+A A +++G   +   +     +  GI+K   I+ I+ F SSRK    +VK  
Sbjct: 554  T--ETALLAFAQKNLGMQNLHHYRDE--PDCLGIEK---IVQIIPFESSRKWGGIVVKYK 606

Query: 857  -GLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAIL------EKTALHLEQYATEGLR 909
             GL+           KGA  ++  R  ++  S+S+  L      ++ +  +   A E LR
Sbjct: 607  NGLHR-------FYIKGAAELLLRRCMQKRASDSKLTLISQKDFDEESQTITNLAAEALR 659

Query: 910  TLCIAQREL----SWSEYEKWNE------KYDIAAASLANREDELEVVADSIERELILLG 959
             + +A R+     +W   E  +E        D+      +R D +   A  +   ++L G
Sbjct: 660  AISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSDSVSEPAQELVSPMVLDG 719

Query: 960  GTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNE 1009
               I+D L+ GV   +E   +AG+ + ++TGD + TA  I   C++L+ E
Sbjct: 720  IVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEE 769

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 8/69 (11%)

Query: 1101 LCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVG--IGIAGEE-GRQA-- 1155
            +  R SP  K  +V+ +K   DV+ +  GDG+ND   ++ ADVG  +GIAG E  R+A  
Sbjct: 800  VLARSSPEDKRILVETLKKMGDVVAVT-GDGTNDAPALKLADVGFSMGIAGTEVAREASD 858

Query: 1156 --VMCSDYA 1162
              +M  D++
Sbjct: 859  IILMTDDFS 867

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 76/322 (23%), Positives = 137/322 (42%), Gaps = 47/322 (14%)

Query: 836  ILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEK 895
            ++   EF S  +RMS IVK  G     E       KGA  +I          N   I + 
Sbjct: 903  VIRSFEFLSELRRMSVIVK--GFK---ENTYWSFTKGAPEVI------ADICNPATIPKD 951

Query: 896  TALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIEREL 955
                L  Y   G R +  A + L  S +             L +++   E V D++E   
Sbjct: 952  FHELLHHYTHNGFRIIACAGKTLPKSSW-------------LYSQKVSREEVEDNLE--- 995

Query: 956  ILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVI 1015
              LG    E++L+      ++ L  A I+  + TGD V TA+++G    L+++E   + I
Sbjct: 996  -FLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSER--VFI 1052

Query: 1016 KTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAK--KDHEFPKGNYAIVID 1073
                D+++E             S++L  + ++   E  + +A   K    P+ +Y + I 
Sbjct: 1053 PFLNDNLEE-------------SRHLLSWRDV-DEEGSVLDAVTLKPLNDPEKSYTLAIT 1098

Query: 1074 GDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSN 1133
            GD  ++    ++I     +     +  +  R+SP +K  +V+ ++  LD      GDG+N
Sbjct: 1099 GDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQ-KLDYNVGFCGDGAN 1157

Query: 1134 DVAMIQSADVGIGIAGEEGRQA 1155
            D   +++A++GI ++  E   A
Sbjct: 1158 DCGALKAANIGISLSEAEASVA 1179

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 84/336 (25%), Positives = 140/336 (41%), Gaps = 67/336 (19%)

Query: 836  ILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEK 895
            ++   EF S  +RMS IVK       ++       KGA  +I    ++   S   A  E+
Sbjct: 928  VVRSFEFLSELRRMSVIVKT-----NNDDVYWSFTKGAPEVISEICNK---STLPADFEE 979

Query: 896  TALHLEQYATEGLRTLCIAQREL---SWSEYEKWNEKYDIAAASLANREDELEVVADSIE 952
                L  Y   G R +  A + L   +W   +K             +RE+        +E
Sbjct: 980  V---LRCYTHNGYRVIACAGKTLPKRTWLYSQK------------VSREE--------VE 1016

Query: 953  RELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMEL 1012
              L  LG    +++L+    + ++ L +A I+  + TGD + TAI++G    L+      
Sbjct: 1017 SNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSR-- 1074

Query: 1013 LVIKTTGDDVKEFG---------SEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEF 1063
             V   + +D    G         +EP +I+D   +K LK       S E + E       
Sbjct: 1075 -VYVPSINDTPLHGEPVIVWRDVNEPDKILD---TKTLKPVKLGNNSVESLREC------ 1124

Query: 1064 PKGNYAIVIDGDALKLALYGE-DIRRKFL---LLCKNCRAVLCCRVSPSQKAAVVKLVKD 1119
               NY + + GD  +L    E +I  ++L   LL  +  A    R+SP +K  ++  ++ 
Sbjct: 1125 ---NYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYA----RMSPDEKHELMIQLQ- 1176

Query: 1120 SLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQA 1155
             LD      GDG+ND   +++ADVGI ++  E   A
Sbjct: 1177 KLDYTVGFCGDGANDCGALKAADVGISLSEAEASVA 1212

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transporting
            ATPase, member of the P-type ATPase superfamily of
            membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 88/352 (25%), Positives = 138/352 (39%), Gaps = 71/352 (20%)

Query: 833  EFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAI 892
            + +I+   +F+S+ KR + I                  KGA   I  RLS    +  E  
Sbjct: 573  KLDIIRRFQFSSALKRSASIA-------SHNDALFAAVKGAPETIRERLSDIPKNYDEI- 624

Query: 893  LEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIE 952
                    + +   G R L +A + L      K ++          NR+D        +E
Sbjct: 625  -------YKSFTRSGSRVLALASKSLPKMSQSKIDD---------LNRDD--------VE 660

Query: 953  RELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMEL 1012
             EL   G       L+D   + I++L E+  +  ++TGD   TA+++     ++  E  +
Sbjct: 661  SELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVFGETLI 720

Query: 1013 LVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKK---DHEFPKGNYA 1069
            L      DD            + LL + ++E  ++       F+  K   DH      Y 
Sbjct: 721  LDRAGKSDD------------NQLLFRDVEETVSIP------FDPSKDTFDHSKLFDRYD 762

Query: 1070 IVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIG 1129
            I + G AL  AL G    R  L         +  RVSPSQK  ++  +KD +   TL  G
Sbjct: 763  IAVTGYALN-ALEGHSQLRDLLR-----HTWVYARVSPSQKEFLLNTLKD-MGYQTLMCG 815

Query: 1130 DGSNDVAMIQSADVGIGI----------AGEEGRQAVMCSDYAIGQFRYLAR 1171
            DG+NDV  ++ A VGI +           GE+ R   M   Y I Q  ++AR
Sbjct: 816  DGTNDVGALKQAHVGIALLNGTEEGLKKLGEQRRLEGMKMMY-IKQTEFMAR 866

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
            Ca2+-transporting P-type ATPase, member of the cation
            transporting (E1-E2) P-type ATPase superfamily, functions
            to pump Ca2+ into the vacuole [3522 bp, 1173 aa]
          Length = 1173

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 85/344 (24%), Positives = 146/344 (42%), Gaps = 87/344 (25%)

Query: 835  EILNILEFNSSRKRMSCIVKIP-GLNPGDEPRALLICKGADSIIYSRLS--RQSGSNSEA 891
            +++  + F SSRK    +VK   G N   +P      KGA  I+    S  R S    E 
Sbjct: 608  KVVQTIPFESSRKWAGLVVKYKEGKNK--KPFYRFFIKGAAEIVSKNCSYKRNSDDTLEE 665

Query: 892  ILE----KTALHLEQYATEGLRTLCIAQRELSWSEYEKW--NEKYDIAAASLANREDELE 945
            I E    +T   ++  A++ LR + +A ++  + E + W   +  D  + ++A     L+
Sbjct: 666  INEDNKKETDDEIKNLASDALRAISVAHKD--FCECDSWPPEQLRDKDSPNIA----ALD 719

Query: 946  VVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNL 1005
            ++ +S ++ LIL G   I+D L+ GV + ++    AG+ + ++TGD + TA  I  +C +
Sbjct: 720  LLFNS-QKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAI 778

Query: 1006 LNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPK 1065
            L+ ++                                          E + A +  EF K
Sbjct: 779  LSTDI----------------------------------------SSEAYSAMEGTEFRK 798

Query: 1066 GNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMT 1125
                              E IR     +  N R +   R SP  K  +V+ +K   DV+ 
Sbjct: 799  --------------LTKNERIR-----ILPNLRVL--ARSSPEDKRLLVETLKGMGDVVA 837

Query: 1126 LAIGDGSNDVAMIQSADVG--IGIAGEE-GRQA----VMCSDYA 1162
            +  GDG+ND   ++ ADVG  +GI+G E  R+A    +M  D++
Sbjct: 838  VT-GDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFS 880

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 65/287 (22%), Positives = 120/287 (41%), Gaps = 51/287 (17%)

Query: 401 VKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRTSK 460
           V VGD++ +   D +PAD +++S     G C  +  ++ GE+N    Q     N++R  K
Sbjct: 210 VLVGDVISLQTGDVVPADCVMIS-----GKCEADESSITGESN--TIQKFPVDNSLRDFK 262

Query: 461 DIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMG 520
                KF       HS           + L  G++  +   I + +L   +   +    G
Sbjct: 263 -----KFNSIDSHNHS-----------KPLDIGDVNEDGNKIADCMLISGSRILSGLGRG 306

Query: 521 VVMFTG-----GDTKIMLNS--GITPTK--KSRISRELNFSVVINFVLLFILCFVSGIAN 571
           V+   G     G T   LN+    TP +   S+++  ++    ++ ++LF++ F   +  
Sbjct: 307 VITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYL-- 364

Query: 572 GVYYDKKGRSRFSYEFGTIAGSAATNGFV-SFWVAVILYQSLVPISLYISVEIIKTAQAA 630
             +Y      RF        GS   N F+ S  V V+     +P+++ +++    T    
Sbjct: 365 --FYIIPEDGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTK 422

Query: 631 FIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVM 677
              G+++    ++   C        + +G    + SDKTGTLT+NVM
Sbjct: 423 --DGNLV----RVLRSC--------ETMGSATAVCSDKTGTLTENVM 455

>CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharomyces
            cerevisiae YEL031w SPF1 P-type ATPase, hypothetical start
          Length = 1214

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 79/326 (24%), Positives = 132/326 (40%), Gaps = 62/326 (19%)

Query: 836  ILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEK 895
            IL   +F+S+ KR S +    G       +     KGA   I  RL     +  E     
Sbjct: 574  ILRRFQFSSALKRSSSVATHDG-------KLYSAVKGAPETIRERLFTIPANYDEI---- 622

Query: 896  TALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIEREL 955
                 + +   G R L +A ++L         EK   +    A+RE          ER+L
Sbjct: 623  ----YKSFTRSGSRVLALASKKL---------EKMSQSQIEDADREH--------FERDL 661

Query: 956  ILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVI 1015
               G       L+    + I++L E+  +  ++TGD   TA+++     ++  E  ++ +
Sbjct: 662  EFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGIVKGETLIVDM 721

Query: 1016 KTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKG---NYAIVI 1072
               G+D            D L+ + ++E  +        F   KD     G    Y + +
Sbjct: 722  VDNGND------------DKLVFRNVEETLSFE------FVVSKDSFEKYGIFDKYDLAV 763

Query: 1073 DGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGS 1132
             G AL+ AL G    +  +       A +  RVSP+QK  ++  +KD +   TL  GDG+
Sbjct: 764  TGHALE-ALKGHHQLQDLIR-----HAWIYARVSPAQKEFILNNLKD-MGYQTLMCGDGT 816

Query: 1133 NDVAMIQSADVGIGI--AGEEGRQAV 1156
            NDV  ++ A VG+ +    EEG + V
Sbjct: 817  NDVGALKQAHVGVALLNGTEEGLKKV 842

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
            (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 92/360 (25%), Positives = 153/360 (42%), Gaps = 75/360 (20%)

Query: 800  DEAALVATARDVGFSFVGKTKKGLIIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLN 859
            ++A L AT   VG       K  L  E  G   +  IL   +F+S+ KR S I     ++
Sbjct: 550  EKATLAATGWKVG------VKDSLSNEKVG---DISILRRFQFSSALKRSSTI----AVH 596

Query: 860  PGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELS 919
                  A+   KGA   I  RLS+      +          + +   G R L +A ++L 
Sbjct: 597  NKQHYSAV---KGAPETIRERLSQVPTDYDQV--------YKSFTRAGSRVLALASKKLP 645

Query: 920  WSEYEKWNEKYDIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLA 979
                            S++ ++ E ++  +++E +L   G       L+D   + I++L 
Sbjct: 646  ----------------SMSIKQIE-KLEREAVESDLEFKGFLVFHCPLKDDAIETIKMLN 688

Query: 980  EAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSK 1039
            E+  +  ++TGD   TA+++     ++  E E L++    D     GS       AL+ +
Sbjct: 689  ESSHRCIMITGDNPLTAVHVAKEVAIV--ERETLILDEPID-----GSS-----HALVFR 736

Query: 1040 YLKEYF-NLTGSEEEIFEAKKDHEFPKGNYAIVIDGDALKL----ALYGEDIRRKFLLLC 1094
             ++E   N    E++ FE  K        Y I + G AL+L    +   E IR  ++   
Sbjct: 737  NIEETIVNPFNPEKDTFEHSKLF----AKYDIAVTGHALQLLSGHSQLNELIRHTWVY-- 790

Query: 1095 KNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGI--AGEEG 1152
                     RVSP+QK  ++  +KD +   TL  GDG+NDV  ++ A VGI +    EEG
Sbjct: 791  --------ARVSPAQKEFIMNSLKD-MGYQTLMCGDGTNDVGALKQAHVGIALLNGTEEG 841

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
            Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
            start by similarity
          Length = 1206

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 78/315 (24%), Positives = 128/315 (40%), Gaps = 60/315 (19%)

Query: 836  ILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEK 895
            IL   +F+SS KR + I            R     KGA   I  RL+       +     
Sbjct: 574  ILRRFQFSSSLKRSASIA-------SQSNRFFAAVKGAPETIRERLNSVPSDYDDI---- 622

Query: 896  TALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIEREL 955
                 + +   G R L +A ++L     +  N + D              +  D IE  L
Sbjct: 623  ----YKSFTRSGSRVLALAYKDLP----KMSNSQID-------------NIDRDEIETGL 661

Query: 956  ILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVI 1015
                       L+D   + I++L E+  +  ++TGD   TA+++     +++ E  +L  
Sbjct: 662  TFGAFLVFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVDRETLIL-- 719

Query: 1016 KTTGDDVKEFGSEPSEIVDALLSKYLKEYFNL---TGSEEEIFEAKKDHEFPKGNYAIVI 1072
                D+  +  S    + D  +++ + + FN    T  E+EIF+           Y + +
Sbjct: 720  ----DEPIDGSSHALVMRD--VNETIVKPFNPDADTFDEKEIFQ----------KYDLAV 763

Query: 1073 DGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGS 1132
             G ALKL L G    R  +         +  RVSPSQK  ++  +KD +   TL  GDG+
Sbjct: 764  TGHALKL-LQGHKQLRDVIR-----HTWIYARVSPSQKEFILITLKD-MGYQTLMCGDGT 816

Query: 1133 NDVAMIQSADVGIGI 1147
            NDV  ++ A VGI +
Sbjct: 817  NDVGALKQAHVGIAL 831

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 90/191 (47%), Gaps = 22/191 (11%)

Query: 829  GIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSN 888
            GI K   ++ ++ F SSRK  +  V++      D        KGA  I+    S Q  S+
Sbjct: 628  GIDK---VVQVIPFESSRKWGAIAVQL-----ADNKGYRFYAKGAAEILLKVCSNQRNSD 679

Query: 889  SEAILEKTALHLEQY------ATEGLRTLCIAQRELSWSEYEKWNEKYDIAAAS----LA 938
            +  +     L+ E +      A+  LRT+ +  R+      +++ +  D + AS    + 
Sbjct: 680  NSIVPMNQDLYDESFKKIQDMASHALRTISLVHRDFKEWPPKEFADSTDPSIASPDLVMG 739

Query: 939  NREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAIN 998
            +  D   + ++ +  + ++     ++D L++GV + +E    AG+ + ++TGD + TA  
Sbjct: 740  HELDHKNLSSEGMTLDAMV----GLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARA 795

Query: 999  IGFSCNLLNNE 1009
            I  +CN+L+ E
Sbjct: 796  ISRNCNILSEE 806

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 10/81 (12%)

Query: 1088 RKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVG--I 1145
            +K L +    R +   R SP  K  +V+ +K   +V+ +  GDG+ND   ++ ADVG  +
Sbjct: 826  KKMLRVIPKLRVL--ARSSPEDKRILVETLKKMGEVVAVT-GDGTNDAPALKLADVGFSM 882

Query: 1146 GIAGEE-GRQA----VMCSDY 1161
            GI+G E  R+A    +M  D+
Sbjct: 883  GISGTEVAREASDIILMTDDF 903

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 403 VGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLK 451
           VGD++ +   D +PAD +L+S     G+C  +   L GE++   + +LK
Sbjct: 259 VGDVISLQTGDVVPADAVLIS-----GSCECDESALTGESDTIKKVALK 302

>Scas_583.14*
          Length = 875

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 74/323 (22%), Positives = 129/323 (39%), Gaps = 70/323 (21%)

Query: 833  EFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAI 892
            + +IL   +F+S+ KR S +          + +     KGA   I  RL+    +  E  
Sbjct: 227  KLQILRRFQFSSALKRSSSVA-------SHKDKLFTAVKGAPETIRERLAVVPKNYDEI- 278

Query: 893  LEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANRE-DELEVVADSI 951
                    + +   G R L +A + L                 +L++++ D+L+   D I
Sbjct: 279  -------YKSFTRSGSRVLALASKSLP----------------NLSSKQLDDLD--RDEI 313

Query: 952  ERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEME 1011
            E  L   G       L+    + I++L E+  +  ++TGD   TA+++     ++  E  
Sbjct: 314  ETGLTFNGFLVFHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETL 373

Query: 1012 LLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEA---KKDHEFPKGNY 1068
            +L    T  D K                    +FN+  + +  F+    K DH      Y
Sbjct: 374  ILDKSETVGDGKLL------------------FFNVEETIKIPFDPASDKFDHRELFDKY 415

Query: 1069 AIVIDGDALKL----ALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVM 1124
             I + G AL L    +   + IR  ++            RVSPSQK  ++  +K+ +   
Sbjct: 416  DIAVTGYALNLLEDHSQLKDLIRHTWVY----------ARVSPSQKEFILNNLKE-MGYQ 464

Query: 1125 TLAIGDGSNDVAMIQSADVGIGI 1147
            TL  GDG+NDV  ++ A VG+ +
Sbjct: 465  TLMCGDGTNDVGALKQAHVGVAL 487

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
            complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 85/191 (44%), Gaps = 27/191 (14%)

Query: 836  ILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEK 895
            I+ ++ F SSRK    +V++   N           KGA   I+        SN + I   
Sbjct: 574  IVQMIPFESSRKWAGLVVRLVDGN------YRFFIKGASETIFKSCHYMRSSNDDVIKLS 627

Query: 896  TALHLEQY------ATEGLRTLCIAQRELSWSEYEKW--NEKYDIAAASLANREDEL--E 945
               H E +      A++ LRT+ +A ++  +++   W   E  D +  S A+ +  L  E
Sbjct: 628  PQKHGEIFGLINNLASDALRTISLAHKD--FTDISSWPPAELRDASDPSTASPDLLLGDE 685

Query: 946  VVADSIERE---------LILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETA 996
             V  + +R          LIL G   I D L+ GV + ++   ++G+ + ++TGD + T 
Sbjct: 686  YVPTATDRPSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTG 745

Query: 997  INIGFSCNLLN 1007
              I  +C +L+
Sbjct: 746  RAIARACGILS 756

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
            Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 951

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 80/185 (43%), Gaps = 42/185 (22%)

Query: 826  EMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQS 885
            E+  ++ E+  +  L FNS RK M+  ++       +E +  L  KGA    + R+  +S
Sbjct: 464  ELADVRSEYTKVKELSFNSKRKMMATKIQ------DNEKKTTLFIKGA----FERILDKS 513

Query: 886  GS--NSEAILEK-TALHLEQ-------YATEGLRTLCIAQRELSWSEYEKWNEKYDIAAA 935
             S    +  +EK TA H E         A+EGLR L  A+R ++ S  +           
Sbjct: 514  SSYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMTDSSSK----------- 562

Query: 936  SLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVET 995
                      +V D I  +L+  G   + D  +  V   I+   + GI + ++TGD   T
Sbjct: 563  ----------LVEDDIS-DLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENT 611

Query: 996  AINIG 1000
            A+NI 
Sbjct: 612  AVNIA 616

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 20/74 (27%)

Query: 370 NLEQGAGEANIVDRSLPPRTDCKFAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDG 429
           +L +G  E+N++  +L P                GD+VR    D IPADI ++  +D   
Sbjct: 162 HLIRGGRESNVLATNLVP----------------GDLVRFRIGDRIPADIRIIECND--- 202

Query: 430 ACYVETKNLDGETN 443
              ++  NL GET+
Sbjct: 203 -LTIDESNLTGETD 215

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 1103 CRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIA 1148
             R +P  K  +V+ ++   DV+ +  GDG ND   ++ AD+G+ + 
Sbjct: 655  ARATPEHKLNIVRALRRRGDVVAMT-GDGVNDAPALKLADIGVSMG 699

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
            cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
            efflux, start by similarity
          Length = 1082

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 97/420 (23%), Positives = 160/420 (38%), Gaps = 91/420 (21%)

Query: 834  FEILNILEFNSSRKRMSCIVKIPGLNPGD--EPRALLICKGADSII-------YSRLSRQ 884
            FE +    F+SS KRMS I K    N  D   P   +  KGA   +       Y+    +
Sbjct: 516  FEHVAEFPFDSSVKRMSAIYK----NTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGK 571

Query: 885  SGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDEL 944
                S+  LE    +++  ++EGLR L  A++  + SE+              AN+ D+L
Sbjct: 572  PSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFN-------------ANK-DKL 617

Query: 945  EVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCN 1004
                D +E +L  LG   I D  +      ++   +AGI + +LTGD   TA +I     
Sbjct: 618  LKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIA---- 673

Query: 1005 LLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFP 1064
                              +E G  P       L  Y KE  N        F+A  D E  
Sbjct: 674  ------------------QEVGILPHN-----LYHYPKEVVNFMVMAATDFDALSDQEI- 709

Query: 1065 KGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLV--KDSLD 1122
                               +D+R   L++          R +P  K  +++ +  +    
Sbjct: 710  -------------------DDLRVLPLVI---------ARCAPQTKVRMIEALHRRSKFC 741

Query: 1123 VMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLV-HGRWSY 1181
             MT   GDG ND   ++ A+VGI +       A   SD  +    + + L  V  GR   
Sbjct: 742  AMT---GDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMS 798

Query: 1182 KRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYM-MFYNLAFTS-LPVIFLGI 1239
              + + + +   +N+  AL L     + D +G  ++  + + + + +  TS  P + LG+
Sbjct: 799  DNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVEVLWIIVVTSCFPAMGLGL 858

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
            complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 83/194 (42%), Gaps = 39/194 (20%)

Query: 840  LEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGA-DSIIYSRLSRQSGSNSEAILEKTAL 898
            L FNS RK M+  V     +P +  + ++  KGA + I+    S   G+     L  +  
Sbjct: 483  LTFNSKRKYMAVKVD----SPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHK 538

Query: 899  HL-----EQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIER 953
             L     +  A+EGLRTL  AQ E S ++                        + DS  +
Sbjct: 539  SLINDCAKSLASEGLRTLAFAQLECSTNKP-----------------------MNDSTIQ 575

Query: 954  ELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIG--FSCNLLNNEME 1011
             L  +G   ++D  +  V   IE L + G+ + ++TGD   TA+NI       ++N E+ 
Sbjct: 576  NLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEIS 635

Query: 1012 LLVIKTTGDDVKEF 1025
            +L    TGD + + 
Sbjct: 636  VL----TGDRLDQM 645

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 1103 CRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIA 1148
             R +P  K  +V+ ++   D++ +  GDG ND   ++ AD+G+ + 
Sbjct: 661  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVAMG 705

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
            involved in Na+ and Li+ efflux, required for Na+
            tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 140/669 (20%), Positives = 240/669 (35%), Gaps = 150/669 (22%)

Query: 605  AVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYI 664
            A+ +  S++P SL + + I  +  AA +    ++   KLD           + LG V  I
Sbjct: 317  AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVR-KLDS---------LEALGAVNDI 366

Query: 665  FSDKTGTLTQNVM--------EFKKCTINGVSYGRAYTEALAGLRKR------------- 703
             SDKTGTLTQ  M         F   TI+         E    L  R             
Sbjct: 367  CSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGD 426

Query: 704  QGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASGEVQ 763
             GI    + R  + ++ +D D  +D  +     +      +  V K+   D   A G+  
Sbjct: 427  VGILQNFKDRLYEKDLPEDID--MDLFQKWLETATL--ANIATVFKDDATDCWKAHGDPT 482

Query: 764  QRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGL 823
            +   + F   + L H+ L      N      ++   D+++L       G           
Sbjct: 483  EIAIQVFATKMDLPHNALTGEKSTN------QSNENDQSSLSQHNEKPG----------- 525

Query: 824  IIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSR 883
                     +FE +    F+S+ KRMS +      N  +E   +   KGA   I S  S 
Sbjct: 526  -------SAQFEHIAEFPFDSTVKRMSSVY----YNNHNETYNIY-GKGAFESIISCCSS 573

Query: 884  QSGSNSEAILEKTALHLE-------QYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAAS 936
              G +   I   T   +E         + EGLR L  A +  +  +              
Sbjct: 574  WYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQV------------- 620

Query: 937  LANREDELEVVAD---SIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKV 993
                +D+L+ +     + E +L+ LG   I D  ++     ++   +AGI + +LTGD V
Sbjct: 621  ---NDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFV 677

Query: 994  ETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEE 1053
             TA  I     +L   +                    EIVD+++         +TGS+  
Sbjct: 678  GTAKAIAQEVGILPTNLY---------------HYSQEIVDSMV---------MTGSQ-- 711

Query: 1054 IFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAV 1113
             F+   + E        V D   L L +                      R SP  K  +
Sbjct: 712  -FDGLSEEE--------VDDLPVLPLVI---------------------ARCSPQTKVRM 741

Query: 1114 VKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLV 1173
            ++ +       T+  GDG ND   ++ A+VGI +       +   SD  +    + + L 
Sbjct: 742  IEALHRRKKFCTMT-GDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILN 800

Query: 1174 LV-HGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYM-MFYNLAFTS 1231
             V  GR     + + + +   +N+  AL L    ++ D +G  ++  + + + + +  TS
Sbjct: 801  AVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTS 860

Query: 1232 -LPVIFLGI 1239
              P + LG+
Sbjct: 861  CFPAMGLGL 869

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
            cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 86/187 (45%), Gaps = 22/187 (11%)

Query: 836  ILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNS--EAIL 893
            I+ I+ F SSRK  + +VK+      +  +  L  KGA  I+    + ++  N     I 
Sbjct: 560  IVQIIPFESSRKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAKACTLKNVCNEGISEID 619

Query: 894  EKTALHLEQ----YATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVAD 949
            +K+   +E+     A + LR + +A  +   +E   W  K       LA+ E+  E +A 
Sbjct: 620  QKSKDDIEEQIFSLAKDALRAISLAHMDFDVNE---WPPK------ELADPENSHEALAV 670

Query: 950  SI-------ERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFS 1002
             +          L L     I+D L++ V + +    +AG+ + ++TGD + TA  I  +
Sbjct: 671  KLIDPKKPHLEGLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARN 730

Query: 1003 CNLLNNE 1009
            C +L+++
Sbjct: 731  CGILSSK 737

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 40/69 (57%), Gaps = 8/69 (11%)

Query: 1101 LCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVG--IGIAGEE-GRQA-- 1155
            +  R SP  K  +V+ +K+  +V+ +  GDG+ND   ++ ADVG  +GI G E  R+A  
Sbjct: 768  VLARSSPEDKKILVRALKEMGEVVAVT-GDGTNDAPALKLADVGFSMGITGTEVAREASD 826

Query: 1156 --VMCSDYA 1162
              +M  D++
Sbjct: 827  IILMTDDFS 835

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 58/311 (18%), Positives = 115/311 (36%), Gaps = 81/311 (26%)

Query: 403 VGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRTSKDI 462
           VGD++++   D +PAD +L+      G C  +   L GE           +NTI+     
Sbjct: 177 VGDLLKLQTGDVVPADCVLVR-----GECETDESALTGE-----------SNTIK----- 215

Query: 463 ARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMGVV 522
                    + P ++   Y      R++ D          ++     C L +     G  
Sbjct: 216 ---------KLPLADALEYHSAHGGRDIGDTSASGASGAADDSRCPDCMLIS-----GSR 261

Query: 523 MFTGGDTKIMLNSGI-----------------TP--TKKSRISRELNFSVVINFVLLFIL 563
           + +G  + I+ N G+                 TP   + S+++  ++    +  + LF++
Sbjct: 262 VLSGLASAIVTNVGVNSVHGKTMASLKEDSEDTPLQMRLSQLTDNISVYGCVAAITLFVV 321

Query: 564 CFVSGI-----ANGVYYDKKGRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLY 618
            F   +     + G Y+D     +         GS   + F++    +++    VP  L 
Sbjct: 322 LFARYLSYILPSGGKYHDLPPAEK---------GSKFMDIFITAITVIVVA---VPEGLP 369

Query: 619 ISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVME 678
           ++V +        +  D  L   ++   C        + +G    + SDKTGTLT+N+M 
Sbjct: 370 LAVTLALAFATTRMTKDGNL--VRVLRSC--------ETMGSATAVCSDKTGTLTENIMT 419

Query: 679 FKKCTINGVSY 689
             + T+    +
Sbjct: 420 VVRGTLGRAGF 430

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 141/671 (21%), Positives = 241/671 (35%), Gaps = 154/671 (22%)

Query: 605  AVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYI 664
            A+ +  S++P SL + + I  +  AA +    ++   KLD           + LG V  I
Sbjct: 317  AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVR-KLDS---------LEALGAVNDI 366

Query: 665  FSDKTGTLTQNVM--------EFKKCTINGVSYGRAYTEALAGLRKR------------- 703
             SDKTGTLTQ  M         F   TI+         E    L  R             
Sbjct: 367  CSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGD 426

Query: 704  QGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASGEVQ 763
             GI    + R  + ++ +D D  +D  +     +      +  V K+   D   A G+  
Sbjct: 427  VGILQNFKDRLYEKDLPEDID--MDLFQKWLETATL--ANIATVFKDDATDCWKAHGDPT 482

Query: 764  QRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGL 823
            +   + F   + L H+ L      N      ++   D+++L       G           
Sbjct: 483  EIAIQVFATKMDLPHNALTGEKSTN------QSNENDQSSLSQHNEKPG----------- 525

Query: 824  IIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSR 883
                     +FE +    F+S+ KRMS +      N  +E   +   KGA   I S  S 
Sbjct: 526  -------SAQFEHIAEFPFDSTVKRMSSVY----YNNHNETYNIY-GKGAFESIISCCSS 573

Query: 884  QSGSNSEAILEKTALHLE-------QYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAAS 936
              G +   I   T   +E         + EGLR L  A +  +  +              
Sbjct: 574  WYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQV------------- 620

Query: 937  LANREDELEVVAD---SIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKV 993
                +D+L+ +     + E +L+ LG   I D  ++     ++   +AGI + +LTGD V
Sbjct: 621  ---NDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFV 677

Query: 994  ETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEE 1053
             TA  I     +L   +                    EIVD+++         +TGS+  
Sbjct: 678  GTAKAIAQEVGILPTNLY---------------HYSQEIVDSMV---------MTGSQ-- 711

Query: 1054 IFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAV 1113
             F+   + E        V D   L L +                      R SP  K  +
Sbjct: 712  -FDGLSEEE--------VDDLPVLPLVI---------------------ARCSPQTKVRM 741

Query: 1114 VKLV--KDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLAR 1171
            ++ +  +     MT   GDG ND   ++ A+VGI +       +   SD  +    + + 
Sbjct: 742  IEALHRRKKFCAMT---GDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASI 798

Query: 1172 LVLV-HGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYM-MFYNLAF 1229
            L  V  GR     + + + +   +N+  AL L    ++ D +G  ++  + + + + +  
Sbjct: 799  LNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVV 858

Query: 1230 TS-LPVIFLGI 1239
            TS  P + LG+
Sbjct: 859  TSCFPAMGLGL 869

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
            involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 143/667 (21%), Positives = 248/667 (37%), Gaps = 145/667 (21%)

Query: 605  AVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYI 664
            A+ +  S++P SL + + I  +A A  +    ++   KLD           + LG V  I
Sbjct: 317  AICVALSMIPSSLVVVLTITMSAGAKVMATRHVIIR-KLDS---------LEALGAVNDI 366

Query: 665  FSDKTGTLTQNVMEFKKC------TINGVSYGRAYTEALAGLRKRQGIDVETEGRREKAE 718
             SDKTGTLTQ  M  K+       TIN  +    +   +  ++             ++ +
Sbjct: 367  CSDKTGTLTQGKMIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQYKHDDEED 426

Query: 719  IAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASGEVQQRCCEHFMLALALCH 778
            +      MI + +     S++Y +E+               G +       ++    L +
Sbjct: 427  VG-----MITDFK-----SKYYADEL---------------GPLNVSLFTQWLYTATLAN 461

Query: 779  SVLVEANPDNPKKLDLKAQS-PDEAAL--VATARDVGFSFVGKTKKGLIIEMQGIQKEFE 835
               V  +P+     D KA   P E A+   AT  D+    +         + + I  +  
Sbjct: 462  IATVFRDPETQ---DWKAHGDPTEIAIQVFATRMDLPRRVLTGEDND---DEKNIHNDIT 515

Query: 836  ILNILE--FNSSRKRMSCIVKIPGLNPGDEPRALL---ICKGADSIIY----SRLSRQSG 886
              ++ E  F+SS KRMS I K       +EP+A +     KGA   +     S  +   G
Sbjct: 516  FEHVAEYPFDSSVKRMSAIYK-----NVEEPKAPIYEVFTKGAFERVLQCCNSWYTTPDG 570

Query: 887  SN---SEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDE 943
            S    +E  LE    +++  ++EGLR L  A++  + S++                 +D+
Sbjct: 571  SPQPLTEEDLETVQKNVDTLSSEGLRVLAFAKKTFNESQF--------------TINKDK 616

Query: 944  LEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSC 1003
            L    D +E  L  LG   I D  +      ++    AGI + +LTGD   TA +I    
Sbjct: 617  LLKERDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHMLTGDFPGTAKSIA--- 673

Query: 1004 NLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEF 1063
                               +E G  P       L  Y KE  N        F+A  D E 
Sbjct: 674  -------------------QEVGILPHN-----LYHYPKEVVNFMVMTATDFDALSDKEI 709

Query: 1064 PKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLV--KDSL 1121
                       D L +                    ++  R +P  K  +++ +  ++  
Sbjct: 710  -----------DELPVL------------------PLVIARCAPQTKVRMIEALHRRNRF 740

Query: 1122 DVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLV-HGRWS 1180
              MT   GDG ND   ++ A+VGI +       A   SD  +    + + L  V  GR  
Sbjct: 741  CAMT---GDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRM 797

Query: 1181 YKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYM-MFYNLAFTS-LPVIFLG 1238
               + + + +   +N+  AL L     + D +G  ++  + + + + +  TS  P + LG
Sbjct: 798  SDNIQKFVLQLLAENVAQALYLMVGLCFLDEEGFSVFPLSPVEVLWVIVVTSCFPAMGLG 857

Query: 1239 ILDQDVN 1245
            +   +V+
Sbjct: 858  LEKANVD 864

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
            Ca2+-transporting P-type ATPase of Golgi membrane
            involved in Ca2+ and Mn2+ import into Golgi [2853 bp, 950
            aa]
          Length = 950

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 75/182 (41%), Gaps = 34/182 (18%)

Query: 826  EMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGA-DSIIYSRLS-- 882
            EM  I+   + +  L FNS RK M+  +    LNP D  +  +  KGA + I+    S  
Sbjct: 461  EMPDIRNTVQKVQELPFNSKRKLMATKI----LNPVDN-KCTVYVKGAFERILEYSTSYL 515

Query: 883  RQSGSNSEAILEKTALHLEQ----YATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLA 938
            +  G  +E + E     + +     A+EGLR    A+  LS                   
Sbjct: 516  KSKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLS------------------- 556

Query: 939  NREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAIN 998
               D    + + + ++L   G   + D  +  V   IE L + G+ + ++TGD   TA+N
Sbjct: 557  ---DSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVN 613

Query: 999  IG 1000
            I 
Sbjct: 614  IA 615

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 91/422 (21%), Positives = 159/422 (37%), Gaps = 95/422 (22%)

Query: 833  EFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAI 892
            +FE +    F+S+ KRMS +      N  +E   +   KGA   I S  S   G +   I
Sbjct: 528  QFEHIAEFPFDSTVKRMSSVY----YNNHNETYNIY-GKGAFESIISCCSSWYGKDGVKI 582

Query: 893  LEKTALHLE-------QYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELE 945
               T   +E         + EGLR L  A +  +  +                  +D+L+
Sbjct: 583  TPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQV----------------NDDQLK 626

Query: 946  VVAD---SIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFS 1002
             +     + E +L+ LG   I D  ++     ++   +AGI + +LTGD V TA  I   
Sbjct: 627  NITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQE 686

Query: 1003 CNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHE 1062
              +L   +                    EIVD+++         +TGS+   F+   + E
Sbjct: 687  VGILPTNLY---------------HYSQEIVDSMV---------MTGSQ---FDGLSEEE 719

Query: 1063 FPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLV--KDS 1120
                    V D   L L +                      R SP  K  +++ +  +  
Sbjct: 720  --------VDDLPVLPLVI---------------------ARCSPQTKVRMIEALHRRKK 750

Query: 1121 LDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLV-HGRW 1179
               MT   GDG ND   ++ A+VGI +       +   SD  +    + + L  V  GR 
Sbjct: 751  FCAMT---GDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRR 807

Query: 1180 SYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYM-MFYNLAFTS-LPVIFL 1237
                + + + +   +N+  AL L    ++ D +G  ++  + + + + +  TS  P + L
Sbjct: 808  MTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGL 867

Query: 1238 GI 1239
            G+
Sbjct: 868  GL 869

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 10/73 (13%)

Query: 605 AVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYI 664
           A+ +  S++P SL + + I  +  AA +    ++   KLD           + LG V  I
Sbjct: 317 AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVR-KLDSL---------EALGAVNDI 366

Query: 665 FSDKTGTLTQNVM 677
            SDKTGTLTQ  M
Sbjct: 367 CSDKTGTLTQGKM 379

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
            Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 76/174 (43%), Gaps = 40/174 (22%)

Query: 837  LNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSG---------S 887
            +N + FNS RK M+    +  ++  D  + ++  KGA   I  +     G          
Sbjct: 460  INEIPFNSKRKFMA----VKTIDAND--KVVVYVKGAFEKIVEKSINYIGRDGKVHKLKP 513

Query: 888  NSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEK-WNEKYDIAAASLANREDELEV 946
            N +AI+   A+ L   A+EGLRTL  A+ E+S +  +K +NE                  
Sbjct: 514  NDKAIINDAAVAL---ASEGLRTLAFAELEVSATHGDKEFNE------------------ 552

Query: 947  VADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIG 1000
              D +E  L   G  A+ D  +  V   IE L +  + + ++TGD   TA++I 
Sbjct: 553  --DMVEG-LTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIA 603

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%)

Query: 656 DDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKR 703
           + LG V  I SDKTGTLT N M   K    G    +    AL+ +++R
Sbjct: 355 ETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKER 402

>Kwal_14.1498
          Length = 939

 Score = 38.5 bits (88), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 90/208 (43%), Gaps = 48/208 (23%)

Query: 840  LEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGS--NSEAILEKTA 897
            + FNS RK M+  VK+   N     + ++  KGA    Y ++  +S    N+E  + K  
Sbjct: 465  ISFNSKRKFMA--VKVKEANG----KFVVHVKGA----YEKILEKSTHFINAENKVVKLD 514

Query: 898  LHLEQ--------YATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVAD 949
             +L Q         A++GLRTL  AQ ELS    +K  E  DI   + A           
Sbjct: 515  SNLRQAITDSADALASDGLRTLAFAQLELSNGNSKKLTED-DINGLTFAG---------- 563

Query: 950  SIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIG--FSCNLLN 1007
                   LLG   + D  +  V   +E L+E  + + ++TGD   TA++I       ++N
Sbjct: 564  -------LLG---MNDPPRPSVKAAVERLSEGSVHIIMITGDAENTAVSIARQIGIPVVN 613

Query: 1008 NEMELLVIKTTGDDVKEFGSEP-SEIVD 1034
             E  +L    TGD +     +  + I+D
Sbjct: 614  PETAVL----TGDKLDHMSEDQLASIID 637

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 1103 CRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIA 1148
             R +P  K  +V+ ++   D++ +  GDG ND   ++ AD+G+ + 
Sbjct: 643  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVSMG 687

>Scas_297.1
          Length = 800

 Score = 37.7 bits (86), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 39/67 (58%), Gaps = 8/67 (11%)

Query: 1103 CRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVG--IGIAGEE-GRQA---- 1155
             R SP  K  +V+ +K   DV+ +  GDG+ND   ++ ADVG  +GI+G E  R+A    
Sbjct: 53   ARSSPEDKRLLVETLKGMGDVVAVT-GDGTNDAPALKLADVGFSMGISGTEVAREASDII 111

Query: 1156 VMCSDYA 1162
            +M  D+A
Sbjct: 112  LMTDDFA 118

 Score = 34.7 bits (78), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 9/62 (14%)

Query: 403 VGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETN----LKVRQSLKCTNTIRT 458
           VGDI+ +   D IPAD +L+     +G C V+  ++ GE++    +KV  +LK  + I  
Sbjct: 618 VGDIITLQTGDVIPADGVLV-----EGQCEVDESSITGESDTIKKVKVFNALKTFDVINE 672

Query: 459 SK 460
            K
Sbjct: 673 GK 674

>Scas_710.41
          Length = 904

 Score = 37.7 bits (86), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 656 DDLGQVEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGID 707
           + L  VE + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 354 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAATRKKKGLD 407

>Kwal_23.3160
          Length = 1100

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 88/407 (21%), Positives = 156/407 (38%), Gaps = 85/407 (20%)

Query: 894  EKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIER 953
            E+   ++E  ++EGLR L  A +  + S+  K +E              +L    D +E 
Sbjct: 598  EEVFKNVETLSSEGLRVLAFATKSFTESQALKVSE--------------DLRKNRDFVES 643

Query: 954  ELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELL 1013
            +LI  G   I D  +      ++   +AGI + +LTGD   TA  I     +L       
Sbjct: 644  DLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILP------ 697

Query: 1014 VIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIVID 1073
                     +     P E+VD+++         +T ++   F+   D E         ID
Sbjct: 698  ---------RNLYHYPKEVVDSMV---------MTAAQ---FDQLTDEE---------ID 727

Query: 1074 GDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLV--KDSLDVMTLAIGDG 1131
                             LLL      ++  R +P  K  ++  +  ++    MT   GDG
Sbjct: 728  ---------------NLLLL-----PLVIARCAPQTKVRMIDALHRREKFCAMT---GDG 764

Query: 1132 SNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLV-HGRWSYKRLAEMIPE 1190
             ND   ++ A+VGI +       A   SD  +    + + L  V  GR     + + + +
Sbjct: 765  VNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQ 824

Query: 1191 FFYKNMIFALALFWYGIYNDFDGSYLYEYTYM-MFYNLAFTS-LPVIFLGILDQDVNDTI 1248
               +N+  AL L     + D D   ++  + + + + +  TS  P + LG L++   D +
Sbjct: 825  LLAENVAQALYLMIGLCFLDEDRLSVFPLSPVEVLWIIVVTSCFPAMGLG-LEKSAPDIM 883

Query: 1249 SLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICF-FFPYLVYHK 1294
                PQ  + GI   E      L  ++ G + +  C   F  ++Y K
Sbjct: 884  EK-EPQDSKAGIFTWEI----ILDMLIYGTWMAACCLACFITVIYGK 925

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 656 DDLGQVEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGID 707
           + L  VE + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 351 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAASRKKKGLD 404

>Scas_688.1
          Length = 913

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 656 DDLGQVEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGID 707
           + L  VE + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 362 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAASRKKKGLD 415

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 656 DDLGQVEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGID 707
           + L  VE + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 396 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLMLTACLAASRKKKGLD 449

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 656 DDLGQVEYIFSDKTGTLTQNVMEFKKC-TINGVSY-GRAYTEALAGLRKRQGID 707
           + L  VE + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 367 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLMLTACLAASRKKKGLD 420

>Scas_707.48*
          Length = 741

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 74/181 (40%), Gaps = 34/181 (18%)

Query: 826  EMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSR-- 883
            ++  I+  F+ +  + FNS RK M+  VKI       E +  L  KGA   + S+ S   
Sbjct: 456  DLSDIRPTFKKVQEIPFNSKRKFMA--VKIVN----SEGKYSLCVKGAFEKVLSQCSHYL 509

Query: 884  -QSGSNSEAILEKTALHLE---QYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLAN 939
             Q G   +    +  + +E     A+EGLR L  A+  L                     
Sbjct: 510  NQKGKTEKLTQGQRDVIIETANSLASEGLRMLAFAKTTLP-------------------- 549

Query: 940  REDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINI 999
              D   ++ +    +LI  G   + D  +  V   IE L + G+ + ++TGD   TA+NI
Sbjct: 550  --DSPTLLTEESVGDLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMITGDSENTAVNI 607

Query: 1000 G 1000
             
Sbjct: 608  A 608

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 1103 CRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIA 1148
             R +P  K  +V+ ++   DV+ +  GDG ND   ++ AD+G+ + 
Sbjct: 647  ARATPEHKLNIVRALRKRGDVVAMT-GDGVNDAPALKLADIGVSMG 691

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 87/411 (21%), Positives = 153/411 (37%), Gaps = 90/411 (21%)

Query: 842  FNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSR---QSGSN-----SEAIL 893
            F+SS KRMS +     +N  D+    +  KGA   +    +R     G+      +E  L
Sbjct: 531  FDSSIKRMSAVY----INLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDL 586

Query: 894  EKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIER 953
            E    +++  + EGLR L  A + +   E E   E+              L    D +E 
Sbjct: 587  EIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGER--------------LTKDRDFVES 632

Query: 954  ELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELL 1013
            +LI  G   I D  +      ++    AGI + +LTGD   TA  I     +L + +   
Sbjct: 633  DLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLY-- 690

Query: 1014 VIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIVID 1073
                           P E+VD ++         +T ++   F++  D E           
Sbjct: 691  -------------HYPKEVVDIMV---------MTATQ---FDSLTDEEL---------- 715

Query: 1074 GDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLV--KDSLDVMTLAIGDG 1131
             D L +                    ++  R +P  K  ++  +  ++    MT   GDG
Sbjct: 716  -DQLPVL------------------PLVIARCAPQTKVRMIDALHRREKFCAMT---GDG 753

Query: 1132 SNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLV-HGRWSYKRLAEMIPE 1190
             ND   ++ A+VGI +       A   SD  +    + + L  V  GR     + + + +
Sbjct: 754  VNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQ 813

Query: 1191 FFYKNMIFALALFWYGIYNDFDGSYLYEYTYM-MFYNLAFTS-LPVIFLGI 1239
                N+  A+ L     + D D   ++  + + + + +  TS LP + LG+
Sbjct: 814  LLAANVAQAIYLMLGLTFLDEDKLSVFPLSPVEVLWIIVVTSCLPAMGLGL 864

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 656 DDLGQVEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGID 707
           + L  VE + SDKTGTLT+N +   +  T+ GV       T  LA  RK++G+D
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEADDLMLTACLAASRKKKGLD 401

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
            P-type ATPase, member of the heavy-metal transporting
            P-type ATPases in the superfamily of P-type ATPases [3015
            bp, 1004 aa]
          Length = 1004

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 23/115 (20%)

Query: 1105 VSPSQKAAVVKLVKDSLDVMTLAI-GDGSNDVAMIQSADVGIG------IAGEEGRQAVM 1157
            VSP+ K  +VK ++D      +A+ GDG ND   +  +D+GI       IA E     ++
Sbjct: 812  VSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAISTGTEIAIEAADIVIL 871

Query: 1158 C-SDYAIGQFRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDF 1211
            C +D      R LA  + +  + ++KR+               L LFW   YN F
Sbjct: 872  CGNDLNTNSLRGLANAIDISLK-TFKRI--------------KLNLFWALCYNIF 911

>Kwal_47.17522
          Length = 899

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 656 DDLGQVEYIFSDKTGTLTQNVMEFKK-CTINGVSYGR-AYTEALAGLRKRQGID 707
           + L  VE + SDKTGTLT+N +   +  T+ GV       T  LA  RK++G+D
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEPDDLMLTACLAASRKKKGLD 401

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 656 DDLGQVEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGID 707
           + L  VE + SDKTGTLT+N +   +  T+ GV       T  LA  RK++G+D
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVDPDDLMLTACLAASRKKKGLD 401

>CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharomyces
            cerevisiae YGL167c PMR1, hypothetical start
          Length = 946

 Score = 34.7 bits (78), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1103 CRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGI--GIAGEEGRQAV 1156
             R +P  K  +VK ++   D++ +  GDG ND   ++ AD+GI  GI+G +  + V
Sbjct: 650  ARATPENKLNIVKALRKRGDIVAMT-GDGVNDAPALKLADIGIAMGISGTDVAKEV 704

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 39/81 (48%), Gaps = 3/81 (3%)

Query: 955  LILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLV 1014
            L   G   + D  +  V   IE L   G+ + ++TGD V TA++I     L   + E  V
Sbjct: 566  LTFTGLFGLADPPRPNVKASIEKLHRGGVHIIMITGDSVNTAVSIAEKIGLSVQDRESSV 625

Query: 1015 IKTTGDDVKEFGS-EPSEIVD 1034
            +  TGD V E    E S+++D
Sbjct: 626  M--TGDKVSELTEDELSKVID 644

>Scas_502.4
          Length = 446

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%)

Query: 1002 SCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAK 1058
            S  LL+ EM+ L I      VK+F    +++ DAL+ K++K +  + G +E +  AK
Sbjct: 383  SGELLSGEMKKLCIDVLQAFVKDFQERRAQVDDALMEKFMKPHKLVWGQKERLVPAK 439

>CAGL0M07293g complement(733072..737619) similar to sp|Q02785
            Saccharomyces cerevisiae YPL058c PDR12 or sp|P32568
            Saccharomyces cerevisiae YDR011w, hypothetical start
          Length = 1515

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 6/64 (9%)

Query: 1480 EDGSP-SGYQKQETWMTSPKETQDLLQSPQFQQAQTFGRGPSTNVRSSLDRTREQMIATN 1538
            ED  P SG++ +E W+ SP E Q+LL+      A    R P+   R   D  ++QM+ + 
Sbjct: 427  EDTIPKSGFEFEEYWLNSP-EYQELLRHYDDYHA----RHPAEETRERFDTAKKQMLQSG 481

Query: 1539 QLDN 1542
            Q ++
Sbjct: 482  QRES 485

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 1105 VSPSQKAAVVKLVKDS--LDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMC 1158
            V P  KA  ++ ++++    V    +GDG ND   I +ADVGI +A       + C
Sbjct: 1065 VLPEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIAAADVGISLASGSDLAMISC 1120

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 87/410 (21%), Positives = 155/410 (37%), Gaps = 89/410 (21%)

Query: 842  FNSSRKRMSCIVKIPGLNPGDEPRALLICKGA-DSII------YSRLSRQSGSNSEAILE 894
            F+S+ KRMS + +       D     +  KGA +S++      Y R    +   ++A ++
Sbjct: 532  FDSTIKRMSSVYE-----SRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVD 586

Query: 895  KTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIERE 954
                +++  ++EGLR L  A +      Y K +   +     L  R        D  E  
Sbjct: 587  TIKENIDSMSSEGLRVLAFANKS-----YPKSDVNEEKLQKILKER--------DYAETG 633

Query: 955  LILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLV 1014
            L  LG   I D  ++     ++   +AGI + +LTGD   TA  I     +L   +    
Sbjct: 634  LTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLY--- 690

Query: 1015 IKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIVIDG 1074
                            E+VD ++    K++ NL  SE+EI                    
Sbjct: 691  ------------HYSKEVVDIMVMTG-KQFDNL--SEDEI-------------------- 715

Query: 1075 DALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLV--KDSLDVMTLAIGDGS 1132
            D L +                    ++  R SP  K  +++ +  ++    MT   GDG 
Sbjct: 716  DNLPVL------------------PLVIARCSPQTKVRMIEALHRREKFCAMT---GDGV 754

Query: 1133 NDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLV-HGRWSYKRLAEMIPEF 1191
            ND   ++ A+VGI +       A   SD  +    + + L  V  GR     + + + + 
Sbjct: 755  NDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQL 814

Query: 1192 FYKNMIFALALFWYGIYNDFDGSYLYEYTYM-MFYNLAFTS-LPVIFLGI 1239
              +N+  AL L     + D +G  ++    + + + +  TS  P + LG+
Sbjct: 815  LAENVAQALYLIVGLAFQDKEGKSVFPLAPVEVLWIIVVTSCFPAMGLGL 864

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 10/77 (12%)

Query: 605 AVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYI 664
           AV +  S++P SL + + I  +  AA +    ++   KLD           + LG V  I
Sbjct: 311 AVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIR-KLDS---------LEALGAVNDI 360

Query: 665 FSDKTGTLTQNVMEFKK 681
            SDKTGTLTQ  M  K+
Sbjct: 361 CSDKTGTLTQGKMIAKQ 377

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
            cerevisiae YDR270w CCC2 probable copper-transporting
            ATPase, start by similarity
          Length = 975

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 72/166 (43%), Gaps = 22/166 (13%)

Query: 994  ETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKE-YFNLTGSEE 1052
            E  I  G SCN+ +     +   T G+  K F   P E +  + S  L E Y ++ GS  
Sbjct: 687  EVLIGKGISCNITDKNTSKIHTITIGNK-KLF---PDESLSDIASSTLTESYVSIDGSLV 742

Query: 1053 EIFE----AKKDHEFPK------GNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLC 1102
              FE     K+D  F        G    ++ GDA + AL    + ++  +   +  +   
Sbjct: 743  GKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSAL---KVAQQLGISANDVFS--- 796

Query: 1103 CRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIA 1148
              V+P QK  +V  ++++       +GDG ND   +  AD+GI I+
Sbjct: 797  -EVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISIS 841

>Scas_569.0d
          Length = 468

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 71/162 (43%), Gaps = 15/162 (9%)

Query: 1100 VLCCRVSPSQKAAVVKLV--KDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVM 1157
            ++  R SP  K  +++ +  +D    MT   GDG ND   ++ A+VGI +       A  
Sbjct: 103  LVIARCSPQTKVRMIEALHRRDKFCAMT---GDGVNDSPSLKMANVGIAMGINGSDVAKD 159

Query: 1158 CSDYAIGQFRYLARL-VLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYL 1216
             SD  +    + + L  +  GR     + + + +   +N+  AL L     + D +G  +
Sbjct: 160  ASDIVLSDDNFASILNAIEEGRRMSDNIQKFVLQLLAENVAQALYLICGLAFQDKEGKSV 219

Query: 1217 YEYTYM-MFYNLAFTS-LPVIFLG-------ILDQDVNDTIS 1249
            +    + + + +  TS  P + LG       ++D+  ND+ S
Sbjct: 220  FPLAPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSKS 261

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 8/65 (12%)

Query: 1101 LCCRVSPSQKAAVVKLVK------DSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQ 1154
            +   V P +KAA VK ++      +    +   +GDG ND   + +ADVGI +A   G +
Sbjct: 972  VIAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMVGDGINDAPALAAADVGIALA--SGSE 1029

Query: 1155 AVMCS 1159
              M S
Sbjct: 1030 LAMTS 1034

>Sklu_2128.2 YCR092C, Contig c2128 573-3755 reverse complement
          Length = 1060

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 36/76 (47%), Gaps = 8/76 (10%)

Query: 45  NKYSRPQVS-----FNDETPKN-KREDAEEFTFNDDTEYDNHSFQPTPKLNNGSGT-FDD 97
           NK S P+V      F D+T K    E A E   ++D    N   +PTP  +N  G   + 
Sbjct: 31  NKKSVPEVEILDSDFEDDTEKKLNHEQANERVLDEDNS-QNQFEEPTPISDNFEGNNLEQ 89

Query: 98  VELDNDSGEPHTNYDG 113
            +L ND G+P+T  D 
Sbjct: 90  EDLTNDDGKPNTTPDA 105

>CAGL0D03410g complement(351075..352706) highly similar to sp|P40992
           Saccharomyces cerevisiae YJL025w RRN7 polymerase I
           specific transcription initiation factor, start by
           similarity
          Length = 543

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 57/133 (42%), Gaps = 19/133 (14%)

Query: 667 DKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGID----VETE---GRREKAEI 719
           D +G   QN        I+ VSYGR   E +    K + +D    +E +   G  E ++ 
Sbjct: 384 DPSGKTVQN-------QISNVSYGRINIENITRWSKDETMDYLDFIENKLVHGNDELSQQ 436

Query: 720 AKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASGEVQQRCCEHFMLALALCHS 779
           +   D  ID+  A     + +P + +  SK   R L+  S E+Q++  + F +     HS
Sbjct: 437 SPFSDLTIDQKIAKRQLFKLFPIKDSIDSKMERRKLQSFSNELQEKYLKQFSM-----HS 491

Query: 780 VLVEANPDNPKKL 792
           V  E N     KL
Sbjct: 492 VYYEQNTSEYVKL 504

>Scas_227.0d
          Length = 307

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 63/291 (21%), Positives = 108/291 (37%), Gaps = 33/291 (11%)

Query: 659 GQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVETEGRREKAE 718
           G    +  DKTGTLT+NVM   +  +    +  +    L  +     I    E  ++  E
Sbjct: 3   GSATAVCFDKTGTLTENVMSVVRGFVGDSYFNDSDNALLTSVATDSHIKKSIEIFKKNGE 62

Query: 719 IAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASGEVQQRCCEHFMLALALCH 778
            +++ +   D L  +  NS        F +K+FV           +R       A     
Sbjct: 63  CSENLEK--DFLTNIVLNS------TAFENKDFVDSANNLPFSTDERDPSQVKRAFEFVR 114

Query: 779 -----SVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLII-EMQGIQK 832
                S+  + N D+   L   A    +   + +  +     + K    L    ++ +++
Sbjct: 115 THTRISISRDDNSDSGDDLIQNAIKGRQEPYIGSKTETALLTLAKKSMNLRFGSLRALRE 174

Query: 833 E-------FEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRL-SRQ 884
                    EI  I+ F S+RK    IVK    N           KGA  I+ +   S++
Sbjct: 175 NPVDRFEVSEIAQIIPFESTRKWGGIIVKYKESN-----LYRFFIKGAAEIVSNNCHSKR 229

Query: 885 SGSNSEAILEKTALH--LEQYATEGLRTLCIAQREL----SWSEYEKWNEK 929
           +  +S   L K  ++  +E  A + LR L +A R+     SW   E  +EK
Sbjct: 230 NSDDSIVTLNKDQINKEIENLANDALRALSLAHRDFPNCTSWPPNEIVDEK 280

>ADR117W [1858] [Homologous to ScYOL097C (WRS1) - SH]
            complement(911631..912911) [1281 bp, 426 aa]
          Length = 426

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 1002 SCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEE 1052
            S  LL+ EM+ L I+T    VKEF    +++ DA L  ++K +  + G  E
Sbjct: 364  SGELLSGEMKKLCIETLQQFVKEFQERRAKVDDATLDAFMKPHKLVWGQRE 414

>YGR125W (YGR125W) [2082] chr7 (742328..745438) Member of the sulfate
            permease family of membrane transporters [3111 bp, 1036
            aa]
          Length = 1036

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 62/158 (39%), Gaps = 27/158 (17%)

Query: 1271 LWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLDHRYFVGVYVTTIAVISCNTYVLLH 1330
            ++Y L  L    I  FFP  +    +I    G+G         Y   I  I   T V   
Sbjct: 319  VFYALGKLRLGKIVGFFPRHI----LIGCIGGVG---------YFLIITGIEVTTRVAKF 365

Query: 1331 QYRWDWFSGLFIALSCLVVFAW---TGIWSSAIASREFFKAAARIYGAPSFWAVFFVAVL 1387
            +Y W +FSGLF     L    W     +    I ++ +FK +  +   PSF+ +  V   
Sbjct: 366  EYSWPFFSGLFTDYDTLA--KWLLPVLLTVVLIGTQRYFKNSLVL---PSFYILTLVLFH 420

Query: 1388 F--CLLPRFTYDSFQKFFYPTDVEIVREMWQHGHFDHY 1423
            F   ++P  + D+ ++  +   +      W    +DHY
Sbjct: 421  FIVAIIPTLSLDALRQAGWIFPIANSDSKW----YDHY 454

>YNL272C (SEC2) [4337] chr14 complement(126803..129082) Guanine
           nucleotide exchange factor with coiled-coil domain
           essential for vesicular transport to the plasma membrane
           [2280 bp, 759 aa]
          Length = 759

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 48/97 (49%), Gaps = 5/97 (5%)

Query: 880 RLSRQSGSNSEAILEKT--ALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASL 937
           R+S Q  S S  ++E      HLE+   + L+T  IA ++ +   Y +  E Y+     L
Sbjct: 9   RVSIQVTSLSTQLIESVDKQSHLEEQLNKSLKT--IASQKAAIENYNQLKEDYNTLKREL 66

Query: 938 ANREDELEVVADSIERELILLGGTAIE-DRLQDGVPD 973
           ++R+DE++ + + I +E  L      E D+L   V D
Sbjct: 67  SDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVED 103

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 53,186,771
Number of extensions: 2510916
Number of successful extensions: 7617
Number of sequences better than 10.0: 105
Number of HSP's gapped: 7669
Number of HSP's successfully gapped: 179
Length of query: 1543
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1428
Effective length of database: 12,615,039
Effective search space: 18014275692
Effective search space used: 18014275692
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)