Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER165W (PAB1)57756728170.0
Scas_576.757556723790.0
CAGL0L11792g57956823340.0
Sklu_1838.358957722490.0
Kwal_56.2348658757521730.0
AGR122C58557020300.0
KLLA0C17600g59258819260.0
YFR023W (PES4)6114183922e-40
Sklu_1706.16722913923e-40
AEL016C6782903747e-38
Scas_607.106052933471e-34
Kwal_0.3705603083391e-33
KLLA0A08338g7663793181e-30
YHR015W (MIP6)6592853091e-29
CAGL0I08943g6023992903e-27
Scas_697.106104182663e-24
Scas_637.23773092392e-21
AGR390C3783142205e-19
Scas_671.44431612154e-18
KLLA0E08745g4751722121e-17
YCL011C (GBP2)4273042055e-17
CAGL0E03245g4251712048e-17
CAGL0H10604g4161712031e-16
KLLA0C11495g4451922031e-16
YNL016W (PUB1)4531602031e-16
AFR107W3961731975e-16
Kwal_27.114474391821967e-16
AEL217W8342161981e-15
Scas_621.104151701932e-15
ADR307W5663161943e-15
YGR159C (NSR1)4141711904e-15
YPL043W (NOP4)6853111925e-15
Sklu_1879.44211801896e-15
Sklu_2442.114643191881e-14
Scas_635.75811761881e-14
AGL250W7292091881e-14
Kwal_56.247098282591882e-14
Kwal_55.219605971731863e-14
CAGL0E01947g4521741843e-14
KLLA0C12925g5701931853e-14
Kwal_23.39858761771854e-14
Kwal_55.201545223221826e-14
CAGL0B04169g8611711836e-14
ADL160W5261401826e-14
CAGL0L12672g6822021827e-14
CAGL0M03795g5132361817e-14
Scas_558.14353761808e-14
Scas_645.147172211811e-13
Sklu_2307.26971871782e-13
YPR112C (MRD1)8871741748e-13
YOL123W (HRP1)5341781729e-13
KLLA0D11792g6851981702e-12
CAGL0B04807g4191761682e-12
YOR319W (HSH49)2131711595e-12
KLLA0A05346g8743171651e-11
AAL018W3371801592e-11
Scas_665.42191751542e-11
KLLA0F18216g7083161622e-11
Scas_598.15162101602e-11
Kwal_27.118326861921603e-11
CAGL0H03861g4432031585e-11
ADR035C8381841561e-10
Sklu_2085.22091171472e-10
KLLA0D14949g8781751552e-10
ABL059W2041631462e-10
CAGL0H02123g5553261496e-10
Scas_316.14831631487e-10
Kwal_27.123372091761411e-09
YNL004W (HRB1)4292971433e-09
YGR250C7812221434e-09
AAR151W481761424e-09
CAGL0J11154g3801531405e-09
KLLA0C14388g2031921355e-09
Scas_157.12321661366e-09
Kwal_14.1851535761391e-08
Kwal_0.2502162151331e-08
Kwal_33.144633931601371e-08
Sklu_905.15152011381e-08
KLLA0F14861g5891701362e-08
Scas_705.228691751363e-08
KLLA0D05016g2621981313e-08
Sklu_1715.13961711343e-08
CAGL0K06655g802761354e-08
CAGL0I09900g2111651276e-08
ABL134C3751911309e-08
YHR086W (NAM8)5232191311e-07
KLLA0C08019g301591272e-07
Scas_376.14042171272e-07
ADR183C320851253e-07
KLLA0E11011g4322631263e-07
Kwal_27.103644431861264e-07
Kwal_55.20972135951165e-07
YBR212W (NGR1)672761255e-07
KLLA0D08206g3911791245e-07
YNL175C (NOP13)4031681236e-07
KLLA0C05522g5401001238e-07
Sklu_1790.3473831202e-06
Scas_88.1256641163e-06
Sklu_2257.4188721107e-06
KLLA0B10472g198951109e-06
CAGL0F08217g678881159e-06
YOL041C (NOP12)459671141e-05
YIR005W (IST3)148951061e-05
CAGL0M12573g299751111e-05
Sklu_2182.33711591122e-05
CAGL0D06182g280881102e-05
Sklu_2353.5252601092e-05
KLLA0D13420g1661471053e-05
YMR268C (PRP24)4441821103e-05
CAGL0J01914g1691521053e-05
CAGL0H04763g3831591093e-05
KLLA0D13772g345961093e-05
Scas_621.163141111084e-05
KLLA0F07799g524831094e-05
Scas_701.3321731075e-05
KLLA0B00979g3421601075e-05
Kwal_26.7179456761085e-05
ADL063W320601066e-05
CAGL0F01023g396651067e-05
AGL038C7123241078e-05
YIR001C (SGN1)250761031e-04
Scas_709.2*1711541001e-04
ADR017W17386992e-04
Kwal_47.18572363821032e-04
Scas_643.164481031022e-04
AFR649W310721013e-04
YIL061C (SNP1)300731003e-04
Kwal_26.7522262721003e-04
Sklu_2213.425761994e-04
Scas_717.41379861004e-04
Sklu_2249.43091261004e-04
YDR432W (NPL3)414159995e-04
Scas_530.46843341005e-04
AFL050W21899966e-04
Kwal_33.1349633072978e-04
Sklu_2375.520799958e-04
YGL044C (RNA15)29675960.001
CAGL0H02211g381157970.001
YNL286W (CUS2)285113950.001
ACR274W42675960.001
Kwal_27.1109620170930.001
Sklu_1192.1280234940.002
KLLA0F09383g25864930.002
AGR010C26675920.003
ADR399C736108930.004
YPL178W (CBC2)20877900.004
Scas_714.5923360900.004
CAGL0C01529g23677900.004
Kwal_23.586427885900.005
Scas_582.1028382900.006
KLLA0A03531g73268920.006
AER285C426148900.008
Scas_720.2245101880.009
Kwal_55.20903147113850.010
Kwal_55.2041428493870.011
YDR429C (TIF35)27460870.013
CAGL0D05236g443108880.014
Scas_666.1122475860.015
CAGL0A04213g63972880.016
Scas_500.662174870.017
Scas_241.118696840.017
KLLA0E19118g652172870.018
YBL051C (PIN4)66838850.032
Scas_570.1411379790.033
Kwal_33.1481057474840.040
Scas_537.5570115840.044
Sklu_2060.311079780.046
CAGL0H03267g775112840.048
KLLA0B11594g11485770.054
Sklu_2221.828159810.071
Kwal_55.2071859487820.073
Sklu_2434.1473655820.076
KLLA0E19943g59274820.083
AER349C21884790.084
Kwal_33.1520818674780.12
CAGL0J02200g144104760.12
AFL224W20676780.12
KLLA0E00484g242222780.13
YNL110C (NOP15)22082770.16
Kwal_26.682473947780.26
YFR032C28997760.31
YLL046C (RNP1)24983750.32
Kwal_30.12890280104750.37
Scas_710.31*16267730.37
Scas_565.8322200750.37
CAGL0I05082g60474760.38
Scas_611.5*787122760.43
ADR001C32476750.46
KLLA0B14432g17379720.52
CAGL0K09966g71953750.53
Scas_663.1575354740.67
CAGL0I08393g43077730.78
CAGL0H04675g274101711.0
CAGL0G05401g67170721.0
ACL071C29884711.1
YDR381W (YRA1)22637711.1
AAR022W11480671.2
ADL126C466242721.2
AFR149C22067701.2
Scas_632.7*22989701.5
YOR361C (PRT1)76354711.6
KLLA0D12364g631111711.6
CAGL0E03179g42166701.7
KLLA0B00847g26959692.0
Sklu_1984.328447682.5
Kwal_27.1115856764692.6
CAGL0E03630g74699692.6
Kwal_23.520429492673.8
Sklu_2391.176190683.9
ADR189W26960664.3
YPL190C (NAB3)80259674.8
AFL070C75773665.5
CAGL0C01419g63996649.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER165W
         (567 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding prot...  1089   0.0  
Scas_576.7                                                            920   0.0  
CAGL0L11792g 1259275..1261014 highly similar to sp|P04147 Saccha...   903   0.0  
Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement        870   0.0  
Kwal_56.23486                                                         841   0.0  
AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH] (978634..98...   786   0.0  
KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces...   746   0.0  
YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA po...   155   2e-40
Sklu_1706.1 YFR023W, Contig c1706 1364-3382                           155   3e-40
AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W (...   148   7e-38
Scas_607.10                                                           138   1e-34
Kwal_0.370                                                            135   1e-33
KLLA0A08338g 736461..738761 weakly similar to sp|P39684 Saccharo...   127   1e-30
YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similar...   123   1e-29
CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces c...   116   3e-27
Scas_697.10                                                           107   3e-24
Scas_637.2                                                             97   2e-21
AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH] (1446842..1...    89   5e-19
Scas_671.4                                                             87   4e-18
KLLA0E08745g 782800..784227 some similarities with sp|P32588 Sac...    86   1e-17
YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein inv...    84   5e-17
CAGL0E03245g complement(299236..300513) similar to sp|P27476 Sac...    83   8e-17
CAGL0H10604g complement(1033488..1034738) similar to sp|P32588 S...    83   1e-16
KLLA0C11495g complement(990832..992169) some similarities with s...    83   1e-16
YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylate...    83   1e-16
AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH] complement(...    80   5e-16
Kwal_27.11447                                                          80   7e-16
AEL217W [2289] [Homologous to ScYGR250C - SH] complement(225217....    81   1e-15
Scas_621.10                                                            79   2e-15
ADR307W [2048] [Homologous to ScYHR086W (NAM8) - SH] complement(...    79   3e-15
YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar ...    78   4e-15
YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein r...    79   5e-15
Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement         77   6e-15
Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement      77   1e-14
Scas_635.7                                                             77   1e-14
AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH] complement(...    77   1e-14
Kwal_56.24709                                                          77   2e-14
Kwal_55.21960                                                          76   3e-14
CAGL0E01947g 193225..194583 some similarities with sp|Q99383 Sac...    75   3e-14
KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383 S...    76   3e-14
Kwal_23.3985                                                           76   4e-14
Kwal_55.20154                                                          75   6e-14
CAGL0B04169g complement(404713..407298) highly similar to tr|Q06...    75   6e-14
ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH] complement(...    75   6e-14
CAGL0L12672g complement(1359637..1361685) similar to sp|P37838 S...    75   7e-14
CAGL0M03795g complement(428607..430148) highly similar to sp|Q99...    74   7e-14
Scas_558.1                                                             74   8e-14
Scas_645.14                                                            74   1e-13
Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement         73   2e-13
YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein w...    72   8e-13
YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylate...    71   9e-13
KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces...    70   2e-12
CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces c...    69   2e-12
YOR319W (HSH49) [5101] chr15 (912817..913458) U2 snRNP protein a...    66   5e-12
KLLA0A05346g 485886..488510 some similarities with sp|P53316 Sac...    68   1e-11
AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C (G...    66   2e-11
Scas_665.4                                                             64   2e-11
KLLA0F18216g 1677731..1679857 some similarities with sp|P38741 S...    67   2e-11
Scas_598.1                                                             66   2e-11
Kwal_27.11832                                                          66   3e-11
CAGL0H03861g complement(361189..362520) similar to sp|P38922 Sac...    65   5e-11
ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH] (768392..77...    65   1e-10
Sklu_2085.2 YOR319W, Contig c2085 3158-3787                            61   2e-10
KLLA0D14949g complement(1259860..1262496) similar to sgd|S000631...    64   2e-10
ABL059W [533] [Homologous to ScYOR319W (HSH49) - SH] complement(...    61   2e-10
CAGL0H02123g complement(188454..190121) similar to sp|Q00539 Sac...    62   6e-10
Scas_316.1                                                             62   7e-10
Kwal_27.12337                                                          59   1e-09
YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with simila...    60   3e-09
YGR250C (YGR250C) [2197] chr7 complement(991180..993525) Protein...    60   4e-09
AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH] complement(6...    59   4e-09
CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces...    59   5e-09
KLLA0C14388g complement(1251548..1252159) similar to sp|Q99181 S...    57   5e-09
Scas_157.1                                                             57   6e-09
Kwal_14.1851                                                           58   1e-08
Kwal_0.250                                                             56   1e-08
Kwal_33.14463                                                          57   1e-08
Sklu_905.1 YMR268C, Contig c905 196-1743                               58   1e-08
KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539 S...    57   2e-08
Scas_705.22                                                            57   3e-08
KLLA0D05016g complement(431592..432380) similar to sp|P25555 Sac...    55   3e-08
Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement          56   3e-08
CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces c...    57   4e-08
CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces c...    54   6e-08
ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH] (140625..14...    55   9e-08
YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated ...    55   1e-07
KLLA0C08019g complement(704199..705104) some similarities with s...    54   2e-07
Scas_376.1                                                             54   2e-07
ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH] (1024792..1...    53   3e-07
KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces c...    53   3e-07
Kwal_27.10364                                                          53   4e-07
Kwal_55.20972                                                          49   5e-07
YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible R...    53   5e-07
KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces c...    52   5e-07
YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleola...    52   6e-07
KLLA0C05522g 494240..495862 some similarities with sp|P32831 Sac...    52   8e-07
Sklu_1790.3 YOL041C, Contig c1790 1701-3122                            51   2e-06
Scas_88.1                                                              49   3e-06
Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement         47   7e-06
KLLA0B10472g complement(914512..915108) similar to sgd|S0006099 ...    47   9e-06
CAGL0F08217g complement(814508..816544) similar to sp|P53316 Sac...    49   9e-06
YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein ...    49   1e-05
YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in ...    45   1e-05
CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces...    47   1e-05
Sklu_2182.3 YDR432W, Contig c2182 3920-5035                            48   2e-05
CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces c...    47   2e-05
Sklu_2353.5 YIL061C, Contig c2353 10817-11575                          47   2e-05
KLLA0D13420g complement(1157491..1157991) some similarities with...    45   3e-05
YMR268C (PRP24) [4222] chr13 complement(802887..804221) Pre-mRNA...    47   3e-05
CAGL0J01914g complement(189309..189818) similar to sp|P40565 Sac...    45   3e-05
CAGL0H04763g 454589..455740 highly similar to sp|Q01560 Saccharo...    47   3e-05
KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4 A...    47   3e-05
Scas_621.16                                                            46   4e-05
KLLA0F07799g complement(734889..736463) similar to sp|Q08208 Sac...    47   4e-05
Scas_701.3                                                             46   5e-05
KLLA0B00979g 77439..78467 some similarities with sp|Q01560 Sacch...    46   5e-05
Kwal_26.7179                                                           46   5e-05
ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH] complement(...    45   6e-05
CAGL0F01023g complement(108155..109345) similar to tr|Q08208 Sac...    45   7e-05
AGL038C [4273] [Homologous to ScYHL024W (RIM4) - SH] (639306..64...    46   8e-05
YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein wi...    44   1e-04
Scas_709.2*                                                            43   1e-04
ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH] complement(...    43   2e-04
Kwal_47.18572                                                          44   2e-04
Scas_643.16                                                            44   2e-04
AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073...    44   3e-04
YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1 snRNA-a...    43   3e-04
Kwal_26.7522                                                           43   3e-04
Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement         43   4e-04
Scas_717.41                                                            43   4e-04
Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement         43   4e-04
YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved i...    43   5e-04
Scas_530.4                                                             43   5e-04
AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH] complement(...    42   6e-04
Kwal_33.13496                                                          42   8e-04
Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement       41   8e-04
YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component...    42   0.001
CAGL0H02211g 200049..201194 similar to sp|P49960 Saccharomyces c...    42   0.001
YNL286W (CUS2) [4325] chr14 (95221..96078) Suppressor of U2 snRN...    41   0.001
ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH] complement...    42   0.001
Kwal_27.11096                                                          40   0.001
Sklu_1192.1 YNL286W, Contig c1192 480-1322 reverse complement          41   0.002
KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces c...    40   0.002
AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH] (736609..7...    40   0.003
ADR399C [2139] [Homologous to ScYOR361C (PRT1) - SH] (1420640..1...    40   0.004
YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of nu...    39   0.004
Scas_714.59                                                            39   0.004
CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces c...    39   0.004
Kwal_23.5864                                                           39   0.005
Scas_582.10                                                            39   0.006
KLLA0A03531g 320828..323026 similar to sp|P06103 Saccharomyces c...    40   0.006
AER285C [2787] [Homologous to ScYMR268C (PRP24) - SH] (1162117.....    39   0.008
Scas_720.2                                                             39   0.009
Kwal_55.20903                                                          37   0.010
Kwal_55.20414                                                          38   0.011
YDR429C (TIF35) [1252] chr4 complement(1324465..1325289) Transla...    38   0.013
CAGL0D05236g 499006..500337 weakly similar to sp|P43607 Saccharo...    39   0.014
Scas_666.11                                                            38   0.015
CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces c...    39   0.016
Scas_500.6                                                             38   0.017
Scas_241.1                                                             37   0.017
KLLA0E19118g 1694566..1696524 some similarities with sp|Q08925 S...    38   0.018
YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein wit...    37   0.032
Scas_570.14                                                            35   0.033
Kwal_33.14810                                                          37   0.040
Scas_537.5                                                             37   0.044
Sklu_2060.3 YIR009W, Contig c2060 4599-4931                            35   0.046
CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces c...    37   0.048
KLLA0B11594g complement(1018044..1018388) some similarities with...    34   0.054
Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement       36   0.071
Kwal_55.20718                                                          36   0.073
Sklu_2434.14 YOR361C, Contig c2434 32150-34360                         36   0.076
KLLA0E19943g 1766853..1768631 weakly similar to sp|P34217 Saccha...    36   0.083
AER349C [2850] [Homologous to NOHBY] (1278446..1279102) [657 bp,...    35   0.084
Kwal_33.15208                                                          35   0.12 
CAGL0J02200g complement(215042..215476) similar to sp|P40561 Sac...    34   0.12 
AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH] complement...    35   0.12 
KLLA0E00484g complement(45755..46483) similar to sp|P10080 Sacch...    35   0.13 
YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein ...    34   0.16 
Kwal_26.6824                                                           35   0.26 
YFR032C (YFR032C) [1713] chr6 complement(222078..222947) Protein...    34   0.31 
YLL046C (RNP1) [3376] chr12 complement(46713..47462) Ribonucleop...    33   0.32 
Kwal_30.12890                                                          33   0.37 
Scas_710.31*                                                           33   0.37 
Scas_565.8                                                             33   0.37 
CAGL0I05082g complement(473462..475276) some similarities with s...    34   0.38 
Scas_611.5*                                                            34   0.43 
ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH] (708437..70...    33   0.46 
KLLA0B14432g 1267356..1267877 weakly similar to sp|P36036 Saccha...    32   0.52 
CAGL0K09966g complement(974102..976261) highly similar to sp|P06...    33   0.53 
Scas_663.15                                                            33   0.67 
CAGL0I08393g complement(818759..820051) similar to sp|P34167 Sac...    33   0.78 
CAGL0H04675g complement(447256..448080) highly similar to sp|Q04...    32   1.0  
CAGL0G05401g complement(508557..510572) similar to sp|P34761 Sac...    32   1.0  
ACL071C [978] [Homologous to ScYHL034C (SBP1) - SH; ScYLL046C (R...    32   1.1  
YDR381W (YRA1) [1208] chr4 (1236546..1236830,1237597..1237992) P...    32   1.1  
AAR022W [208] [Homologous to ScYIR009W (MSL1) - SH] complement(3...    30   1.2  
ADL126C [1615] [Homologous to ScYFR032C - SH] (469991..471391) [...    32   1.2  
AFR149C [3341] [Homologous to ScYDR381W (YRA1) - SH] (705111..70...    32   1.2  
Scas_632.7*                                                            32   1.5  
YOR361C (PRT1) [5138] chr15 complement(1015357..1017648) Transla...    32   1.6  
KLLA0D12364g complement(1051765..1053660) some similarities with...    32   1.6  
CAGL0E03179g 293086..294351 similar to sp|P39927 Saccharomyces c...    32   1.7  
KLLA0B00847g complement(65983..66792) similar to sp|Q04067 Sacch...    31   2.0  
Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement         31   2.5  
Kwal_27.11158                                                          31   2.6  
CAGL0E03630g complement(335091..337331) weakly similar to sp|P38...    31   2.6  
Kwal_23.5204                                                           30   3.8  
Sklu_2391.1 YPL190C, Contig c2391 194-2479 reverse complement          31   3.9  
ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH] complement...    30   4.3  
YPL190C (NAB3) [5257] chr16 complement(185316..187724) Nuclear p...    30   4.8  
AFL070C [3123] [Homologous to ScYPL190C (NAB3) - SH] (303268..30...    30   5.5  
CAGL0C01419g complement(153063..154982) similar to sp|Q08925 Sac...    29   9.8  

>YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding protein
           of cytoplasm and nucleus, part of the 3'-end
           RNA-processing complex (cleavage factor I), involved in
           translation termination with Sup35p, has 4 RNA
           recognition (RRM) domains [1734 bp, 577 aa]
          Length = 577

 Score = 1089 bits (2817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/567 (93%), Positives = 531/567 (93%)

Query: 1   MADITDKTAEQLENLNIQDDQKQAATGXXXXXXXXXXXXLYVGDLEPSVSEAHLYDIFSP 60
           MADITDKTAEQLENLNIQDDQKQAATG            LYVGDLEPSVSEAHLYDIFSP
Sbjct: 1   MADITDKTAEQLENLNIQDDQKQAATGSESQSVENSSASLYVGDLEPSVSEAHLYDIFSP 60

Query: 61  IGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSL 120
           IGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSL
Sbjct: 61  IGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSL 120

Query: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180
           RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240
           EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240

Query: 241 KFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNER 300
           KFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNER
Sbjct: 241 KFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNER 300

Query: 301 MHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGK 360
           MHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGK
Sbjct: 301 MHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGK 360

Query: 361 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRYQ 420
           SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRYQ
Sbjct: 361 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRYQ 420

Query: 421 QXXXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPNPQQXXXXXXXXXXXXXXQFRNGP 480
           Q          GMPGQFMPPMFYGVMPPRGVPFNGPNPQQ              QFRNGP
Sbjct: 421 QATAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMNPMGGMPKNGMPPQFRNGP 480

Query: 481 VYGVPPQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSAKTSNEEAAGKITGMILDLPPQ 540
           VYGVPPQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSAKTSNEEAAGKITGMILDLPPQ
Sbjct: 481 VYGVPPQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSAKTSNEEAAGKITGMILDLPPQ 540

Query: 541 EVFPLLESDELFEQHYKEASAAYESFK 567
           EVFPLLESDELFEQHYKEASAAYESFK
Sbjct: 541 EVFPLLESDELFEQHYKEASAAYESFK 567

>Scas_576.7
          Length = 575

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/567 (79%), Positives = 492/567 (86%), Gaps = 11/567 (1%)

Query: 1   MADITDKTAEQLENLNIQDDQKQAATGXXXXXXXXXXXXLYVGDLEPSVSEAHLYDIFSP 60
           M+DIT+KT EQLENL I + + Q +T             LYVG+L+P+VSEA LYDIFSP
Sbjct: 1   MSDITEKTVEQLENLKISESEDQPST---TTSTETSPASLYVGELDPTVSEALLYDIFSP 57

Query: 61  IGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSL 120
           IGSVSSIRVCRDA+TKTSLGYAYVNFNDHEAG+KAIEQLNYTPIKGRLCRIMWSQRDP+L
Sbjct: 58  IGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDPAL 117

Query: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180
           RKKGSGNIFIKNLHPDIDNKAL++TFSVFG+ILSSKIATDE GKSKGFGFVHFE E +AK
Sbjct: 118 RKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAK 177

Query: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240
           EAIDALNGMLLNGQEIYVAPHL+RKERDSQLEETKAH+TN+YVKNIN ETTDE+F ELFA
Sbjct: 178 EAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFA 237

Query: 241 KFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNER 300
           K+G ++S+SLEK  DGKLKGFGFV++EKHEDA KAVE LN +E   + L+V RAQKK ER
Sbjct: 238 KYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYER 297

Query: 301 MHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGK 360
           M  LKKQYEA RLEKMAKYQGVNLFVKNLDDS+DDEKL+EEFAPYGTITS +VMRT+NGK
Sbjct: 298 MQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGK 357

Query: 361 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRYQ 420
           SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQAR QMRYQ
Sbjct: 358 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARTQMRYQ 417

Query: 421 QXXXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPNPQQXXXXXXXXXXXXXXQFRNGP 480
           Q          G+PGQFMPPMFYGVMPPRGVPFNGPNPQQ              QFRNGP
Sbjct: 418 QATAAAAAAAAGIPGQFMPPMFYGVMPPRGVPFNGPNPQQ-------MNGVPPQQFRNGP 470

Query: 481 VYGVPPQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSAKTSNEEAAGKITGMILDLPPQ 540
            YG+PPQGGFPRN    NQFYQ+ QRQALGE+LYKKVSAK ++EEAAGKITGMILDLPPQ
Sbjct: 471 GYGMPPQGGFPRNGVP-NQFYQKNQRQALGEELYKKVSAKNADEEAAGKITGMILDLPPQ 529

Query: 541 EVFPLLESDELFEQHYKEASAAYESFK 567
           EV  LLE+DELFEQH+KEASAAYESFK
Sbjct: 530 EVVSLLENDELFEQHFKEASAAYESFK 556

>CAGL0L11792g 1259275..1261014 highly similar to sp|P04147
           Saccharomyces cerevisiae YER165w PAB1 mRNA
           polyadenylate-binding protein, start by similarity
          Length = 579

 Score =  903 bits (2334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/568 (77%), Positives = 487/568 (85%), Gaps = 4/568 (0%)

Query: 1   MADITDKTAEQLENLNIQDDQKQAATGXXXXXXXXXXXXLYVGDLEPSVSEAHLYDIFSP 60
           MADIT+KTAEQLENL++QD  KQ  T             LYVGDL+PSVSEAHLYDIFSP
Sbjct: 1   MADITEKTAEQLENLSLQD--KQEGTNEENQSETVSAS-LYVGDLDPSVSEAHLYDIFSP 57

Query: 61  IGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSL 120
           IG+VSSIRVCRDAITKTSLGYAYVNFNDH+A + AIE+LN+TPIKG+LCRIMWSQRDPSL
Sbjct: 58  IGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSL 117

Query: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180
           RKKG+GNIFIKNLHPDIDNKALYDTFSVFG+ILSSK+ATDE GKSKGFG+VHFEE+ +A 
Sbjct: 118 RKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFEEDESAS 177

Query: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240
           EAIDALNGMLLNGQEIYV PHLS+KER+S+ EE KA++TN+Y+KNIN+ETTD++F+EL A
Sbjct: 178 EAIDALNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVA 237

Query: 241 KFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNER 300
           KFG   S  LE+  +G+ KGFGFVN+  HEDAVK VE LN++E  G+ LYV RAQKK ER
Sbjct: 238 KFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYER 297

Query: 301 MHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGK 360
              LKKQYEA R+EKMAKYQG+NLF+KNLDDS+DD+KLEEEFAPYGTITSAKVM TENGK
Sbjct: 298 QQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGK 357

Query: 361 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRYQ 420
           SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR+Q
Sbjct: 358 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRFQ 417

Query: 421 Q-XXXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPNPQQXXXXXXXXXXXXXXQFRNG 479
           Q           GMPGQFMPPMFYGVMPPRGVPFNGPNPQ               QFRNG
Sbjct: 418 QASAAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNPQMANMGAMPKNGMPPHQFRNG 477

Query: 480 PVYGVPPQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSAKTSNEEAAGKITGMILDLPP 539
           PVYGVPPQGGF RN    NQFYQQKQRQALGE+LYK++ ++T++EEAAGKITGMILDLPP
Sbjct: 478 PVYGVPPQGGFARNGPAANQFYQQKQRQALGEELYKRIFSRTNDEEAAGKITGMILDLPP 537

Query: 540 QEVFPLLESDELFEQHYKEASAAYESFK 567
           QEV PLLE+DELFEQH+KEASAAYESFK
Sbjct: 538 QEVVPLLENDELFEQHFKEASAAYESFK 565

>Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement
          Length = 589

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/577 (74%), Positives = 480/577 (83%), Gaps = 12/577 (2%)

Query: 1   MADITDKTAEQLENLNIQDDQKQAATGXXXXXXX--XXXXXLYVGDLEPSVSEAHLYDIF 58
           M+D+TDKTAEQLE L I DDQ+ A T               LYVG+L+P+V+EA LYD+F
Sbjct: 1   MSDVTDKTAEQLEQLKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLF 60

Query: 59  SPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDP 118
           SPIGSVSSIRVCRDAITKTSLGYAYVNF+DH+AGR AI++LNYT IKGR CRIMWSQRDP
Sbjct: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDP 120

Query: 119 SLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGA 178
           SLRKKGSGNIFIKNLHP IDNKAL+DTFSVFG+ILS KIATDE G SKGFGFVHFEEE +
Sbjct: 121 SLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYS 180

Query: 179 AKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQEL 238
           AKEA+DA+NGMLLNGQE+YVAPH+S+K+R S+LEE K+++TN+YVKNI+ ETT E+F+ L
Sbjct: 181 AKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEAL 240

Query: 239 FAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKN 298
           F +FG I SA LE+D++GK +GFGF+N+E HE A KAV+ LND++   ++LYVGRAQKK 
Sbjct: 241 FTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKY 300

Query: 299 ERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTEN 358
           ER+  L+KQYE  RLEK+AKYQGVNLFVKNLDDS+DDEKL +EFAP+G ITSAKVMR + 
Sbjct: 301 ERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDA 360

Query: 359 GKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 418
           G SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR
Sbjct: 361 GNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 420

Query: 419 YQQXXXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPNPQQXXXXXXXXXXXXX--XQF 476
           YQQ          GMPGQFMPPMFYGVMPPRGVPFNGPNPQQ                QF
Sbjct: 421 YQQVTAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMAAMGGMPKNGVIPPQQF 480

Query: 477 --RNGPVYGVP----PQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSAKTSNEEAAGKI 530
              NGP+YGVP    PQGGFPRN    NQFY QKQRQALGEQLYKKVSAKT +EEAAGKI
Sbjct: 481 GRPNGPMYGVPPQGAPQGGFPRNG--GNQFYHQKQRQALGEQLYKKVSAKTQDEEAAGKI 538

Query: 531 TGMILDLPPQEVFPLLESDELFEQHYKEASAAYESFK 567
           TGMILDLPPQEV PLLE+D+LFEQH+KEA AAYESFK
Sbjct: 539 TGMILDLPPQEVVPLLENDDLFEQHFKEAFAAYESFK 575

>Kwal_56.23486
          Length = 587

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/575 (73%), Positives = 477/575 (82%), Gaps = 12/575 (2%)

Query: 1   MADITDKTAEQLENLNIQDDQKQAATGXXXXXXX--XXXXXLYVGDLEPSVSEAHLYDIF 58
           M+D+TDKTAEQLE L IQD+Q    T               LYVG+L+PSV+EA LYD+F
Sbjct: 1   MSDVTDKTAEQLEQLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLF 60

Query: 59  SPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDP 118
           SPIGSVSSIRVCRDAITKTSLGYAYVNF+DH AG  AIE+LNYTPIKGR CRIMWSQRDP
Sbjct: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDP 120

Query: 119 SLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGA 178
           SLRKKGSGN+FIKNLHP IDNKAL+DTFSVFG+ILS KIATDE GKS+ FGFVHFEEE A
Sbjct: 121 SLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFEEEEA 180

Query: 179 AKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQEL 238
           AKEAIDA+NGMLLNG E+YVAPH+S+K+R S+L+E K+++TN+YVKNI+ ET  ++F++L
Sbjct: 181 AKEAIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKL 240

Query: 239 FAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKN 298
           F+++G I SA LE D +GKL+GFGFVN+E H  A KAVE LND++ NG+KLYVGRAQKK 
Sbjct: 241 FSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKY 300

Query: 299 ERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTEN 358
           ER+  LKKQYE+ R+EK+AKYQGVNLFVKNLDDS+DDEKL+EEFAP+GTITS KVMR + 
Sbjct: 301 ERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDA 360

Query: 359 GKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 418
           G SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK+VRRSQLAQQIQARNQMR
Sbjct: 361 GSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQMR 420

Query: 419 YQQXXXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPNPQQXXXXXXXXXXXXXXQ--- 475
           YQQ          GMPGQFM PMFYGVMPPRGVPFNGPNPQQ              Q   
Sbjct: 421 YQQ-ATAAAAAAAGMPGQFMQPMFYGVMPPRGVPFNGPNPQQMAAMNGMPKNGVPPQQFG 479

Query: 476 FRNGPVYGVP---PQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSAKTSNEEAAGKITG 532
             NGP+YGVP   PQG FPRN    NQF+ QKQRQALGEQLYK+VSAKT +EEAAGKITG
Sbjct: 480 RPNGPMYGVPPQGPQGAFPRNG---NQFFHQKQRQALGEQLYKRVSAKTQDEEAAGKITG 536

Query: 533 MILDLPPQEVFPLLESDELFEQHYKEASAAYESFK 567
           MILDLPPQEV PLLE+DELF+QH+KEA AAY+SFK
Sbjct: 537 MILDLPPQEVVPLLENDELFDQHFKEAFAAYDSFK 571

>AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH]
           (978634..980391) [1758 bp, 585 aa]
          Length = 585

 Score =  786 bits (2030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/570 (70%), Positives = 461/570 (80%), Gaps = 7/570 (1%)

Query: 1   MADITDKTAEQLENLNIQDDQKQAATGXXXXXXXXXXXXLYVGDLEPSVSEAHLYDIFSP 60
           M+DITDKTAEQLE L I++      T             LYVG+LEP+VSEA LYDIFSP
Sbjct: 1   MSDITDKTAEQLEQLKIEEQTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIFSP 60

Query: 61  IGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSL 120
           IGSVSSIRVCRDAIT TSLGYAYVNF+DHEAG KAIEQLNYT IKG+ CRIMWSQRDPSL
Sbjct: 61  IGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSL 120

Query: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180
           RKKGSGNI+IKNLHP IDNK+L++TFS FG+ILS K+ATDENG S+GFGFVHFE E  A+
Sbjct: 121 RKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDAR 180

Query: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240
           +AI+A++GML+N QE+YVA H+S+K+R S+LEE KA +TN+YVKNI+ ET+ E+F+ELF 
Sbjct: 181 DAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFG 240

Query: 241 KFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNER 300
           K+G I SA LEKD++GKL+GFGFVN+E H  A KAV+ LN+ E  G+KLYVGRAQKK ER
Sbjct: 241 KYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYER 300

Query: 301 MHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGK 360
           +  LKKQYEA RLEK+AKYQGVNLFVKNLDDS+DDEKL+EEFAP+GTITSAKVMR E G 
Sbjct: 301 LQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGN 360

Query: 361 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRYQ 420
           S+GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK+VRR+QLAQQIQARNQMR+Q
Sbjct: 361 SRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQIQARNQMRFQ 420

Query: 421 QXXXXXXXXXXGMPGQFM-PPMFYGVMPPRGVPFNGPNPQQXXXXXXXXXXXXXXQF-RN 478
                      G+PGQFM PPM+YG +PPR VPF GPNPQ               QF R 
Sbjct: 421 HANAAAAAAVAGLPGQFMPPPMYYGGIPPR-VPFQGPNPQM--AGMPKNGAMPPQQFGRP 477

Query: 479 GPVY-GVPPQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSAKTSNEEAAGKITGMILDL 537
           GP+Y G  PQG FPRN       YQQKQRQALGEQLY+KV AKT ++EAAGKITGMILDL
Sbjct: 478 GPMYGGFAPQGQFPRNGQQQQF-YQQKQRQALGEQLYQKVFAKTQDDEAAGKITGMILDL 536

Query: 538 PPQEVFPLLESDELFEQHYKEASAAYESFK 567
           PPQ+V  LLE+DEL EQH++EA AAY+ FK
Sbjct: 537 PPQQVIQLLENDELLEQHFQEAHAAYQKFK 566

>KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces
           cerevisiae YER165w PAB1 mRNA polyadenylate-binding
           protein, start by similarity
          Length = 592

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/588 (65%), Positives = 457/588 (77%), Gaps = 24/588 (4%)

Query: 1   MADITDKTAEQLENLNIQDDQK------------QAATGXXXXXXXXXXXXLYVGDLEPS 48
           M+DIT+KTAEQLENL I DDQ+              +              LYVG+L+P+
Sbjct: 1   MSDITEKTAEQLENLQINDDQQPAQSASAPSTSASESEASSVSKVENNNASLYVGELDPN 60

Query: 49  VSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRL 108
           ++EA LYD+FSP+G +SSIRVCRDA+TK SLGYAYVN+ D+EAG+KAI++LNY  I GR 
Sbjct: 61  ITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKKAIQELNYAEINGRP 120

Query: 109 CRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGF 168
           CRIMWS+RDP++RKKGSGNIFIKNLHP IDNKAL++TFS FG++LS K+A DENG S+GF
Sbjct: 121 CRIMWSERDPAIRKKGSGNIFIKNLHPAIDNKALHETFSTFGEVLSCKVALDENGNSRGF 180

Query: 169 GFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINS 228
           GFVHF+EE  AK+AI+A+NGML+NG E+YVA H+ +K+R S+LEE KA++TN+YVKNI+ 
Sbjct: 181 GFVHFKEESDAKDAIEAVNGMLMNGLEVYVAMHVPKKDRISKLEEAKANFTNIYVKNIDV 240

Query: 229 ETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEK 288
           ETTDE+F++LF+++G IVSA+LEKDA+GK KGFGFVN+  H  A KAVE LN  E   + 
Sbjct: 241 ETTDEEFEQLFSQYGEIVSAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELNGKEFKSQA 300

Query: 289 LYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTI 348
           LYVGRAQKK ER   LKKQYE YRLEK+AK+QGVNLF+KNLDDS+DDEKL+EEFAPYGTI
Sbjct: 301 LYVGRAQKKYERAEELKKQYEQYRLEKLAKFQGVNLFIKNLDDSIDDEKLKEEFAPYGTI 360

Query: 349 TSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLA 408
           TSA+VMR + G SKGFGFVCFS+PEEATKA+TEKNQQIVAGKPLYVAIAQRKDVRRSQLA
Sbjct: 361 TSARVMRDQEGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQRKDVRRSQLA 420

Query: 409 QQIQARNQMRY-QQXXXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPNPQQXXXXXXX 467
           QQIQARNQ+R+ QQ          GMPGQ+MP MFYGVM PRG P  GPNP         
Sbjct: 421 QQIQARNQIRFQQQQQQQAAAAAAGMPGQYMPQMFYGVMAPRGFP--GPNPGMNGPMGAG 478

Query: 468 XXXXXX----XQFR---NGPVY-GVPPQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSA 519
                      QF    NGP+Y G+PPQ  FPR+   +    QQKQRQALGEQLYKKVSA
Sbjct: 479 IPKNGMVPPPQQFAGRPNGPMYQGMPPQNQFPRHQQQHYI-QQQKQRQALGEQLYKKVSA 537

Query: 520 KTSNEEAAGKITGMILDLPPQEVFPLLESDELFEQHYKEASAAYESFK 567
           K  +E AAGKITGMILDLPPQ+V  LL++DE FEQ ++EA AAYE+FK
Sbjct: 538 KIDDENAAGKITGMILDLPPQQVIQLLDNDEQFEQQFQEALAAYENFK 585

>YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA
           polymerase epsilon mutation, contains four RNA
           recognition motif (RRM) domains [1836 bp, 611 aa]
          Length = 611

 Score =  155 bits (392), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 125/418 (29%), Positives = 194/418 (46%), Gaps = 63/418 (15%)

Query: 13  ENLNIQDDQKQAATGXXXXXXXXXXXXLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRD 72
           E L I +++     G            L++GDL  +V+E  L  IF    S  S +VC D
Sbjct: 66  EFLRINNNKSGHKNGKLKSFESKKLVPLFIGDLHETVTEETLKGIFKKYPSFVSAKVCLD 125

Query: 73  AITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKN 132
           ++TK SLG+ Y+NF D E   KA+E+LNYT + G+  RIM S R+ + RK    N+F  N
Sbjct: 126 SVTKKSLGHGYLNFEDKEEAEKAMEELNYTKVNGKEIRIMPSLRNTTFRKNFGTNVFFSN 185

Query: 133 L---HPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGM 189
           L   +P +  +  YDTFS +G ILS K+ +      K  GFV+FE+E  A+  I   N  
Sbjct: 186 LPLNNPLLTTRVFYDTFSRYGKILSCKLDS-----RKDIGFVYFEDEKTARNVIKMYNNT 240

Query: 190 LLNGQEIYVAPHLSRKERD--------SQLE---------------------ETKAHYT- 219
              G++I    H  ++ R         S+L+                     E+K  Y+ 
Sbjct: 241 SFFGKKILCGIHFDKEVRSVPNFETQKSRLDAETIIEKEQSLNEKHSKGNDKESKNIYSS 300

Query: 220 ---NLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAV 276
              ++++KN+ + TT +     F++ GPI S  L      K   + FV Y+   D+ KA+
Sbjct: 301 SQNSIFIKNLPTITTRDDILNFFSEVGPIKSIYLSNATKVKY-LWAFVTYKNSSDSEKAI 359

Query: 277 EALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDE 336
           +  N+    G+KL V RAQ K ER   ++ Q       K++      LF++NL    + E
Sbjct: 360 KRYNNFYFRGKKLLVTRAQDKEERAKFIESQ-------KIS-----TLFLENLSAVCNKE 407

Query: 337 KL-----EEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAG 389
            L     +E   P+      ++   +   S   GF+ F   E+AT+     N ++V G
Sbjct: 408 FLKYLCHQENIRPF----KIQIDGYDENSSTYSGFIKFRNFEDATRIFNFLNNRLVGG 461

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 85/187 (45%), Gaps = 25/187 (13%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLK-GFGFVNYEKHEDAVKAVEAL 279
           L++ +++   T+E  + +F K+   VSA +  D+  K   G G++N+E  E+A KA+E L
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 280 NDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNL---DDSVDDE 336
           N +++NG+++ +  +     R    +K +            G N+F  NL   +  +   
Sbjct: 153 NYTKVNGKEIRIMPSL----RNTTFRKNF------------GTNVFFSNLPLNNPLLTTR 196

Query: 337 KLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 396
              + F+ YG I S K+        K  GFV F   + A   I   N     GK +   I
Sbjct: 197 VFYDTFSRYGKILSCKL-----DSRKDIGFVYFEDEKTARNVIKMYNNTSFFGKKILCGI 251

Query: 397 AQRKDVR 403
              K+VR
Sbjct: 252 HFDKEVR 258

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 50/101 (49%), Gaps = 1/101 (0%)

Query: 312 RLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFS 370
           +L+     + V LF+ +L ++V +E L+  F  Y +  SAKV + +   KS G G++ F 
Sbjct: 81  KLKSFESKKLVPLFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFE 140

Query: 371 TPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQI 411
             EEA KA+ E N   V GK + +  + R    R      +
Sbjct: 141 DKEEAEKAMEELNYTKVNGKEIRIMPSLRNTTFRKNFGTNV 181

>Sklu_1706.1 YFR023W, Contig c1706 1364-3382
          Length = 672

 Score =  155 bits (392), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 98/291 (33%), Positives = 146/291 (50%), Gaps = 40/291 (13%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++GDL+  V+E  L D F+   S+ S+++C DAI+K SLGY Y+NF++ E   KA E+ 
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNL---HPDIDNKALYDTFSVFGDILSSK 156
           NY P+ G+  RIM S R+   RK    N+F  NL   +  +  +A YDTF  +G ILS K
Sbjct: 164 NYVPLFGKEVRIMPSLRNSFYRKNIGTNVFFSNLPLENLSLTTRAFYDTFKKYGKILSCK 223

Query: 157 IATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDS------- 209
           +      + K  GF++F+++ +AK AID  NG    G  I    H  R+ R S       
Sbjct: 224 L-----DRRKNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMCGIHFDREVRKSPEFEKRK 278

Query: 210 -------------------QLEE----TKAHYTN-LYVKNINSETTDEQFQELFAKFGPI 245
                              +L+E    TKA + N ++VKN+     ++   + F++ GP+
Sbjct: 279 SKLDGMTIIKEKLMTDDEQELQEVAPGTKAPHPNAIFVKNLPVNANEDDILDFFSRIGPV 338

Query: 246 VSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQK 296
            S    K        + FV Y+K  D  +A+E LN       K+ V RAQK
Sbjct: 339 KSVFTSKVPKYN-SSWAFVTYKKGSDTSEAIEKLNGEIFKHRKIEVARAQK 388

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 87/189 (46%), Gaps = 25/189 (13%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLK-GFGFVNYEKHEDAVKAVEAL 279
           L++ +++   T++  ++ F K+  +VS  +  DA  K   G+G++N+   EDA KA E  
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 280 NDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNL---DDSVDDE 336
           N   L G+++ +         M  L+  +  YR     K  G N+F  NL   + S+   
Sbjct: 164 NYVPLFGKEVRI---------MPSLRNSF--YR-----KNIGTNVFFSNLPLENLSLTTR 207

Query: 337 KLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 396
              + F  YG I S K+ R +N      GF+ F     A  AI + N +   G  +   I
Sbjct: 208 AFYDTFKKYGKILSCKLDRRKN-----IGFIYFDKDTSAKSAIDDFNGKEYYGNNIMCGI 262

Query: 397 AQRKDVRRS 405
              ++VR+S
Sbjct: 263 HFDREVRKS 271

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 48/91 (52%), Gaps = 1/91 (1%)

Query: 322 VNLFVKNLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFSTPEEATKAIT 380
           V LF+ +LD+ V ++ L + F  Y ++ S K+ +   + +S G+G++ FS  E+A KA  
Sbjct: 102 VALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATE 161

Query: 381 EKNQQIVAGKPLYVAIAQRKDVRRSQLAQQI 411
           E N   + GK + +  + R    R  +   +
Sbjct: 162 EFNYVPLFGKEVRIMPSLRNSFYRKNIGTNV 192

 Score = 33.1 bits (74), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++V +L  + +E  + D FS IG V S+   +  + K +  +A+V +       +AIE+L
Sbjct: 314 IFVKNLPVNANEDDILDFFSRIGPVKSVFTSK--VPKYNSSWAFVTYKKGSDTSEAIEKL 371

Query: 100 NYTPIKGRLCRIMWSQRD 117
           N    K R   +  +Q++
Sbjct: 372 NGEIFKHRKIEVARAQKN 389

>AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W
           (MIP6) - SH] (605004..607040) [2037 bp, 678 aa]
          Length = 678

 Score =  148 bits (374), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 94/290 (32%), Positives = 140/290 (48%), Gaps = 39/290 (13%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++GDL+  V+E +L D F+   S  S ++C D+ TK SLGY Y+NF++ E   + IE+ 
Sbjct: 118 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 177

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNL---HPDIDNKALYDTFSVFGDILSSK 156
           NY PI GR  RIM S R+   RK    N+F  NL   +  +  +  YD F  FG ILS K
Sbjct: 178 NYIPIFGREVRIMPSLRNSFYRKNIGTNVFFSNLPLENLALTTRVFYDAFKKFGKILSCK 237

Query: 157 IATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDS-QLEETK 215
           +      + K  GFV+FE++ AAK+AI   NG    G  I    H  R  R S + E+ K
Sbjct: 238 L-----DRRKNIGFVYFEKDSAAKQAIAEYNGKEFFGNNILCGIHFDRNVRKSPEFEKRK 292

Query: 216 A-----------------------------HYTNLYVKNINSETTDEQFQELFAKFGPIV 246
           A                             H   +++KN+      +   + F++ GP+ 
Sbjct: 293 ARLEDMTLVKESLVMDNNQEIPSGSKMKGPHPNAVFIKNLPLNPDSDLLLDYFSQIGPVK 352

Query: 247 SASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQK 296
           S     +       + F+ ++K  DA  A++ LN S+L G  + + RAQK
Sbjct: 353 SI-FTSNVSKLSSAWAFITFQKGSDAQDAIDNLNHSQLLGRPIELSRAQK 401

 Score = 97.1 bits (240), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 88/318 (27%), Positives = 150/318 (47%), Gaps = 40/318 (12%)

Query: 108 LCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENG-KSK 166
           + ++  S+  P+L  K    +FI +L   +  K L DTF+ F   +S+KI  D N  KS 
Sbjct: 98  IVKLGRSKDSPTLTSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSL 157

Query: 167 GFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEE---TKAHYTNLYV 223
           G+G+++F  E  A+  I+  N + + G+E+ + P L    R+S   +   T   ++NL +
Sbjct: 158 GYGYLNFSNEEDAERVIEEFNYIPIFGREVRIMPSL----RNSFYRKNIGTNVFFSNLPL 213

Query: 224 KNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSE 283
           +N+    T   F + F KFG I+S  L++      K  GFV +EK   A +A+   N  E
Sbjct: 214 ENL--ALTTRVFYDAFKKFGKILSCKLDRR-----KNIGFVYFEKDSAAKQAIAEYNGKE 266

Query: 284 LNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKM------------------AKYQGVN-- 323
             G  +  G    +N R     ++ +A RLE M                  +K +G +  
Sbjct: 267 FFGNNILCGIHFDRNVRKSPEFEKRKA-RLEDMTLVKESLVMDNNQEIPSGSKMKGPHPN 325

Query: 324 -LFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGK-SKGFGFVCFSTPEEATKAITE 381
            +F+KNL  + D + L + F+  G + S  +  +   K S  + F+ F    +A  AI  
Sbjct: 326 AVFIKNLPLNPDSDLLLDYFSQIGPVKS--IFTSNVSKLSSAWAFITFQKGSDAQDAIDN 383

Query: 382 KNQQIVAGKPLYVAIAQR 399
            N   + G+P+ ++ AQ+
Sbjct: 384 LNHSQLLGRPIELSRAQK 401

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 94/198 (47%), Gaps = 25/198 (12%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLK-GFGFVNYEKHEDAVKAVEAL 279
           L++ +++ + T++  ++ F KF   VSA +  D++ K   G+G++N+   EDA + +E  
Sbjct: 118 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 177

Query: 280 NDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNL---DDSVDDE 336
           N   + G ++ +         M  L+  +  YR     K  G N+F  NL   + ++   
Sbjct: 178 NYIPIFGREVRI---------MPSLRNSF--YR-----KNIGTNVFFSNLPLENLALTTR 221

Query: 337 KLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 396
              + F  +G I S K+ R +N      GFV F     A +AI E N +   G  +   I
Sbjct: 222 VFYDAFKKFGKILSCKLDRRKN-----IGFVYFEKDSAAKQAIAEYNGKEFFGNNILCGI 276

Query: 397 AQRKDVRRSQLAQQIQAR 414
              ++VR+S   ++ +AR
Sbjct: 277 HFDRNVRKSPEFEKRKAR 294

>Scas_607.10
          Length = 605

 Score =  138 bits (347), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 85/293 (29%), Positives = 141/293 (48%), Gaps = 40/293 (13%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++  L   V+E  LYD+FS   S+ S+++C D+ +K SL Y Y+NF+D    +KA++  
Sbjct: 94  LFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNFSDELEAKKAVDDF 153

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNL---HPDIDNKALYDTFSVFGDILSSK 156
           NYT + G   ++M S R+   RK    N+F  NL   +  +  +A YDTF  +G+ILS K
Sbjct: 154 NYTILFGNEIKMMPSLRNTIYRKNIGTNVFFANLPLENKHLTTRAFYDTFKGYGEILSCK 213

Query: 157 IATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKER--------- 207
           +      K K  GFV+F+ +  A+  I+  N  +  G +I    H  ++ R         
Sbjct: 214 L-----DKRKNIGFVYFDNDKPAQMVINDFNNKIYFGNKIICGLHFDKEIRNFPNFDKRK 268

Query: 208 ---------DSQLEETKA-------------HYTNLYVKNINSETTDEQFQELFAKFGPI 245
                    D +LE                 H   ++VKN+  +  DE+  + F+K GP+
Sbjct: 269 ANIDNKIIIDDELEAANIGVQFKKNSELILPHPNAIFVKNLPFDVPDEEILDHFSKLGPV 328

Query: 246 VSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKN 298
            S     +       + F+ Y+K  D ++A    N+++  G+ + V RA+ KN
Sbjct: 329 KSV-FSSNVTKYKSSWAFITYKKQTDTIRATNHFNNTKFQGKTITVSRAKLKN 380

 Score = 84.7 bits (208), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 80/313 (25%), Positives = 135/313 (43%), Gaps = 39/313 (12%)

Query: 116 RDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENG-KSKGFGFVHFE 174
           R+   RK+   ++FI  L  D+    LYD FS +  ++S KI  D +  KS  +G+++F 
Sbjct: 82  RNYRSRKRIVTSLFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNFS 141

Query: 175 EEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNI---NSETT 231
           +E  AK+A+D  N  +L G EI + P L    R++   +     TN++  N+   N   T
Sbjct: 142 DELEAKKAVDDFNYTILFGNEIKMMPSL----RNTIYRKNIG--TNVFFANLPLENKHLT 195

Query: 232 DEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291
              F + F  +G I+S  L+K      K  GFV ++  + A   +   N+    G K+  
Sbjct: 196 TRAFYDTFKGYGEILSCKLDKR-----KNIGFVYFDNDKPAQMVINDFNNKIYFGNKIIC 250

Query: 292 GRAQKKNERMH--------------VLKKQYEAYRL--------EKMAKYQGVNLFVKNL 329
           G    K  R                ++  + EA  +        E +  +    +FVKNL
Sbjct: 251 GLHFDKEIRNFPNFDKRKANIDNKIIIDDELEAANIGVQFKKNSELILPHPNA-IFVKNL 309

Query: 330 DDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAG 389
              V DE++ + F+  G + S         KS  + F+ +    +  +A    N     G
Sbjct: 310 PFDVPDEEILDHFSKLGPVKSVFSSNVTKYKS-SWAFITYKKQTDTIRATNHFNNTKFQG 368

Query: 390 KPLYVAIAQRKDV 402
           K + V+ A+ K+ 
Sbjct: 369 KTITVSRAKLKNT 381

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 46/89 (51%), Gaps = 1/89 (1%)

Query: 324 LFVKNLDDSVDDEKLEEEFAPYGTITSAKVM-RTENGKSKGFGFVCFSTPEEATKAITEK 382
           LF+  L D V +  L + F+ Y ++ S K+   +++ KS  +G++ FS   EA KA+ + 
Sbjct: 94  LFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNFSDELEAKKAVDDF 153

Query: 383 NQQIVAGKPLYVAIAQRKDVRRSQLAQQI 411
           N  I+ G  + +  + R  + R  +   +
Sbjct: 154 NYTILFGNEIKMMPSLRNTIYRKNIGTNV 182

 Score = 36.6 bits (83), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 42/201 (20%), Positives = 80/201 (39%), Gaps = 13/201 (6%)

Query: 6   DKTAEQLENLNIQDDQKQAAT-----GXXXXXXXXXXXXLYVGDLEPSVSEAHLYDIFSP 60
           DK    ++N  I DD+ +AA                   ++V +L   V +  + D FS 
Sbjct: 265 DKRKANIDNKIIIDDELEAANIGVQFKKNSELILPHPNAIFVKNLPFDVPDEEILDHFSK 324

Query: 61  IGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSL 120
           +G V S  V    +TK    +A++ +       +A    N T  +G+   +    R    
Sbjct: 325 LGPVKS--VFSSNVTKYKSSWAFITYKKQTDTIRATNHFNNTKFQGKTITV---SRAKLK 379

Query: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT--DENGKSKGFGFVHFEEEGA 178
             +G+  +++ N+   + N+       +   I + KI    D++      G++    +  
Sbjct: 380 NTEGNRTVYLNNVSV-VCNQEFLRRLCLQEGIKAQKIYLKPDDHDSYSCSGYIKCNSKDN 438

Query: 179 AKEAIDALNGMLLNGQEIYVA 199
           AK   + LNG  + G  I+V+
Sbjct: 439 AKRVFEILNGKFIGGCYIHVS 459

>Kwal_0.370
          Length = 560

 Score =  135 bits (339), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 92/308 (29%), Positives = 144/308 (46%), Gaps = 42/308 (13%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++GDL+P+V+E  L D F    S+ S+++C D+ T  SLGY Y+NF   +    AIE  
Sbjct: 17  LFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDAETAIETF 76

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNL---HPDIDNKALYDTFSVFGDILSSK 156
           +Y  + GR  RIM S R+   RK    N+F  NL    P +  +  Y+TF  +G +LS K
Sbjct: 77  SYVNLFGREVRIMPSMRNSYFRKNIGTNVFFSNLPLEQPALTTRVFYETFREYGKVLSCK 136

Query: 157 IATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDS-QLEETK 215
           +      + K  GFV+FE + AA++AI + N     G  +    H  +  R S + E+ +
Sbjct: 137 L-----DRRKNIGFVYFESDAAARKAIASYNNKEYYGNIVTCGLHFDKDIRRSPEFEKRR 191

Query: 216 A------------------------------HYTNLYVKNINSETTDEQFQELFAKFGPI 245
           +                              H  +++VKN+     +E     F++ GP+
Sbjct: 192 SRLGSLTVAKENLLSENNVELENHDQNSKDPHPNSIHVKNLPFNICNEDLLNYFSRIGPV 251

Query: 246 VSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKN--ERMHV 303
            S    K  +     +GFV Y+K  D  KA+++LN +     +L V +A K N   R   
Sbjct: 252 KSVFTSK-LEAYRSSWGFVTYKKGCDTRKALDSLNGAIFMDRRLEVNKALKNNGDRRDGT 310

Query: 304 LKKQYEAY 311
           + K   AY
Sbjct: 311 VSKNRRAY 318

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 85/337 (25%), Positives = 150/337 (44%), Gaps = 39/337 (11%)

Query: 112 MWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGF 170
           M +  +P +  +   ++FI +L P++  K L DTF VF  ++S KI  D E G S G+G+
Sbjct: 1   MNNSYNPCVTSQKVSSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGY 60

Query: 171 VHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSE- 229
           ++F     A+ AI+  + + L G+E+ + P +    R+S   +     TN++  N+  E 
Sbjct: 61  LNFYSSKDAETAIETFSYVNLFGREVRIMPSM----RNSYFRKNIG--TNVFFSNLPLEQ 114

Query: 230 --TTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGE 287
              T   F E F ++G ++S  L++      K  GFV +E    A KA+ + N+ E  G 
Sbjct: 115 PALTTRVFYETFREYGKVLSCKLDRR-----KNIGFVYFESDAAARKAIASYNNKEYYGN 169

Query: 288 KLYVG-----------RAQKKNERMHVLKKQYEAYRLEKMAKYQGVN----------LFV 326
            +  G             +K+  R+  L    E    E   + +  +          + V
Sbjct: 170 IVTCGLHFDKDIRRSPEFEKRRSRLGSLTVAKENLLSENNVELENHDQNSKDPHPNSIHV 229

Query: 327 KNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQI 386
           KNL  ++ +E L   F+  G + S    + E  +S  +GFV +    +  KA+   N  I
Sbjct: 230 KNLPFNICNEDLLNYFSRIGPVKSVFTSKLEAYRS-SWGFVTYKKGCDTRKALDSLNGAI 288

Query: 387 VAGKPLYV--AIAQRKDVRRSQLAQQIQARNQMRYQQ 421
              + L V  A+    D R   +++  +A N   ++ 
Sbjct: 289 FMDRRLEVNKALKNNGDRRDGTVSKNRRAYNDQNFRS 325

>KLLA0A08338g 736461..738761 weakly similar to sp|P39684
           Saccharomyces cerevisiae YFR023w PES4 DNA-directed DNA
           polymerase epsilon suppressor, start by similarity
          Length = 766

 Score =  127 bits (318), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 108/379 (28%), Positives = 168/379 (44%), Gaps = 43/379 (11%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++GDL  +V+E  L++IF+   S +S+++C D+ TK SLGY Y+NF D +    A+++ 
Sbjct: 140 LFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFGDPKDAENAVDEY 199

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPD---IDNKALYDTFSVFGDILSSK 156
           NY PI GR  R+M S R+   RK    N+F  NL  D   +  +  YD F  FG ILS K
Sbjct: 200 NYMPIFGREIRMMPSLRNTYFRKNIGTNVFFSNLPLDNTKLTTRVFYDEFKKFGKILSCK 259

Query: 157 IATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKA 216
           +      + K  GF++FE + AAKEAI   NG       I    H  R  R S   E K 
Sbjct: 260 L-----DRRKNIGFIYFENDAAAKEAIKQYNGKEFFDSTIMCGVHFDRNVRKSPEFEQK- 313

Query: 217 HYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAV 276
                 +  IN+ T              +V   LE + D        V  +  E+  K V
Sbjct: 314 ------INRINNLT--------------VVKEKLEMEDDNN------VTTDPSENGKKDV 347

Query: 277 EALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDE 336
            A ND++ + +   VG A K      ++++  +  +  K+     +  FVKNL  +   +
Sbjct: 348 VAGNDTDDDDDDKAVGNATKS-----LVEETNKESKNTKLPHPNAI--FVKNLPINPSHD 400

Query: 337 KLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 396
            L   F+  G + S          S  + F+ +   ++   AI + N      + + V  
Sbjct: 401 NLLNFFSKIGPVKSVYTSDVSKFDS-SWAFITYKRIQDTKTAIEKLNGCKYMKRTIEVKK 459

Query: 397 AQRKDVRRSQLAQQIQARN 415
            +R  +  SQ     +  N
Sbjct: 460 TERHHLEESQFENNTRPNN 478

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 94/191 (49%), Gaps = 15/191 (7%)

Query: 114 SQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENG-KSKGFGFVH 172
           +Q+  +++ +    +FI +L  ++    L++ F+ F    S KI  D N  KS G+G+++
Sbjct: 126 TQQTNTMKSEKQTALFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLN 185

Query: 173 FEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNI---NSE 229
           F +   A+ A+D  N M + G+EI + P L    R++   +     TN++  N+   N++
Sbjct: 186 FGDPKDAENAVDEYNYMPIFGREIRMMPSL----RNTYFRKNIG--TNVFFSNLPLDNTK 239

Query: 230 TTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKL 289
            T   F + F KFG I+S  L++      K  GF+ +E    A +A++  N  E     +
Sbjct: 240 LTTRVFYDEFKKFGKILSCKLDRR-----KNIGFIYFENDAAAKEAIKQYNGKEFFDSTI 294

Query: 290 YVGRAQKKNER 300
             G    +N R
Sbjct: 295 MCGVHFDRNVR 305

>YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similarity
           to Pes4p and Pab1p in the N-terminal region, contains
           four RNA recognition (RRM) domains [1980 bp, 659 aa]
          Length = 659

 Score =  123 bits (309), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 86/285 (30%), Positives = 136/285 (47%), Gaps = 34/285 (11%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++G+L+ +V+E  L  IF    S  S +VCRD +TK SLGY Y+NF D      A ++ 
Sbjct: 113 LFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEF 172

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNL---HPDIDNKALYDTFSVFGDILSSK 156
           NYT   G+  +IM S ++   RK    N+F  NL   +P +  ++ Y     +G++LS  
Sbjct: 173 NYTVFFGQEVKIMPSMKNTLFRKNIGTNVFFSNLPLENPQLTTRSFYLIMIEYGNVLSCL 232

Query: 157 IATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKER--------- 207
           +      + K  GFV+F+ + +A+  I   N     G +I    H  ++ R         
Sbjct: 233 LE-----RRKNIGFVYFDNDISARNVIKKYNNQEFFGNKIICGLHFDKEVRTRPEFTKRK 287

Query: 208 -----DSQLEETKAHYTNL---------YVKNINSETTDEQFQELFAKFGPIVSASL-EK 252
                D  +E+      NL          VKN+ S+TT E+  + F+  GPI S  + EK
Sbjct: 288 KMIGSDIVIEDELLASNNLSDNARSKTILVKNLPSDTTQEEVLDYFSTIGPIKSVFISEK 347

Query: 253 DADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKK 297
            A+   K   FV Y+  E++ KA + LN +      ++VG  + K
Sbjct: 348 QANTPHK--AFVTYKNEEESKKAQKCLNKTIFKNHTIWVGPGKDK 390

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 81/195 (41%), Gaps = 26/195 (13%)

Query: 214 TKAHYTN-LYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHED 271
           TK   TN L++ N+ S  T+E  +++F ++    SA + +D    K  G+G++N++   D
Sbjct: 105 TKTSKTNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKND 164

Query: 272 AVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNL-- 329
           A  A +  N +   G+++ +  + K              +R     K  G N+F  NL  
Sbjct: 165 AESARKEFNYTVFFGQEVKIMPSMKNT-----------LFR-----KNIGTNVFFSNLPL 208

Query: 330 -DDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVA 388
            +  +           YG + S  + R +N      GFV F     A   I + N Q   
Sbjct: 209 ENPQLTTRSFYLIMIEYGNVLSCLLERRKN-----IGFVYFDNDISARNVIKKYNNQEFF 263

Query: 389 GKPLYVAIAQRKDVR 403
           G  +   +   K+VR
Sbjct: 264 GNKIICGLHFDKEVR 278

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 77/179 (43%), Gaps = 13/179 (7%)

Query: 246 VSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSEL--------NGEKLYVGR--AQ 295
           +S S   D D + K F  ++ +       A   L D +L        N  K Y  +   Q
Sbjct: 23  ISKSCPNDKDARQKSFKTISAQALVRVQGAGYKLGDVKLKDAEVKEKNSLKKYDCKNATQ 82

Query: 296 KKNERMHVLKKQYEAYRLEK-MAKYQGVN-LFVKNLDDSVDDEKLEEEFAPYGTITSAKV 353
           +K E+  V +K      ++K + K    N LF+ NL  +V +E L + F  Y +  SAKV
Sbjct: 83  EKKEQEQVFEKTVAKGSVQKYITKTSKTNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKV 142

Query: 354 MRT-ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQI 411
            R     KS G+G++ F    +A  A  E N  +  G+ + +  + +  + R  +   +
Sbjct: 143 CRDFLTKKSLGYGYLNFKDKNDAESARKEFNYTVFFGQEVKIMPSMKNTLFRKNIGTNV 201

>CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces
           cerevisiae YFR023w PES4 DNA-directed DNA polymerase
           epsilon suppressor, hypothetical start
          Length = 602

 Score =  116 bits (290), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 100/399 (25%), Positives = 166/399 (41%), Gaps = 60/399 (15%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+VG+L   ++   L ++F    S  S +VC +A    SLG+ Y+NF + E   +A E  
Sbjct: 66  LFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERATEDF 125

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNL---HPDIDNKALYDTFSVFGDILSSK 156
           NY  I G+  RIM S RD   RK    NIF  NL      + ++  YD F  +G++LS K
Sbjct: 126 NYNKIMGKEIRIMPSIRDSVYRKNFGTNIFFSNLPLQKEKLTHRMFYDIFRKYGNVLSVK 185

Query: 157 IATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKER--------- 207
           + +     SK  GFV+FE++  A++ I   N     G  I    H  ++ R         
Sbjct: 186 LDS-----SKNIGFVYFEDDTIARDVIKEFNNKEFLGNIISCGLHFDKELRKKPNFDKQI 240

Query: 208 -----DSQLEETKAHYTN-------------------LYVKNINSETTDEQFQELFAKFG 243
                D  +E+ K  + +                   +++KN+  +T + +   +F++ G
Sbjct: 241 SKLDDDIIIEKEKEIFDSNKVEIKIDKDKVAIIQPNGIFIKNLPLDTNNNEILAIFSEVG 300

Query: 244 PIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHV 303
           PI S  L    + +   + FV Y+      KA+   N   +    ++V  A         
Sbjct: 301 PIKSVFLSPLNESREYLWAFVTYKDKASVEKAISLFNGKAIGNRNVFVTHA--------- 351

Query: 304 LKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTI-TSAKVMRTENGKS- 361
               Y  Y +          LF+ NL    D + L++            KV ++EN +  
Sbjct: 352 ----YSKYNIPTPKPI----LFLSNLSPICDRKFLKQIMNQLSVKPEDIKVHQSENPEHV 403

Query: 362 KGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 400
              G + F T ++  KA    N ++V+G  +Y    + K
Sbjct: 404 TSTGTIQFKTQDDLDKAKKFLNNKLVSGSIIYATTRKSK 442

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 1/92 (1%)

Query: 321 GVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVM-RTENGKSKGFGFVCFSTPEEATKAI 379
            + LFV NL + +  E+L E F  Y +  SAKV    ++ +S G G++ F   E+A +A 
Sbjct: 63  NIALFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERAT 122

Query: 380 TEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQI 411
            + N   + GK + +  + R  V R      I
Sbjct: 123 EDFNYNKIMGKEIRIMPSIRDSVYRKNFGTNI 154

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 75/176 (42%), Gaps = 14/176 (7%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +++ +L    +   +  IFS +G + S+ +     ++  L +A+V + D  +  KAI   
Sbjct: 278 IFIKNLPLDTNNNEILAIFSEVGPIKSVFLSPLNESREYL-WAFVTYKDKASVEKAISLF 336

Query: 100 NYTPIKGRLCRIM--WSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFG----DIL 153
           N   I  R   +   +S+ +    K     +F+ NL P  D K L    +       DI 
Sbjct: 337 NGKAIGNRNVFVTHAYSKYNIPTPKPI---LFLSNLSPICDRKFLKQIMNQLSVKPEDI- 392

Query: 154 SSKIATDENGKS-KGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERD 208
             K+   EN +     G + F+ +    +A   LN  L++G  IY     S+K ++
Sbjct: 393 --KVHQSENPEHVTSTGTIQFKTQDDLDKAKKFLNNKLVSGSIIYATTRKSKKNQE 446

>Scas_697.10
          Length = 610

 Score =  107 bits (266), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 107/418 (25%), Positives = 180/418 (43%), Gaps = 60/418 (14%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++GDL   V++  L  IF    S  S +VC D  T  SLG+ Y+NF D E   KAI+  
Sbjct: 103 LFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNFGDKEDAEKAIDDF 162

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKA-----LYDTFSVFGDILS 154
           N   +  ++ RIM S R  + +K    N+F  NL PD DN+       ++ F  FG ILS
Sbjct: 163 NCMKLGDKVIRIMPSLRGKNTKKSIGTNVFFTNL-PDEDNRLFHSRKFFEIFRQFGKILS 221

Query: 155 SKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVA---------PHLSRK 205
            ++  D N   K  GF+ FE E  AK  +   N  +  G  I            P +  K
Sbjct: 222 CRL--DPN---KNIGFISFEHEEVAKTVVKKYNNSMFFGNRITCGILSEDNSKKPIMEEK 276

Query: 206 -ERDSQLEETKAHY-------------TN-------LYVKNINSETTDEQFQELFAKFGP 244
            E+  Q  +    Y             TN       ++V N+ +  T E+ +  F K G 
Sbjct: 277 QEQAKQFSQLNKKYDLNEKNMPRALLNTNNLFIENTVFVSNLPTSITVEEIRNHFNKIGN 336

Query: 245 IVSASL-EKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNE-RMH 302
           I++  + +K +   L  + FV Y     A++A++ LN++ +  +++ V +A ++ E + H
Sbjct: 337 IMNLFISDKISSNAL--WAFVKYSTAACAIRAIKELNNTFIRKKQIVVSQAFRRGETQFH 394

Query: 303 VLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENG--K 360
           + +K  +              L++K L   + D+    +F     I   ++  T+    K
Sbjct: 395 LSRKPTKRI------------LYLKEL-SRICDKDFVSQFCHQRRIKFDEISLTKVNLEK 441

Query: 361 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 418
           S     +   T E+A K     N +++AG  +  +     ++   +        NQ+R
Sbjct: 442 STHTARIKCRTDEDARKLYNSINNRLIAGSIIKASWENSNEIENVEKDISNNVENQIR 499

>Scas_637.2
          Length = 377

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 88/309 (28%), Positives = 139/309 (44%), Gaps = 33/309 (10%)

Query: 120 LRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAA 179
           + K     IFI NL  D   + L D FS  G+++++++ +   G+SKG G V F     A
Sbjct: 72  VEKHHENGIFIGNLSFDATEEDLRDFFSQVGEVVNAEVMS-YRGRSKGMGTVEFTNPADA 130

Query: 180 KEAIDALNGMLLNGQEIYV----APHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQF 235
           +EAI   NG+   G++I+V     P  SR+E  S  E T+  Y   +V N+    T +  
Sbjct: 131 EEAIRQYNGVPFMGRDIFVKQDQPPPGSRQEFKSS-EPTQQGY-EAFVVNLPYSITWQNL 188

Query: 236 QELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQ 295
           +++F + G ++ A +E D +G  +GFG V Y   ED  KA+++ N +EL G  L V R  
Sbjct: 189 KDIFRECGDVIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRILEV-REG 247

Query: 296 KKN-----------------------ERMHVLKKQYEAYRLEKMAKYQGVN--LFVKNLD 330
           K N                       E   VL   +     E ++     N  ++  NL 
Sbjct: 248 KFNHPRDTFDDRRDFDDRRDFDDVPKEEEPVLPPAHNPSFTEGVSGDGERNNTVYCNNLP 307

Query: 331 DSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGK 390
            S     L + F   G I  A+++  E G S G   V +++ + A   I + N     G+
Sbjct: 308 LSTTVPDLYDLFGSVGEIAMAELVYDETGTSTGAAVVEYASQDAADVCINKLNGYNYGGR 367

Query: 391 PLYVAIAQR 399
            L++  A R
Sbjct: 368 DLHITYASR 376

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 109/299 (36%), Gaps = 44/299 (14%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +++G+L    +E  L D FS +G V +  V   +    S G   V F +     +AI Q 
Sbjct: 80  IFIGNLSFDATEEDLRDFFSQVGEVVNAEVM--SYRGRSKGMGTVEFTNPADAEEAIRQY 137

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGN--------IFIKNLHPDIDNKALYDTFSVFGD 151
           N  P  GR   +   Q  P  R++   +         F+ NL   I  + L D F   GD
Sbjct: 138 NGVPFMGRDIFVKQDQPPPGSRQEFKSSEPTQQGYEAFVVNLPYSITWQNLKDIFRECGD 197

Query: 152 ILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV------------- 198
           ++ + +  D NG S+GFG V +  E    +AID+ NG  L G+ + V             
Sbjct: 198 VIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRILEVREGKFNHPRDTFD 257

Query: 199 ------------------APHLSRKERDSQLEETKA---HYTNLYVKNINSETTDEQFQE 237
                              P L      S  E           +Y  N+   TT     +
Sbjct: 258 DRRDFDDRRDFDDVPKEEEPVLPPAHNPSFTEGVSGDGERNNTVYCNNLPLSTTVPDLYD 317

Query: 238 LFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQK 296
           LF   G I  A L  D  G   G   V Y   + A   +  LN     G  L++  A +
Sbjct: 318 LFGSVGEIAMAELVYDETGTSTGAAVVEYASQDAADVCINKLNGYNYGGRDLHITYASR 376

>AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH]
           (1446842..1447978) [1137 bp, 378 aa]
          Length = 378

 Score = 89.4 bits (220), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 71/314 (22%), Positives = 130/314 (41%), Gaps = 62/314 (19%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           LYVG+L+ +++EA L   F   G +++++V  D   + +  YA+V +        A + L
Sbjct: 37  LYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYRQPRDANVAFQTL 95

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT 159
           +   I+  + +I W+ +   +    + N+F+ +L+ D+D++ L  TF  F   + + +  
Sbjct: 96  DGKQIENNVIKINWAFQSQQVSSDDTFNLFVGDLNVDVDDETLSSTFKEFPTFIQAHVMW 155

Query: 160 D-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV-------------------- 198
           D ++G+S+G+GFV F E+  A++A+DA  G  LNG+ I V                    
Sbjct: 156 DMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAAKRESQHAARPRSNRGG 215

Query: 199 ---------------APHL--------------------SRKERDSQLEETKAHYTNLYV 223
                           PHL                    + +  ++ +       T  Y+
Sbjct: 216 FRGGSGHQPFRGMPQGPHLGGAAPAGPMQLQGPPVPSPVNPQAVEAMIRRAPQRVTTAYI 275

Query: 224 KNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSE 283
            NI     +     L   FG I+      +     KG  F+ Y+ H+ A   + AL +  
Sbjct: 276 GNIPHFAQEPDLIPLLQNFGFIIDFKHYAE-----KGCCFIKYDTHDQAALCIVALANFP 330

Query: 284 LNGEKLYVGRAQKK 297
             G  L  G  ++K
Sbjct: 331 FQGRTLRTGWGKEK 344

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 91/186 (48%), Gaps = 17/186 (9%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALN 280
           LYV N++    +   ++ F   GPI +  +  D + +   + FV Y +  DA  A + L+
Sbjct: 37  LYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYRQPRDANVAFQTLD 96

Query: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340
             ++                 +V+K  + A++ ++++     NLFV +L+  VDDE L  
Sbjct: 97  GKQIEN---------------NVIKINW-AFQSQQVSSDDTFNLFVGDLNVDVDDETLSS 140

Query: 341 EFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399
            F  + T   A VM   ++G+S+G+GFV F   EEA KA+  K    + G+ + V  A +
Sbjct: 141 TFKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAAK 200

Query: 400 KDVRRS 405
           ++ + +
Sbjct: 201 RESQHA 206

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 85/179 (47%), Gaps = 8/179 (4%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALN 187
           +++ NL   I+   L   F V G I + K+  D+N +   + FV + +   A  A   L+
Sbjct: 37  LYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYRQPRDANVAFQTLD 96

Query: 188 GMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVS 247
           G  +    I +      ++  S  ++T     NL+V ++N +  DE     F +F   + 
Sbjct: 97  GKQIENNVIKINWAFQSQQVSS--DDT----FNLFVGDLNVDVDDETLSSTFKEFPTFIQ 150

Query: 248 ASLEKDA-DGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLK 305
           A +  D   G+ +G+GFV++ + E+A KA++A     LNG  + V  A K+ E  H  +
Sbjct: 151 AHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAAKR-ESQHAAR 208

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 12/45 (26%), Positives = 19/45 (42%)

Query: 80  GYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKG 124
           G  ++ ++ H+     I  L   P +GR  R  W +  PS    G
Sbjct: 307 GCCFIKYDTHDQAALCIVALANFPFQGRTLRTGWGKEKPSFVPNG 351

>Scas_671.4
          Length = 443

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 90/161 (55%), Gaps = 3/161 (1%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           LYVG+L+ S++E  L   F   G ++ +++  D     ++ YA++ +        A++ L
Sbjct: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQTL 143

Query: 100 NYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIA 158
           N   I+G+  RI W+ Q   +     + N+F+ +L+ D+D++ L   F  F   + + + 
Sbjct: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203

Query: 159 TD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
            D + G+S+G+GFV F ++  A+EA++ + GM +NG+ + +
Sbjct: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 79/178 (44%), Gaps = 6/178 (3%)

Query: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180
           R+     +++ NL   I+   L   F V G I   KI  D+   +  + F+ + +   A 
Sbjct: 78  RETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDAN 137

Query: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240
            A+  LNG+ + G+ + +          SQ         NL+V ++N +  DE     F 
Sbjct: 138 VALQTLNGIQIEGKTVRI-----NWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFD 192

Query: 241 KFGPIVSASLEKDAD-GKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKK 297
           +F   V A +  D   G+ +G+GFV++   E A +A+  +    +NG  + +  A K+
Sbjct: 193 QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 82/182 (45%), Gaps = 16/182 (8%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALN 280
           LYV N++    ++  ++ F   G I    +  D       + F+ Y K  DA  A++ LN
Sbjct: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144

Query: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340
             ++ G+ + +  A +  +  +                    NLFV +L+  VDDE L  
Sbjct: 145 GIQIEGKTVRINWAFQSQQTTN---------------SDDTFNLFVGDLNVDVDDETLSH 189

Query: 341 EFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399
            F  + +   A VM   + G+S+G+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249

Query: 400 KD 401
           ++
Sbjct: 250 RE 251

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 37/77 (48%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+VGDL   V +  L   F    S     V  D  T  S GY +V+F D E  ++A+  +
Sbjct: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232

Query: 100 NYTPIKGRLCRIMWSQR 116
              PI GR  RI W+ +
Sbjct: 233 QGMPINGRAVRINWATK 249

>KLLA0E08745g 782800..784227 some similarities with sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1 major
           polyadenylated RNA-binding protein of nucleus and
           cytoplasm, hypothetical start
          Length = 475

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 94/172 (54%), Gaps = 2/172 (1%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           LYVG+L  S+ +  L   F   GS+SS+++  D  ++    YA+V + +      A + L
Sbjct: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDANVAYQTL 157

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT 159
           N   ++G++ +I W+ +   +    + N+F+ +L+ D+D+  L  TF  F   + + +  
Sbjct: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217

Query: 160 D-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQ 210
           D ++G+S+G+GFV F E+  A+ A++   G  LNG+ + +     R+ + SQ
Sbjct: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQ 269

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 93/191 (48%), Gaps = 17/191 (8%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALN 280
           LYV N+     D+  ++ F   G I S  +  D + +   + FV Y +  DA  A + LN
Sbjct: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158

Query: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340
             E+ G+               VLK  + A++ +++   +  NLFV +L+  VDD  L  
Sbjct: 159 GKEVEGK---------------VLKINW-AFQSQQVNSDETFNLFVGDLNVDVDDATLAG 202

Query: 341 EFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399
            F  + +   A VM   ++G+S+G+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262

Query: 400 KDVRRSQLAQQ 410
           ++ ++SQ  Q+
Sbjct: 263 REPQQSQQGQR 273

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 86/178 (48%), Gaps = 7/178 (3%)

Query: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180
           R+K    +++ NL   ID+  L   F + G I S KI  D+N +   + FV + E   A 
Sbjct: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151

Query: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240
            A   LNG  + G+ + +      ++ +S  +ET     NL+V ++N +  D      F 
Sbjct: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNS--DET----FNLFVGDLNVDVDDATLAGTFK 205

Query: 241 KFGPIVSASLEKDA-DGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKK 297
           +F   + A +  D   G+ +G+GFV++ + + A  A+E     ELNG  L +  A K+
Sbjct: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263

>YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein
           involved in mRNA export, binds poly(A)+ RNA and
           single-stranded G-strand telomere sequence, has three
           RNA recognition (RRM) domains [1284 bp, 427 aa]
          Length = 427

 Score = 83.6 bits (205), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 74/304 (24%), Positives = 137/304 (45%), Gaps = 33/304 (10%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALN 187
           IF++NL  D   + L + F   G+++ + I T + G  +G G V F +  + ++AI   +
Sbjct: 124 IFVRNLTFDCTPEDLKELFGTVGEVVEADIITSK-GHHRGMGTVEFTKNESVQDAISKFD 182

Query: 188 GMLLNGQEIYV-----APHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKF 242
           G L   +++ V      P  +++       E   +   +++ N+      +  +++F + 
Sbjct: 183 GALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSLKDMFKEC 242

Query: 243 GPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV--GRAQKK--N 298
           G ++ A +E D +G  +GFG V Y   ++ ++A++  N  E+ G  L V  GR  K+  N
Sbjct: 243 GHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRFNKRKNN 302

Query: 299 ERMHVLKKQYEAYR--------------LEKMAKY-QGVN--------LFVKNLDDSVDD 335
           +R +  ++  E  R               E  AK+ +GVN        ++  NL  S   
Sbjct: 303 DRYNQRREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGGDRNCFIYCSNLPFSTAR 362

Query: 336 EKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVA 395
             L + F P G I +A++   ENG+  G   V +    +A   I + N     G  L ++
Sbjct: 363 SDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKLNNYNYGGCSLQIS 422

Query: 396 IAQR 399
            A+R
Sbjct: 423 YARR 426

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 121/309 (39%), Gaps = 58/309 (18%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTS--LGYAYVNFNDHEAGRKAIE 97
           ++V +L    +   L ++F  +G V    V  D IT      G   V F  +E+ + AI 
Sbjct: 124 IFVRNLTFDCTPEDLKELFGTVGEV----VEADIITSKGHHRGMGTVEFTKNESVQDAIS 179

Query: 98  QLNYTPIKGRLCRIMWSQRDP------SLRKKGSGN-------IFIKNLHPDIDNKALYD 144
           + +      R  ++M  Q +P         KK +         +FI NL   ++ ++L D
Sbjct: 180 KFDGALFMDR--KLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSLKD 237

Query: 145 TFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQ--EIYVAPHL 202
            F   G +L + +  D NG S+GFG V +  E     AID  NGM + G+  E+      
Sbjct: 238 MFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRFN 297

Query: 203 SRKERDS------------------------QLEETKAHYTN-----------LYVKNIN 227
            RK  D                          ++ET A +T            +Y  N+ 
Sbjct: 298 KRKNNDRYNQRREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGGDRNCFIYCSNLP 357

Query: 228 SETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGE 287
             T      +LF   G I +A L+   +G+  G   V YE   DA   ++ LN+    G 
Sbjct: 358 FSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKLNNYNYGGC 417

Query: 288 KLYVGRAQK 296
            L +  A++
Sbjct: 418 SLQISYARR 426

>CAGL0E03245g complement(299236..300513) similar to sp|P27476
           Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, start by
           similarity
          Length = 425

 Score = 83.2 bits (204), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 88/171 (51%), Gaps = 14/171 (8%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++VG L  S+ +  L   F  IG V + RV  +  T  S GY YV+F D     KA++++
Sbjct: 178 VFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFEDKSYAEKAVKEM 237

Query: 100 NYTPIKGRLCRIMWSQRDPSL-----RKKGSGNI--------FIKNLHPDIDNKALYDTF 146
           +   I GR   +  S   P++     R+K  G+I        F+ NL  + D   +Y+ F
Sbjct: 238 HGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLGNLSFNADRDNIYEIF 297

Query: 147 SVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEI 196
             FG+I+S +I T  E  + KGFG+V +     AK+A++AL G  ++ + +
Sbjct: 298 GKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYIDNRPV 348

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 89/162 (54%), Gaps = 9/162 (5%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDA 185
            +F+  L   ID++ L   F   G ++++++  +    +S+G+G+V FE++  A++A+  
Sbjct: 177 TVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFEDKSYAEKAVKE 236

Query: 186 LNGMLLNGQEIYVAPHLS------RKERDSQLEETKAHYTN-LYVKNINSETTDEQFQEL 238
           ++G  ++G+ I V    S      R++R  +  +  +  ++ L++ N++     +   E+
Sbjct: 237 MHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLGNLSFNADRDNIYEI 296

Query: 239 FAKFGPIVSASLEKDADG-KLKGFGFVNYEKHEDAVKAVEAL 279
           F KFG I+S  +    +  + KGFG+V Y   +DA KA+EAL
Sbjct: 297 FGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEAL 338

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 90/183 (49%), Gaps = 7/183 (3%)

Query: 213 ETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASL--EKDADGKLKGFGFVNYEKHE 270
           +T      ++V  ++    DE  ++ F   G +V+A +  E+  D + +G+G+V++E   
Sbjct: 170 KTDGEPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTD-RSRGYGYVDFEDKS 228

Query: 271 DAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLD 330
            A KAV+ ++  E++G  + V  +  K     V  ++    R   +       LF+ NL 
Sbjct: 229 YAEKAVKEMHGKEIDGRPINVDMSTSKP---TVNPREDRQKRFGDIPSEPSDTLFLGNLS 285

Query: 331 DSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAG 389
            + D + + E F  +G I S ++    E  + KGFG+V +++ ++A KA+     + +  
Sbjct: 286 FNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYIDN 345

Query: 390 KPL 392
           +P+
Sbjct: 346 RPV 348

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 52/90 (57%), Gaps = 5/90 (5%)

Query: 315 KMAKYQG--VNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENG--KSKGFGFVCFS 370
           K AK  G    +FV  L  S+DDE L++EF   G + +A+VM  E G  +S+G+G+V F 
Sbjct: 167 KKAKTDGEPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVM-YERGTDRSRGYGYVDFE 225

Query: 371 TPEEATKAITEKNQQIVAGKPLYVAIAQRK 400
               A KA+ E + + + G+P+ V ++  K
Sbjct: 226 DKSYAEKAVKEMHGKEIDGRPINVDMSTSK 255

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 40/79 (50%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++G+L  +    ++Y+IF   G + S+R+     T+   G+ YV +   +  +KA+E L
Sbjct: 279 LFLGNLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEAL 338

Query: 100 NYTPIKGRLCRIMWSQRDP 118
               I  R  R+ +S   P
Sbjct: 339 QGEYIDNRPVRLDYSTPKP 357

>CAGL0H10604g complement(1033488..1034738) similar to sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1, hypothetical
           start
          Length = 416

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 96/171 (56%), Gaps = 4/171 (2%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           LYVG+L+ S++E  L   F   G + ++++  D +    + YA+V +        A++ L
Sbjct: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118

Query: 100 NYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIA 158
           N   ++ +  +I W+ +   +     + N+F+ +L+ D+D++ L  TF  F   + + + 
Sbjct: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178

Query: 159 TD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERD 208
            D + G+S+G+GFV F  +  A++A+DA+ G  L+G++I +    +++ER+
Sbjct: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRIN-WATKRERN 228

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 90/183 (49%), Gaps = 18/183 (9%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALN 280
           LYV N++   T++  ++ F   GPI +  + +D   +   + FV Y +  DA  A++ LN
Sbjct: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119

Query: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGV-NLFVKNLDDSVDDEKLE 339
             +L  + L +                  A+  ++ A+     NLFV +L+  VDDE L 
Sbjct: 120 GVQLENKTLKINW----------------AFETQQAAENDDTFNLFVGDLNVDVDDETLA 163

Query: 340 EEFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398
             F  + T   A VM   + G+S+G+GFV FS  EEA KA+     + ++G+ + +  A 
Sbjct: 164 GTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223

Query: 399 RKD 401
           +++
Sbjct: 224 KRE 226

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 81/175 (46%), Gaps = 6/175 (3%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALN 187
           +++ NL   I    L   F   G I + KI  D   +   + FV +     A  A+  LN
Sbjct: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119

Query: 188 GMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVS 247
           G+ L  + + +      +    Q  E    + NL+V ++N +  DE     F +F   + 
Sbjct: 120 GVQLENKTLKINWAFETQ----QAAENDDTF-NLFVGDLNVDVDDETLAGTFREFPTFIQ 174

Query: 248 ASLEKDAD-GKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERM 301
           A +  D   G+ +G+GFV++   E+A KA++A+   +L+G ++ +  A K+   M
Sbjct: 175 AHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATKRERNM 229

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 4/93 (4%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+VGDL   V +  L   F    +     V  D  T  S GY +V+F++ E  +KA++ +
Sbjct: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKN 132
               + GR  RI W+ +    R++  GN F  N
Sbjct: 208 QGKDLSGRQIRINWATK----RERNMGNNFGNN 236

>KLLA0C11495g complement(990832..992169) some similarities with
           sp|P27476 Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, hypothetical
           start
          Length = 445

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 59/192 (30%), Positives = 93/192 (48%), Gaps = 14/192 (7%)

Query: 19  DDQKQAATGXXXXXXXXXXXXLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTS 78
           DD++++ +             ++VG L  S+ +  L   F PIG V S RV  +  T  S
Sbjct: 177 DDEEKSESKKPKTELAGEPATIFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRS 236

Query: 79  LGYAYVNFNDHEAGRKAIEQLNYTPIKGRL--CRIMWSQ-----RDPSLRKKG------S 125
            GY YV+F D     KAI++++   I GR   C +  S+     RD   +K G      S
Sbjct: 237 RGYGYVDFEDKSYAEKAIKEMHGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEPS 296

Query: 126 GNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAID 184
             +F+ NL  + D   LY+ F  +G+I+S +I T  E  + KGFG+V +     A +A +
Sbjct: 297 DTLFLGNLSFEADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFE 356

Query: 185 ALNGMLLNGQEI 196
            L G  +N + +
Sbjct: 357 GLQGEYINNRPV 368

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 88/167 (52%), Gaps = 9/167 (5%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDAL 186
           IF+  L   ID++ L   F   G ++S+++  +    +S+G+G+V FE++  A++AI  +
Sbjct: 198 IFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIKEM 257

Query: 187 NGMLLNGQEIYVAPHLS------RKERDSQLEETKAHYTN-LYVKNINSETTDEQFQELF 239
           +G  ++G+ I      S      R +R  +  +  +  ++ L++ N++ E   +   E+F
Sbjct: 258 HGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFEADRDNLYEIF 317

Query: 240 AKFGPIVSASLEKDADG-KLKGFGFVNYEKHEDAVKAVEALNDSELN 285
            K+G IVS  +    +  + KGFG+V Y   EDA KA E L    +N
Sbjct: 318 GKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQGEYIN 364

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 87/181 (48%), Gaps = 19/181 (10%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASL--EKDADGKLKGFGFVNYEKHEDAVKAVEA 278
           ++V  ++    DE  +  F   G ++SA +  E+  D + +G+G+V++E    A KA++ 
Sbjct: 198 IFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTD-RSRGYGYVDFEDKSYAEKAIKE 256

Query: 279 LNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGV------NLFVKNLDDS 332
           ++  E++G  +        N  M    K   A R ++  K+  V       LF+ NL   
Sbjct: 257 MHGKEIDGRPI--------NCDMST-SKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFE 307

Query: 333 VDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKP 391
            D + L E F  YG I S ++    E  + KGFG+V + + E+ATKA      + +  +P
Sbjct: 308 ADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQGEYINNRP 367

Query: 392 L 392
           +
Sbjct: 368 V 368

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 3/81 (3%)

Query: 322 VNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENG--KSKGFGFVCFSTPEEATKAI 379
             +FV  L  S+DDE L+ EF P G + SA+VM  E G  +S+G+G+V F     A KAI
Sbjct: 196 ATIFVGRLSWSIDDEWLKTEFEPIGGVISARVM-YERGTDRSRGYGYVDFEDKSYAEKAI 254

Query: 380 TEKNQQIVAGKPLYVAIAQRK 400
            E + + + G+P+   ++  K
Sbjct: 255 KEMHGKEIDGRPINCDMSTSK 275

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++G+L       +LY+IF   G + S+R+     T+   G+ YV +   E   KA E L
Sbjct: 299 LFLGNLSFEADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGL 358

Query: 100 NYTPIKGRLCRIMWS 114
               I  R  R+ +S
Sbjct: 359 QGEYINNRPVRLDYS 373

>YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylated
           RNA-binding protein of nucleus and cytoplasm, contains
           three RNA recognition (RRM) domains and three
           Gln/Asn-rich regions [1362 bp, 453 aa]
          Length = 453

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 89/160 (55%), Gaps = 2/160 (1%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           LYVG+L+ +++E  L   F   G +++I++  D   K ++ YA+V ++       A++ L
Sbjct: 77  LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNK-NVNYAFVEYHQSHDANIALQTL 135

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT 159
           N   I+  + +I W+ +        + N+F+ +L+ ++D++ L + F  F   LS  +  
Sbjct: 136 NGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMW 195

Query: 160 D-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
           D + G S+G+GFV F  +  A+ A+D++ G  LNG+ + +
Sbjct: 196 DMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRI 235

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 92/182 (50%), Gaps = 17/182 (9%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALN 280
           LYV N++   T++  ++ F   GPI +  +  D + K   + FV Y +  DA  A++ LN
Sbjct: 77  LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLN 136

Query: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340
             ++                 +++K  + A++ ++ +     NLFV +L+ +VDDE L  
Sbjct: 137 GKQIEN---------------NIVKINW-AFQSQQSSSDDTFNLFVGDLNVNVDDETLRN 180

Query: 341 EFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399
            F  + +  S  VM   + G S+G+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 181 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAK 240

Query: 400 KD 401
           +D
Sbjct: 241 RD 242

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+VGDL  +V +  L + F    S  S  V  D  T +S GY +V+F   +  + A++ +
Sbjct: 164 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSM 223

Query: 100 NYTPIKGRLCRIMWSQR 116
               + GR  RI W+ +
Sbjct: 224 QGQDLNGRPLRINWAAK 240

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 31/75 (41%), Gaps = 6/75 (8%)

Query: 41  YVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLN 100
           Y+G++    +EA L  +F   G +   +   +       G  ++ ++ HE     I  L 
Sbjct: 344 YIGNIPHFATEADLIPLFQNFGFILDFKHYPEK------GCCFIKYDTHEQAAVCIVALA 397

Query: 101 YTPIKGRLCRIMWSQ 115
             P +GR  R  W +
Sbjct: 398 NFPFQGRNLRTGWGK 412

>AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH]
           complement(628898..630088) [1191 bp, 396 aa]
          Length = 396

 Score = 80.5 bits (197), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 55/173 (31%), Positives = 89/173 (51%), Gaps = 14/173 (8%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++VG L  SV +  L   F  IG V   RV  +  T  S GY YV+F D     KA++++
Sbjct: 169 IFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTDKSRGYGYVDFEDVSYAEKAVKEM 228

Query: 100 NYTPIKGRL--CRIMWSQ-----RDPSLRKKG------SGNIFIKNLHPDIDNKALYDTF 146
           +   I GR   C +  S+     R+   +K G      S  +F+ NL  + D  AL++ F
Sbjct: 229 HGKEIDGRAINCDMSTSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSFNADRDALFELF 288

Query: 147 SVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
           S  G+++S +I T  E+ + KGFG+V +     A+ A+DAL G  ++ + + +
Sbjct: 289 SKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDALQGEYIDNRPVRI 341

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 91/192 (47%), Gaps = 19/192 (9%)

Query: 212 EETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASL--EKDADGKLKGFGFVNYEKH 269
           ++T      ++V  ++    DE  +  F   G +V A +  E+  D K +G+G+V++E  
Sbjct: 160 QKTDGQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTD-KSRGYGYVDFEDV 218

Query: 270 EDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGV------N 323
             A KAV+ ++  E++G  +        N  M    K   A R ++  KY          
Sbjct: 219 SYAEKAVKEMHGKEIDGRAI--------NCDMST-SKPASAPREDRAKKYGDTPSQPSDT 269

Query: 324 LFVKNLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFSTPEEATKAITEK 382
           LF+ NL  + D + L E F+ +G + S ++    E+ + KGFG+V + + EEA  A+   
Sbjct: 270 LFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDAL 329

Query: 383 NQQIVAGKPLYV 394
             + +  +P+ +
Sbjct: 330 QGEYIDNRPVRI 341

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 45/83 (54%), Gaps = 3/83 (3%)

Query: 320 QGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENG--KSKGFGFVCFSTPEEATK 377
           Q   +FV  L  SVDDE L+ EF   G +  A+V+  E G  KS+G+G+V F     A K
Sbjct: 165 QPATIFVGRLSWSVDDEWLKTEFDHIGGVVGARVI-YERGTDKSRGYGYVDFEDVSYAEK 223

Query: 378 AITEKNQQIVAGKPLYVAIAQRK 400
           A+ E + + + G+ +   ++  K
Sbjct: 224 AVKEMHGKEIDGRAINCDMSTSK 246

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++G+L  +     L+++FS  G+V S+R+     +    G+ YV +   E  + A++ L
Sbjct: 270 LFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDAL 329

Query: 100 NYTPIKGRLCRIMWSQRDP 118
               I  R  RI +S   P
Sbjct: 330 QGEYIDNRPVRIDFSSPRP 348

>Kwal_27.11447
          Length = 439

 Score = 80.1 bits (196), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 89/182 (48%), Gaps = 17/182 (9%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALN 280
           LYV N++   T++  ++ F   G I +  +  D + K   + FV + +  DA  A + L+
Sbjct: 64  LYVGNLDLAVTEDMLKQYFQVGGAIANVKILMDKNNKEANYAFVEFHQPHDASVAFQTLD 123

Query: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340
             ++                 HV+K  Y A++ ++++     NLFV +L+  VDDE L  
Sbjct: 124 GKQIEN---------------HVIKINY-AFQSQQVSSEDTFNLFVGDLNVDVDDETLAN 167

Query: 341 EFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399
            F    T   A VM   + G+S+G+GFV F    +A KA+ EK   +V G+ + +  A +
Sbjct: 168 TFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRINWASK 227

Query: 400 KD 401
           ++
Sbjct: 228 RE 229

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 92/160 (57%), Gaps = 2/160 (1%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           LYVG+L+ +V+E  L   F   G+++++++  D   K +  YA+V F+       A + L
Sbjct: 64  LYVGNLDLAVTEDMLKQYFQVGGAIANVKILMDKNNKEA-NYAFVEFHQPHDASVAFQTL 122

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT 159
           +   I+  + +I ++ +   +  + + N+F+ +L+ D+D++ L +TF      + + +  
Sbjct: 123 DGKQIENHVIKINYAFQSQQVSSEDTFNLFVGDLNVDVDDETLANTFKHVPTFIQAHVMW 182

Query: 160 D-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
           D + G+S+G+GFV F E+  A++A++   G ++NG+ I +
Sbjct: 183 DMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRI 222

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 77/171 (45%), Gaps = 7/171 (4%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALN 187
           +++ NL   +    L   F V G I + KI  D+N K   + FV F +   A  A   L+
Sbjct: 64  LYVGNLDLAVTEDMLKQYFQVGGAIANVKILMDKNNKEANYAFVEFHQPHDASVAFQTLD 123

Query: 188 GMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVS 247
           G  +    I +      ++  S  E+T     NL+V ++N +  DE     F      + 
Sbjct: 124 GKQIENHVIKINYAFQSQQVSS--EDT----FNLFVGDLNVDVDDETLANTFKHVPTFIQ 177

Query: 248 ASLEKDAD-GKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKK 297
           A +  D   G+ +G+GFV++ +   A KA+E    + +NG  + +  A K+
Sbjct: 178 AHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRINWASKR 228

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+VGDL   V +  L + F  + +     V  D  T  S GY +V+F +    +KA+E+ 
Sbjct: 151 LFVGDLNVDVDDETLANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEK 210

Query: 100 NYTPIKGRLCRIMWSQR 116
             T + GR  RI W+ +
Sbjct: 211 QGTVVNGRAIRINWASK 227

 Score = 36.2 bits (82), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 47/118 (39%), Gaps = 5/118 (4%)

Query: 198 VAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGK 257
           + P +  +  ++ +    +  T +Y+ NI    +++    L   FG IV      D    
Sbjct: 303 LPPQVPPQAIEAMIRSAPSRVTTVYIGNIPHFASEQDLIPLLQNFGFIVDFKHYPD---- 358

Query: 258 LKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEK 315
            +G  F+ Y  HE A   +  L +    G  L  G  ++K   +   K    A ++E+
Sbjct: 359 -RGCCFIKYGTHEQAAICILTLGNFPFQGRNLRTGWGKEKPTYVPQPKLDQSALQMEQ 415

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 31/80 (38%), Gaps = 6/80 (7%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +Y+G++    SE  L  +    G +   +   D       G  ++ +  HE     I  L
Sbjct: 326 VYIGNIPHFASEQDLIPLLQNFGFIVDFKHYPDR------GCCFIKYGTHEQAAICILTL 379

Query: 100 NYTPIKGRLCRIMWSQRDPS 119
              P +GR  R  W +  P+
Sbjct: 380 GNFPFQGRNLRTGWGKEKPT 399

>AEL217W [2289] [Homologous to ScYGR250C - SH]
           complement(225217..227721) [2505 bp, 834 aa]
          Length = 834

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 98/216 (45%), Gaps = 47/216 (21%)

Query: 126 GNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGK-SKGFGFVHFEEEGAAKEAID 184
           GN++I+ +  D+    L   FS FG +LS KI  D N + S G+GF+ +     A   I 
Sbjct: 217 GNLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIK 276

Query: 185 ALNGMLLNGQEIYVAPHLSRKERDS-QLEETK-----AHYTNLYVKNINSETTDEQF--- 235
            LNG L+NG  +++  H+ RKER+   L+  K       +  ++V N+ +E  D      
Sbjct: 277 ELNGNLMNGSPLFINYHVERKERERIHLDHLKEDNDDERFRGVFVGNLPTEYEDGTLITP 336

Query: 236 QELFAKFGPIV---------------SASLE----------------------KDADGKL 258
           +++F KF  I+               + ++E                      ++ D  L
Sbjct: 337 EQVFNKFNHILDPVDILSYYFPKRNSNTNIEYKDDDSTSPTSSSKENAETCDSQNEDSPL 396

Query: 259 KGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRA 294
           KG+GF+ +  H+ A+KA++ LN     G  L V +A
Sbjct: 397 KGYGFIKFSTHDMALKAIDKLNSFTWLGHSLVVNKA 432

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 97/233 (41%), Gaps = 57/233 (24%)

Query: 209 SQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLK-GFGFVNYE 267
           SQ      H  NLY++ I  + + +    +F+KFG ++S  +  D + +   G+GF++Y 
Sbjct: 207 SQNPHALTHPGNLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYP 266

Query: 268 KHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMA------KYQG 321
               A + ++ LN + +NG  L++          HV +K+ E   L+ +       +++G
Sbjct: 267 LGSQAARCIKELNGNLMNGSPLFIN--------YHVERKERERIHLDHLKEDNDDERFRG 318

Query: 322 VNLFVKNLDDSVDDEKL---EEEFAPYGTIT----------------------------- 349
           V  FV NL    +D  L   E+ F  +  I                              
Sbjct: 319 V--FVGNLPTEYEDGTLITPEQVFNKFNHILDPVDILSYYFPKRNSNTNIEYKDDDSTSP 376

Query: 350 ------SAKVMRTENGKS--KGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
                 +A+   ++N  S  KG+GF+ FST + A KAI + N     G  L V
Sbjct: 377 TSSSKENAETCDSQNEDSPLKGYGFIKFSTHDMALKAIDKLNSFTWLGHSLVV 429

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 52/98 (53%), Gaps = 17/98 (17%)

Query: 320 QGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTEN----------------GKSKG 363
           Q  NL+VK++  S  DE L + ++ YG I SAK++                    G S+G
Sbjct: 597 QESNLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGTSRG 656

Query: 364 FGFVCFSTPEEATKAITEKNQ-QIVAGKPLYVAIAQRK 400
           +GFVCF  P +A++A+   ++ Q+     LYV+ AQ++
Sbjct: 657 YGFVCFKNPLDASRAMMATDRFQVGTNHVLYVSFAQKR 694

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 50/89 (56%), Gaps = 6/89 (6%)

Query: 323 NLFVKNL--DDSVDDEKLEEEFAPYGTITSAKVMRTENGK-SKGFGFVCFSTPEEATKAI 379
           NL+++ +  D SVDD  L   F+ +GT+ S K++   N + S G+GF+ +    +A + I
Sbjct: 218 NLYIRGIPKDLSVDD--LIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCI 275

Query: 380 TEKNQQIVAGKPLYVAI-AQRKDVRRSQL 407
            E N  ++ G PL++    +RK+  R  L
Sbjct: 276 KELNGNLMNGSPLFINYHVERKERERIHL 304

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 17/96 (17%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSA----------------SLEKDADGKLKGFG 262
           +NLYVK+I     DE   + ++++G I+SA                +LE    G  +G+G
Sbjct: 599 SNLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGTSRGYG 658

Query: 263 FVNYEKHEDAVKAVEALNDSEL-NGEKLYVGRAQKK 297
           FV ++   DA +A+ A +  ++     LYV  AQK+
Sbjct: 659 FVCFKNPLDASRAMMATDRFQVGTNHVLYVSFAQKR 694

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/234 (21%), Positives = 88/234 (37%), Gaps = 62/234 (26%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           LY+  +   +S   L  IFS  G+V S+++  D  T+ SLGY ++++       + I++L
Sbjct: 219 LYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIKEL 278

Query: 100 NYTPIKG---------------RLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYD 144
           N   + G               R+      + +   R +G   +F+ NL  + ++  L  
Sbjct: 279 NGNLMNGSPLFINYHVERKERERIHLDHLKEDNDDERFRG---VFVGNLPTEYEDGTLIT 335

Query: 145 TFSVFG---------DILS-------------------------------SKIATDENGK 164
              VF          DILS                               +  + +E+  
Sbjct: 336 PEQVFNKFNHILDPVDILSYYFPKRNSNTNIEYKDDDSTSPTSSSKENAETCDSQNEDSP 395

Query: 165 SKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHY 218
            KG+GF+ F     A +AID LN     G  + V    ++  ++  L    +HY
Sbjct: 396 LKGYGFIKFSTHDMALKAIDKLNSFTWLGHSLVV----NKAVQNKTLYNNHSHY 445

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 22/86 (25%)

Query: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT---DEN-------------GK 164
           R +   N+++K++     ++ L D +S +G+I+S+KI T    +N             G 
Sbjct: 594 RDQQESNLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGT 653

Query: 165 SKGFGFVHFEEEGAAKEAIDALNGML 190
           S+G+GFV F      K  +DA   M+
Sbjct: 654 SRGYGFVCF------KNPLDASRAMM 673

>Scas_621.10
          Length = 415

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 85/170 (50%), Gaps = 13/170 (7%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++VG L  S+ +  L   F  IG V S RV  +  T  S GY YV+F D     KAI+++
Sbjct: 164 IFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKEM 223

Query: 100 NYTPIKGRLCRIMWSQRDPSL----RKKGSGNI--------FIKNLHPDIDNKALYDTFS 147
               I GR   +  S   P+     R K  G++        F+ NL  + D  A+ + FS
Sbjct: 224 QGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDAISELFS 283

Query: 148 VFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEI 196
            +G+I+S +I T  E  + KGFG+V +     AK+A++ L G  ++ + +
Sbjct: 284 KYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPV 333

 Score = 74.3 bits (181), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 86/160 (53%), Gaps = 8/160 (5%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDAL 186
           IF+  L   ID++ L   F   G ++S+++  +    +S+G+G+V FE++  A++AI  +
Sbjct: 164 IFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKEM 223

Query: 187 NGMLLNGQEIYV-----APHLSRKERDSQLEETKAHYT-NLYVKNINSETTDEQFQELFA 240
            G  ++G+EI V      P     +R  +  +  +  +  L++ N++     +   ELF+
Sbjct: 224 QGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDAISELFS 283

Query: 241 KFGPIVSASLEKDADG-KLKGFGFVNYEKHEDAVKAVEAL 279
           K+G I+S  +    +  + KGFG+V Y   EDA KA+E L
Sbjct: 284 KYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGL 323

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 93/189 (49%), Gaps = 18/189 (9%)

Query: 212 EETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSAS--LEKDADGKLKGFGFVNYEKH 269
           ++T+     ++V  ++    DE  ++ F   G +VSA   +E+  D + +G+G+V++E  
Sbjct: 155 QKTEGEPATIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTD-RSRGYGYVDFEDK 213

Query: 270 EDAVKAVEALNDSELNGEKLYVGRAQKK-----NERMHVLKKQYEAYRLEKMAKYQGVNL 324
             A KA++ +   E++G ++ V  +  K     N+R         A +   +       L
Sbjct: 214 SYAEKAIKEMQGKEIDGREINVDMSTSKPAAGNNDR---------AKKFGDVPSEPSETL 264

Query: 325 FVKNLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFSTPEEATKAITEKN 383
           F+ NL  + D + + E F+ YG I S ++    E  + KGFG+V ++  E+A KA+    
Sbjct: 265 FLGNLSFNADRDAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQ 324

Query: 384 QQIVAGKPL 392
            + +  +P+
Sbjct: 325 GEYIDNRPV 333

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 322 VNLFVKNLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFSTPEEATKAIT 380
             +FV  L  S+DDE L++EF   G + SA+V M     +S+G+G+V F     A KAI 
Sbjct: 162 ATIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIK 221

Query: 381 EKNQQIVAGKPLYVAIAQRK 400
           E   + + G+ + V ++  K
Sbjct: 222 EMQGKEIDGREINVDMSTSK 241

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 40/79 (50%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++G+L  +     + ++FS  G + S+R+     T+   G+ YV + + E  +KA+E L
Sbjct: 264 LFLGNLSFNADRDAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGL 323

Query: 100 NYTPIKGRLCRIMWSQRDP 118
               I  R  R+ +S   P
Sbjct: 324 QGEYIDNRPVRLDYSTPRP 342

>ADR307W [2048] [Homologous to ScYHR086W (NAM8) - SH]
           complement(1238223..1239923) [1701 bp, 566 aa]
          Length = 566

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 72/316 (22%), Positives = 135/316 (42%), Gaps = 62/316 (19%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVS-SIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQ 98
           LY+GDL+PS +E  +  I++ +G  +  +++ +++    + GY +V F  + A   A+ +
Sbjct: 54  LYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSNLAATNALLK 113

Query: 99  LNYTPI---KGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTF-SVFGDILS 154
               PI     R  ++ W+    +   + S  IF+ +L P++    L++ F S +   L+
Sbjct: 114 TGL-PIPVDASRTLKLNWASFATTPGSEFS--IFVGDLAPNVTESQLFELFISRYSSTLN 170

Query: 155 SKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKER------ 207
           +KI  D+  G SKG+GFV F  E   + ++  + G+ LNG+ I V+     K R      
Sbjct: 171 AKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRVSTTSKNKSRFQSGNP 230

Query: 208 ------------------------DSQLEETKAHY----------------TNLYVKNIN 227
                                    + L++++  Y                T +++  ++
Sbjct: 231 ASAAPASPASTAVNSPGLAQGSNVQTLLQQSQFIYPVQQQPALSQFADPNNTTVFIGGLS 290

Query: 228 SETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGE 287
           S  T+++ +  F  FG IV   +        KG GFV Y     A  A+  +    +   
Sbjct: 291 SLVTEDELRAYFQPFGQIVYVKIPVG-----KGCGFVQYVDRSSAENAIAKMQGFPIGNS 345

Query: 288 --KLYVGRAQKKNERM 301
             +L  GR+ K+   M
Sbjct: 346 RVRLSWGRSAKQTAAM 361

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 86/189 (45%), Gaps = 20/189 (10%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPI-VSASLEKDADGKL-KGFGFVNYEKHEDAVKAV 276
           T LY+ +++   T+   ++++A  G   V   L K++ G    G+ FV +  +  A  A+
Sbjct: 52  TQLYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSNLAATNAL 111

Query: 277 EALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDE 336
                    G  + V       +    LK  + ++     +++   ++FV +L  +V + 
Sbjct: 112 LK------TGLPIPV-------DASRTLKLNWASFATTPGSEF---SIFVGDLAPNVTES 155

Query: 337 KLEEEF-APYGTITSAKVMRTE-NGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
           +L E F + Y +  +AK++  +  G SKG+GFV F    E  +++ E     + G+ + V
Sbjct: 156 QLFELFISRYSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRV 215

Query: 395 AIAQRKDVR 403
           +   +   R
Sbjct: 216 STTSKNKSR 224

>YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar
           protein involved in processing 20S to 18S rRNA, has 2
           RNA recognition (RRM) domains and is member of GAR
           (glycine/arginine-rich repeats) family of proteins [1245
           bp, 414 aa]
          Length = 414

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 85/171 (49%), Gaps = 12/171 (7%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++VG L  S+ +  L   F  IG V   RV  +  T  S GY YV+F +     KAI+++
Sbjct: 170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEM 229

Query: 100 NYTPIKGRLCRIMWSQRDPS-----LRKKG------SGNIFIKNLHPDIDNKALYDTFSV 148
               I GR      S   P+      +K G      S  +F+ NL  + D  A+++ F+ 
Sbjct: 230 QGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAK 289

Query: 149 FGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
            G+++S +I T  E  + KGFG+V F     AK+A+DAL G  ++ + + +
Sbjct: 290 HGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRL 340

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 91/190 (47%), Gaps = 18/190 (9%)

Query: 212 EETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASL--EKDADGKLKGFGFVNYEKH 269
           EET+   T ++V  ++    DE  ++ F   G ++ A +  E+  D + +G+G+V++E  
Sbjct: 162 EETEEPAT-IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTD-RSRGYGYVDFENK 219

Query: 270 EDAVKAVEALNDSELNGEKLYVGRAQKK----NERMHVLKKQYEAYRLEKMAKYQGVNLF 325
             A KA++ +   E++G  +    +  K    N+R         A +           LF
Sbjct: 220 SYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDR---------AKKFGDTPSEPSDTLF 270

Query: 326 VKNLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFSTPEEATKAITEKNQ 384
           + NL  + D + + E FA +G + S ++    E  + KGFG+V FS  E+A KA+     
Sbjct: 271 LGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQG 330

Query: 385 QIVAGKPLYV 394
           + +  +P+ +
Sbjct: 331 EYIDNRPVRL 340

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 3/81 (3%)

Query: 322 VNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENG--KSKGFGFVCFSTPEEATKAI 379
             +FV  L  S+DDE L++EF   G +  A+V+  E G  +S+G+G+V F     A KAI
Sbjct: 168 ATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVI-YERGTDRSRGYGYVDFENKSYAEKAI 226

Query: 380 TEKNQQIVAGKPLYVAIAQRK 400
            E   + + G+P+   ++  K
Sbjct: 227 QEMQGKEIDGRPINCDMSTSK 247

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 43/80 (53%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++G+L  +     ++++F+  G V S+R+     T+   G+ YV F++ E  +KA++ L
Sbjct: 269 LFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDAL 328

Query: 100 NYTPIKGRLCRIMWSQRDPS 119
               I  R  R+ +S   P+
Sbjct: 329 QGEYIDNRPVRLDFSSPRPN 348

>YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein
           required for ribosome biogenesis, contains three
           canonical RNA recognition motif (RRM) domains and one
           degenerate RNA recognition motif (RRM) domain [2058 bp,
           685 aa]
          Length = 685

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 71/311 (22%), Positives = 127/311 (40%), Gaps = 69/311 (22%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALN 187
           +F++++  D+ ++ L D FS F  I  + +  D N +S+GFGFV F  E   KEA+    
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAKAR 87

Query: 188 GMLLNGQ--EIYVAPHLSRKERDSQLEETKAHYTN------------------------- 220
               NG    + +A    R ++ S++ E     ++                         
Sbjct: 88  KTKFNGHILRVDIAKRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGEDSMLKGKP 147

Query: 221 -LYVKNINSETTDE-QFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEA 278
            L ++N+     D  + +++F ++G +V A++ +  DGKL GF FV  +K  +   A+E 
Sbjct: 148 KLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCRIALEN 207

Query: 279 LNDSELNGEKLYVGRAQKKNERMHVLKKQYEA---------------------------- 310
             D +++G K+ V  A +KN      K Q E                             
Sbjct: 208 TKDLKIDGRKVAVDFAVQKNRWEDYKKAQPEMNDKDDNESGNEDAEENHDDEEDENEEED 267

Query: 311 -----------YRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSA-KVMRTEN 358
                       + +   K +  ++FV+N+     +E L   F+ +G++  A  V+    
Sbjct: 268 RQVDQASKNKESKRKAQNKREDFSVFVRNVPYDATEESLAPHFSKFGSVKYALPVIDKST 327

Query: 359 GKSKGFGFVCF 369
           G +KG  FV F
Sbjct: 328 GLAKGTAFVAF 338

 Score = 74.3 bits (181), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 90/201 (44%), Gaps = 21/201 (10%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALN 280
           L+V++I  + TDEQ  + F+ F PI  A + KD + + +GFGFV++   +D  +A+    
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAKAR 87

Query: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVN----------------- 323
            ++ NG  L V  A K+ +R     +  E    E   K  G N                 
Sbjct: 88  KTKFNGHILRVDIA-KRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGEDSMLKGK 146

Query: 324 --LFVKNLDDSVDDE-KLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAIT 380
             L ++N+  S  D  KL++ F  YGT+  A + R  +GK  GF FV          A+ 
Sbjct: 147 PKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCRIALE 206

Query: 381 EKNQQIVAGKPLYVAIAQRKD 401
                 + G+ + V  A +K+
Sbjct: 207 NTKDLKIDGRKVAVDFAVQKN 227

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/318 (18%), Positives = 115/318 (36%), Gaps = 96/318 (30%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+V  +   V++  L D FS    +    V +D   K S G+ +V+F   +  ++A+ + 
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDT-NKRSRGFGFVSFAVEDDTKEALAKA 86

Query: 100 NYTPIKGRLCRIMWSQRDPSLRK----------------------------------KGS 125
             T   G + R+  ++R    +K                                  KG 
Sbjct: 87  RKTKFNGHILRVDIAKRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGEDSMLKGK 146

Query: 126 GNIFIKNLHPDI-DNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAID 184
             + I+N+     D   L   F  +G ++ + I    +GK  GF FV  ++    + A++
Sbjct: 147 PKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCRIALE 206

Query: 185 ALNGMLLNGQEIYV---------------APHLSRKERD--------------------- 208
               + ++G+++ V                P ++ K+ +                     
Sbjct: 207 NTKDLKIDGRKVAVDFAVQKNRWEDYKKAQPEMNDKDDNESGNEDAEENHDDEEDENEEE 266

Query: 209 -------SQLEETKAHYTN------LYVKNINSETTDEQFQELFAKFG------PIVSAS 249
                  S+ +E+K    N      ++V+N+  + T+E     F+KFG      P++  S
Sbjct: 267 DRQVDQASKNKESKRKAQNKREDFSVFVRNVPYDATEESLAPHFSKFGSVKYALPVIDKS 326

Query: 250 LEKDADGKLKGFGFVNYE 267
                 G  KG  FV ++
Sbjct: 327 T-----GLAKGTAFVAFK 339

 Score = 29.6 bits (65), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 60/280 (21%), Positives = 113/280 (40%), Gaps = 47/280 (16%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDEN-GKSKGFGFVHFEEEGAAKEAI-- 183
           ++F++N+  D   ++L   FS FG +  +    D++ G +KG  FV F+++    E I  
Sbjct: 291 SVFVRNVPYDATEESLAPHFSKFGSVKYALPVIDKSTGLAKGTAFVAFKDQYTYNECIKN 350

Query: 184 -------------DALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYT----------- 219
                        D +   +  G+ + + P L R++     E+  A              
Sbjct: 351 APAAGSTSLLIGDDVMPEYVYEGRVLSITPTLVREDAGRMAEKNAAKRKEALGKAPGEKD 410

Query: 220 --NLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAV- 276
             NLY+ N        +  +L       +     K    +LK    ++      A++ + 
Sbjct: 411 RRNLYLLNEGRVVEGSKMADLLTNTDMEIREKSYKLRVEQLKKNPSLHLSMTRLAIRNLP 470

Query: 277 EALNDSELN--GEKLYVGRAQK-KNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSV 333
            A+ND  L     K  V  A + KN+  H L K+      ++  K+ G         D +
Sbjct: 471 RAMNDKALKALARKAVVEFATEVKNKERHPLSKEEIIRSTKEKYKFMG--------PDEI 522

Query: 334 DDEKLEEEFAPYGTITSAKVMR----TENGKSKGFGFVCF 369
           + +K +++ +  G +  AKV+     +  G+S+G+GFV F
Sbjct: 523 EAQKKKDKKS--GVVKQAKVIMEVKGSTAGRSRGYGFVEF 560

>Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement
          Length = 421

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 91/180 (50%), Gaps = 14/180 (7%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++VG L  S+ +  L   F  IG V S RV  +  +  S GY YV+F D     KA++++
Sbjct: 175 IFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVKEM 234

Query: 100 NYTPIKGRL--CRIMWSQ-----RDPSLRKKG------SGNIFIKNLHPDIDNKALYDTF 146
           +   I GR   C +  S+     RD   +K G      S  +F+ NL  + D   L++ F
Sbjct: 235 HGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFNADRDNLFEIF 294

Query: 147 SVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRK 205
           S  G+++S +I T  E  + KGFG+V +     AK+A +AL G  ++ + + +   + R+
Sbjct: 295 SQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNRPVRLDYSIPRQ 354

 Score = 64.3 bits (155), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 86/162 (53%), Gaps = 9/162 (5%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENG-KSKGFGFVHFEEEGAAKEAIDA 185
            IF+  L   ID++ L   F   G ++S+++  +    +S+G+G+V FE++  A++A+  
Sbjct: 174 TIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVKE 233

Query: 186 LNGMLLNGQEIYVAPHLS------RKERDSQLEETKAHYTN-LYVKNINSETTDEQFQEL 238
           ++G  ++G+ I      S      R +R  +  +  +  ++ L++ N++     +   E+
Sbjct: 234 MHGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFNADRDNLFEI 293

Query: 239 FAKFGPIVSASLEKDADG-KLKGFGFVNYEKHEDAVKAVEAL 279
           F++ G ++S  +    +  + KGFG+V Y   +DA KA EAL
Sbjct: 294 FSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEAL 335

 Score = 58.5 bits (140), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 87/186 (46%), Gaps = 7/186 (3%)

Query: 210 QLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASL--EKDADGKLKGFGFVNYE 267
           Q  E       ++V  ++    DE  +  F   G +VSA +  E+ +D + +G+G+V++E
Sbjct: 164 QKPELTGEPATIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSD-RSRGYGYVDFE 222

Query: 268 KHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVK 327
               A KAV+ ++  E++G  +    +  K        +   A +   +       LF+ 
Sbjct: 223 DKHYAEKAVKEMHGKEIDGRPINCDMSTSKPA---AAPRDDRAKKFGDVPSQPSDTLFLG 279

Query: 328 NLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFSTPEEATKAITEKNQQI 386
           NL  + D + L E F+ +G + S ++    E  + KGFG+V + + ++A KA      + 
Sbjct: 280 NLSFNADRDNLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEY 339

Query: 387 VAGKPL 392
           +  +P+
Sbjct: 340 IDNRPV 345

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 322 VNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENG-KSKGFGFVCFSTPEEATKAIT 380
             +FV  L  S+DDE L+ EF   G + SA+V+      +S+G+G+V F     A KA+ 
Sbjct: 173 ATIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVK 232

Query: 381 EKNQQIVAGKPLYVAIAQRK 400
           E + + + G+P+   ++  K
Sbjct: 233 EMHGKEIDGRPINCDMSTSK 252

>Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement
          Length = 464

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 79/319 (24%), Positives = 137/319 (42%), Gaps = 32/319 (10%)

Query: 107 RLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSK 166
           RL R + S  +  + +  S +IF+ NL  D   + L + FS  G+++ + I T   G  +
Sbjct: 143 RLARELDSTYEEKMNRNYSNSIFVGNLTYDCQPEDLKEYFSQIGEVVRADIIT-SRGHHR 201

Query: 167 GFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV--------APHLSRKERDSQLEETKAHY 218
           G G V F       EAI   +G  L  +EI+V        +     +ER  +++ +   Y
Sbjct: 202 GMGTVEFTNADDVDEAIRRFDGSTLLDREIFVRQDNPPPESMRAPPRERRPRIQASAPGY 261

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEA 278
             +++ N+      +  +++F + G ++ A ++ D DG  +G+G V Y+  E+   A+E 
Sbjct: 262 -EVFIANLPYSVNWQALKDMFKECGDVLRADVKLDRDGYSRGYGVVYYKTKEEVQVAIER 320

Query: 279 LNDSELNGEKLYV--GRAQKKNER---------------MHVLKKQYEAYRLE--KMAK- 318
            N  EL G  L V  G+    +E                +    + +E+   E  +MA  
Sbjct: 321 YNGYELEGRVLDVHEGKLGPASEHQQQQEQFQPQDDEPVLDFAPQIHESLNTEFTEMATG 380

Query: 319 --YQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEAT 376
              Q   +FV NL  S     L + F   G +  A++    NGK  G   V +  P +A 
Sbjct: 381 GGDQSSTIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYDNPADAE 440

Query: 377 KAITEKNQQIVAGKPLYVA 395
             I+  N     G+ L ++
Sbjct: 441 VCISRLNSYNYGGRDLDIS 459

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 69/300 (23%), Positives = 116/300 (38%), Gaps = 57/300 (19%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTS--LGYAYVNFNDHEAGRKAIE 97
           ++VG+L        L + FS IG V    V  D IT      G   V F + +   +AI 
Sbjct: 164 IFVGNLTYDCQPEDLKEYFSQIGEV----VRADIITSRGHHRGMGTVEFTNADDVDEAIR 219

Query: 98  QLNYTPIKGRLCRIMWSQRDP--------------SLRKKGSG-NIFIKNLHPDIDNKAL 142
           + + + +  R   I   Q +P               ++    G  +FI NL   ++ +AL
Sbjct: 220 RFDGSTLLDR--EIFVRQDNPPPESMRAPPRERRPRIQASAPGYEVFIANLPYSVNWQAL 277

Query: 143 YDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV---- 198
            D F   GD+L + +  D +G S+G+G V+++ +   + AI+  NG  L G+ + V    
Sbjct: 278 KDMFKECGDVLRADVKLDRDGYSRGYGVVYYKTKEEVQVAIERYNGYELEGRVLDVHEGK 337

Query: 199 -------------------------APHLSRKERDSQLEETKA----HYTNLYVKNINSE 229
                                    AP +  +  +++  E         + ++V N+   
Sbjct: 338 LGPASEHQQQQEQFQPQDDEPVLDFAPQI-HESLNTEFTEMATGGGDQSSTIFVDNLPWS 396

Query: 230 TTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKL 289
           T      +LF   G +  A L+   +GK  G   V Y+   DA   +  LN     G  L
Sbjct: 397 TAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYDNPADAEVCISRLNSYNYGGRDL 456

>Scas_635.7
          Length = 581

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 95/176 (53%), Gaps = 14/176 (7%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDAL 186
           +FI  L+ +     L + FS +G+++  KI  D   G+S+GFGF+ FE   +  E +   
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKTQ 257

Query: 187 NGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIV 246
           +  +L+G+ I     + R+E+D   +        ++V  I ++   ++F++ FA++G I+
Sbjct: 258 H--ILDGKVIDPKRSIPREEQDKTGK--------IFVGGIGTDVRPKEFEDFFAQYGTII 307

Query: 247 SASLEKDAD-GKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQ-KKNER 300
            A L  D D G+ +GFGFV Y+   DAV  V      E  G+++ + RA+ + N+R
Sbjct: 308 DAQLMLDKDTGRSRGFGFVTYDSG-DAVDRVCQNKYIEFKGKQIEIKRAEPRHNQR 362

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 97/193 (50%), Gaps = 23/193 (11%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEAL 279
           +++  +N ETT++  +  F+K+G +V   + KD A G+ +GFGF+ +E      + V+  
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKTQ 257

Query: 280 NDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLE 339
           +   L+G+ +   R+  + E+             +K  K     +FV  +   V  ++ E
Sbjct: 258 H--ILDGKVIDPKRSIPREEQ-------------DKTGK-----IFVGGIGTDVRPKEFE 297

Query: 340 EEFAPYGTITSAKVM-RTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398
           + FA YGTI  A++M   + G+S+GFGFV + + +   +    K  +   GK + +  A+
Sbjct: 298 DFFAQYGTIIDAQLMLDKDTGRSRGFGFVTYDSGDAVDRVCQNKYIEF-KGKQIEIKRAE 356

Query: 399 RKDVRRSQLAQQI 411
            +  +R+  +Q +
Sbjct: 357 PRHNQRAAASQPM 369

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 79/148 (53%), Gaps = 9/148 (6%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +++G L    +E  L + FS  G+V  +++ +D  T  S G+ ++ F +  +  + ++  
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKTQ 257

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT 159
           +   + G++  I   +  P   +  +G IF+  +  D+  K   D F+ +G I+ +++  
Sbjct: 258 HI--LDGKV--IDPKRSIPREEQDKTGKIFVGGIGTDVRPKEFEDFFAQYGTIIDAQLML 313

Query: 160 DEN-GKSKGFGFVHFEEEGAAKEAIDAL 186
           D++ G+S+GFGFV ++    + +A+D +
Sbjct: 314 DKDTGRSRGFGFVTYD----SGDAVDRV 337

>AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH]
           complement(232080..234269) [2190 bp, 729 aa]
          Length = 729

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 95/209 (45%), Gaps = 32/209 (15%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDAL 186
            +F++N+  D  +  L D FS F  I  + I  D  G S+GFGFV F  E   + A+D  
Sbjct: 17  TLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAALDKG 76

Query: 187 NGMLLNGQEIYVAPHLSRKERDSQLEETKAHYT----------------------NLYVK 224
                 G+ + V     R+ER  + +E +A  +                       L ++
Sbjct: 77  RKTQFKGRLLRV-DVAKRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKPKLIIR 135

Query: 225 NINSETTD-EQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSE 283
           N+     D  + +++F +FG +  AS+ + ADGKL GF FV  +K  +  KA+E     +
Sbjct: 136 NMPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEECKGLK 195

Query: 284 LNGEKLYVGRAQKKNERMHVLKKQYEAYR 312
           ++G ++ V  A        V K ++E Y+
Sbjct: 196 IDGREVAVDFA--------VQKSKWEDYK 216

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 91/193 (47%), Gaps = 12/193 (6%)

Query: 220 NLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEAL 279
            L+V+NI  + TD +  + F++F PI  A + KD  G  +GFGFV++    D   A++  
Sbjct: 17  TLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAALDKG 76

Query: 280 NDSELNGEKLYVGRAQK--KNERMHVLKKQYEAYRLEK--------MAKYQGV-NLFVKN 328
             ++  G  L V  A++  ++++    + Q  A   EK         A  +G   L ++N
Sbjct: 77  RKTQFKGRLLRVDVAKRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKPKLIIRN 136

Query: 329 LDDSVDD-EKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIV 387
           +  S  D  KL++ F  +G +  A + R  +GK  GF FV         KAI E     +
Sbjct: 137 MPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEECKGLKI 196

Query: 388 AGKPLYVAIAQRK 400
            G+ + V  A +K
Sbjct: 197 DGREVAVDFAVQK 209

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 79/187 (42%), Gaps = 29/187 (15%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+V ++    ++A L D FS    +    + +D    +S G+ +V+F      + A+++ 
Sbjct: 18  LFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAG-SSRGFGFVSFAVESDTQAALDKG 76

Query: 100 NYTPIKGRLCRIMWSQRDPSLRK---------------------------KGSGNIFIKN 132
             T  KGRL R+  ++R    +K                           +G   + I+N
Sbjct: 77  RKTQFKGRLLRVDVAKRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKPKLIIRN 136

Query: 133 LHPDI-DNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLL 191
           +     D   L   F  FG +  + I    +GK  GF FV  ++    ++AI+   G+ +
Sbjct: 137 MPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEECKGLKI 196

Query: 192 NGQEIYV 198
           +G+E+ V
Sbjct: 197 DGREVAV 203

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 49/91 (53%), Gaps = 2/91 (2%)

Query: 323 NLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEK 382
            LFV+N+     D +L + F+ +  I  A +++   G S+GFGFV F+   +   A+ + 
Sbjct: 17  TLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAALDKG 76

Query: 383 NQQIVAGKPLYVAIAQRKDVRRSQLAQQIQA 413
            +    G+ L V +A+R++  RS+   + +A
Sbjct: 77  RKTQFKGRLLRVDVAKRRE--RSKKGDEAEA 105

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 87/215 (40%), Gaps = 25/215 (11%)

Query: 54  LYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMW 113
           L  IF   G V+   + R A  K   G+A+V        RKAIE+     I GR   +  
Sbjct: 147 LKKIFGRFGVVAEASIPRKADGKL-CGFAFVTMKKLSNCRKAIEECKGLKIDGREVAV-- 203

Query: 114 SQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHF 173
              D +++K    +   K  HP+ D +   D          S+   DE+G          
Sbjct: 204 ---DFAVQKSKWEDY--KKTHPESDEEEQVDEGE------ESEAEGDEDGS--------- 243

Query: 174 EEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDE 233
           + EG   EA D  +G      +   A   S   R  +    +    +++V+N+  + T E
Sbjct: 244 DAEGDVAEASDEESGEESESGDTSAAETDS-VSRPQEAPRNRRENFSVFVRNVPYDATQE 302

Query: 234 QFQELFAKFGPIVSASLEKDADGKL-KGFGFVNYE 267
             +  F+KFGP+  A   +D +  L KG  FV ++
Sbjct: 303 TLEAHFSKFGPVKYALPVQDKETGLPKGTAFVAFK 337

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 22/37 (59%)

Query: 256 GKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVG 292
           G+ KG+GF+ Y  H+ A+  +  LN  ++  E++  G
Sbjct: 548 GRSKGYGFIEYRDHKAALMGLRWLNAHQVTQEEILEG 584

>Kwal_56.24709
          Length = 828

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 109/259 (42%), Gaps = 52/259 (20%)

Query: 83  YVNFNDHEAGR-KAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKA 141
           + ++ D E  R  A+  L  +PI  +     WS    +      GN++++ +  D+    
Sbjct: 202 FKHWADLEVVRDSAVAALRASPIVSK-----WSVSVNAHALTHPGNLYVRGIPKDLTIDD 256

Query: 142 LYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAP 200
           L   FS FG +LS KI  D  +G S G+GF+ +     A   I  LNG L+NG  +++  
Sbjct: 257 LVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASRCIKELNGNLMNGSALFINY 316

Query: 201 HLSRKERDS------QLEETKAHYTNLYVKNINSETTDEQF---QELFAKF--------- 242
           H+ RKER+       + +     +  +++ N+ +   D      + + AKF         
Sbjct: 317 HVERKERERIHWDHFKEDNDDDRFKGVFIGNLPTNHPDGSLVTPEHVIAKFQDQLRSKGE 376

Query: 243 GPI---------------------------VSASLEKDADGKLKGFGFVNYEKHEDAVKA 275
            P+                           +   + K  +  LKG+GF+ +  H+ A+ A
Sbjct: 377 QPVHIVSYYLPKRNSESDIEYRDDDDKTDDIETCISKHEESPLKGYGFIKFVSHDQALTA 436

Query: 276 VEALNDSELNGEKLYVGRA 294
           ++  N+ E  G KL V +A
Sbjct: 437 IDLFNNFEWLGNKLVVNKA 455

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 64/124 (51%), Gaps = 5/124 (4%)

Query: 216 AHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDA-DGKLKGFGFVNYEKHEDAVK 274
            H  NLYV+ I  + T +    +F+KFGP++S  +  D+  G   G+GF++Y     A +
Sbjct: 238 THPGNLYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASR 297

Query: 275 AVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVD 334
            ++ LN + +NG  L++    ++ ER  +    ++    +   +++GV  F+ NL  +  
Sbjct: 298 CIKELNGNLMNGSALFINYHVERKERERIHWDHFKEDNDDD--RFKGV--FIGNLPTNHP 353

Query: 335 DEKL 338
           D  L
Sbjct: 354 DGSL 357

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 50/101 (49%), Gaps = 20/101 (19%)

Query: 320 QGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTEN-------------------GK 360
           Q  NL+VK+L  S  DE   + +  +G I SAK++                       G 
Sbjct: 608 QESNLYVKHLPMSWRDEDFFQFYENFGEIISAKIITVGGSKNDGIGEDGAAKQSEPALGS 667

Query: 361 SKGFGFVCFSTPEEATKAITEKNQ-QIVAGKPLYVAIAQRK 400
           SKG+GFVCF  P +A++A+   ++ Q+     LYV+ AQ++
Sbjct: 668 SKGYGFVCFKNPLDASRAMMITDRYQVDENHTLYVSFAQKR 708

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 76/213 (35%), Gaps = 57/213 (26%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           LYV  +   ++   L  +FS  G V S+++  D+ +  SLGY ++++       + I++L
Sbjct: 243 LYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASRCIKEL 302

Query: 100 NYTPIKGRLC------------RIMWS---QRDPSLRKKGSGNIFIKNL---HPDIDNKA 141
           N   + G               RI W    + +   R KG   +FI NL   HPD     
Sbjct: 303 NGNLMNGSALFINYHVERKERERIHWDHFKEDNDDDRFKG---VFIGNLPTNHPDGSLVT 359

Query: 142 LYDTFSVFGDILSSK------------------------------------IATDENGKS 165
                + F D L SK                                    I+  E    
Sbjct: 360 PEHVIAKFQDQLRSKGEQPVHIVSYYLPKRNSESDIEYRDDDDKTDDIETCISKHEESPL 419

Query: 166 KGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
           KG+GF+ F     A  AID  N     G ++ V
Sbjct: 420 KGYGFIKFVSHDQALTAIDLFNNFEWLGNKLVV 452

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 47/99 (47%), Gaps = 20/99 (20%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASL-------------------EKDADGKLK 259
           +NLYVK++     DE F + +  FG I+SA +                    + A G  K
Sbjct: 610 SNLYVKHLPMSWRDEDFFQFYENFGEIISAKIITVGGSKNDGIGEDGAAKQSEPALGSSK 669

Query: 260 GFGFVNYEKHEDAVKAVEALNDSELN-GEKLYVGRAQKK 297
           G+GFV ++   DA +A+   +  +++    LYV  AQK+
Sbjct: 670 GYGFVCFKNPLDASRAMMITDRYQVDENHTLYVSFAQKR 708

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 5/60 (8%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDAL 186
           N+++K+L     ++  +  +  FG+I+S+KI T    K+ G G     E+GAAK++  AL
Sbjct: 611 NLYVKHLPMSWRDEDFFQFYENFGEIISAKIITVGGSKNDGIG-----EDGAAKQSEPAL 665

>Kwal_55.21960
          Length = 597

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 89/173 (51%), Gaps = 13/173 (7%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDAL 186
           +FI  L+ +     L D FS +G +   KI  D   G+S+GFGF+ F E  +  E +   
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 187 NGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIV 246
           +  +L+G+ I     + R+E+D            ++V  I  +   ++F+E F+++G I+
Sbjct: 271 H--ILDGKVIDPKRAIPREEQD--------KTGKIFVGGIGPDVRPKEFEEFFSQWGTII 320

Query: 247 SASLEKDAD-GKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKN 298
            A L  D D G+ +GFGF+ Y+   DAV  V      E  G+++ + RA+ ++
Sbjct: 321 DAQLMLDKDTGRSRGFGFITYDT-PDAVDRVCENKFIEFKGKRIEIKRAEPRH 372

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 84/164 (51%), Gaps = 22/164 (13%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEAL 279
           +++  +N ETT++  ++ F+K+G +    + +D A G+ +GFGF+ + +     + V+  
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 280 NDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLE 339
           +   L+G+ +   RA  + E+             +K  K     +FV  +   V  ++ E
Sbjct: 271 H--ILDGKVIDPKRAIPREEQ-------------DKTGK-----IFVGGIGPDVRPKEFE 310

Query: 340 EEFAPYGTITSAKVM-RTENGKSKGFGFVCFSTPEEATKAITEK 382
           E F+ +GTI  A++M   + G+S+GFGF+ + TP+   +    K
Sbjct: 311 EFFSQWGTIIDAQLMLDKDTGRSRGFGFITYDTPDAVDRVCENK 354

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 76/140 (54%), Gaps = 5/140 (3%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +++G L    +E +L D FS  G V+ +++ RD  T  S G+ ++ F +  +  + ++  
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT 159
           +   + G++  I   +  P   +  +G IF+  + PD+  K   + FS +G I+ +++  
Sbjct: 271 HI--LDGKV--IDPKRAIPREEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLML 326

Query: 160 DEN-GKSKGFGFVHFEEEGA 178
           D++ G+S+GFGF+ ++   A
Sbjct: 327 DKDTGRSRGFGFITYDTPDA 346

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++VG + P V      + FS  G++   ++  D  T  S G+ ++ ++  +A  +  E  
Sbjct: 295 IFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGRSRGFGFITYDTPDAVDRVCEN- 353

Query: 100 NYTPIKGRLCRI 111
            +   KG+   I
Sbjct: 354 KFIEFKGKRIEI 365

>CAGL0E01947g 193225..194583 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 452

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 87/174 (50%), Gaps = 13/174 (7%)

Query: 123 KGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKE 181
           K S  +FI  L+ +     L D FS +G +   KI  D   G+S+GFGF+ FE   +  E
Sbjct: 119 KDSCKMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDE 178

Query: 182 AIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAK 241
            +   +  +L+G+ I     + R+E+D            ++V  I  +   ++F+E FA+
Sbjct: 179 VVKTQH--ILDGKVIDPKRAIPREEQD--------KTGKIFVGGIGPDVRPKEFEEFFAQ 228

Query: 242 FGPIVSASLEKDAD-GKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRA 294
           +G I+ A L  D D G+ +GFGF+ Y+   DAV  V      +  G K+ + RA
Sbjct: 229 WGTIIDAQLMLDKDTGRSRGFGFITYDT-PDAVDKVCQNKFIDFKGRKIEIKRA 281

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 84/164 (51%), Gaps = 22/164 (13%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEAL 279
           +++  +N ETT++  ++ F+K+G +    + KD A G+ +GFGF+ +E      + V+  
Sbjct: 124 MFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDEVVKTQ 183

Query: 280 NDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLE 339
           +   L+G+ +   RA  + E+             +K  K     +FV  +   V  ++ E
Sbjct: 184 H--ILDGKVIDPKRAIPREEQ-------------DKTGK-----IFVGGIGPDVRPKEFE 223

Query: 340 EEFAPYGTITSAKVM-RTENGKSKGFGFVCFSTPEEATKAITEK 382
           E FA +GTI  A++M   + G+S+GFGF+ + TP+   K    K
Sbjct: 224 EFFAQWGTIIDAQLMLDKDTGRSRGFGFITYDTPDAVDKVCQNK 267

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 72/136 (52%), Gaps = 5/136 (3%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +++G L    +E  L D FS  G V  +++ +D  T  S G+ ++ F    +  + ++  
Sbjct: 124 MFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDEVVKTQ 183

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT 159
           +   + G++  I   +  P   +  +G IF+  + PD+  K   + F+ +G I+ +++  
Sbjct: 184 HI--LDGKV--IDPKRAIPREEQDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQLML 239

Query: 160 DEN-GKSKGFGFVHFE 174
           D++ G+S+GFGF+ ++
Sbjct: 240 DKDTGRSRGFGFITYD 255

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++VG + P V      + F+  G++   ++  D  T  S G+ ++ ++  +A  K   Q 
Sbjct: 208 IFVGGIGPDVRPKEFEEFFAQWGTIIDAQLMLDKDTGRSRGFGFITYDTPDAVDKVC-QN 266

Query: 100 NYTPIKGRLCRI 111
            +   KGR   I
Sbjct: 267 KFIDFKGRKIEI 278

>KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1 CF Ib (RNA3
           Cleavage factor Ib), hypothetical start
          Length = 570

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 97/193 (50%), Gaps = 18/193 (9%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDAL 186
           +FI  L+ +   + L D FS +G +   KI  D   G+S+GFGF+ FE   +  E +   
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFENASSVDEVVKTQ 247

Query: 187 NGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIV 246
           +  +L+G+ I     + R+E+D            ++V  I  +   ++F+E F+++G I+
Sbjct: 248 H--ILDGKVIDPKRAIPREEQD--------KTGKIFVGGIGPDVRPKEFEEFFSQWGSII 297

Query: 247 SASLEKDAD-GKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLK 305
            A L  D D G+ +GFGF+ Y+   DAV  V      E  G+++ + RA+ +      L+
Sbjct: 298 DAQLMLDKDTGRSRGFGFITYDT-PDAVDRVCQNKFIEFKGKQIEIKRAEPRQ-----LQ 351

Query: 306 KQYEAYRLEKMAK 318
           KQ +    + M +
Sbjct: 352 KQKQPQMTQPMGQ 364

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 106/229 (46%), Gaps = 23/229 (10%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEAL 279
           +++  +N ETT+E  ++ F+K+G +    + KD A G+ +GFGF+ +E      + V+  
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFENASSVDEVVKTQ 247

Query: 280 NDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLE 339
           +   L+G+ +   RA  + E+             +K  K     +FV  +   V  ++ E
Sbjct: 248 H--ILDGKVIDPKRAIPREEQ-------------DKTGK-----IFVGGIGPDVRPKEFE 287

Query: 340 EEFAPYGTITSAKVM-RTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398
           E F+ +G+I  A++M   + G+S+GFGF+ + TP+   +    K  +   GK + +  A+
Sbjct: 288 EFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDTPDAVDRVCQNKFIEF-KGKQIEIKRAE 346

Query: 399 RKDVRRSQLAQQIQARNQMRYQQXXXXXXXXXXGMPGQFMPPMFYGVMP 447
            + +++ +  Q  Q   Q                M G F P M  G  P
Sbjct: 347 PRQLQKQKQPQMTQPMGQNMSNPMQQYQMFQNPMMAGGFNPMMATGFNP 395

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 76/140 (54%), Gaps = 5/140 (3%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +++G L    +E  L D FS  G+V+ +++ +D  T  S G+ ++ F +  +  + ++  
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFENASSVDEVVKTQ 247

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT 159
           +   + G++  I   +  P   +  +G IF+  + PD+  K   + FS +G I+ +++  
Sbjct: 248 HI--LDGKV--IDPKRAIPREEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQLML 303

Query: 160 DEN-GKSKGFGFVHFEEEGA 178
           D++ G+S+GFGF+ ++   A
Sbjct: 304 DKDTGRSRGFGFITYDTPDA 323

>Kwal_23.3985
          Length = 876

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 88/177 (49%), Gaps = 6/177 (3%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGK------SKGFGFVHFEEEGAAK 180
           +IF+KNL+     K L + F  FG  + +++ T  + K      S GFGF  F+    A 
Sbjct: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709

Query: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240
             IDA++G +L+G  I +     +  + S   ++K     + VKN+  E   +Q  ELF+
Sbjct: 710 AVIDAMDGAVLDGHRIQLKLSHRQGGQSSSSGKSKKGTGKIIVKNLPFEVERKQIFELFS 769

Query: 241 KFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKK 297
            FG + S  L K  D   +GF FV +   ++A  A+E L    L G +L +  A+++
Sbjct: 770 SFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEEE 826

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 99/213 (46%), Gaps = 16/213 (7%)

Query: 192 NGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLE 251
            G EI      S+ E D   +       +++VKN+N  TT ++  E F  FG  V A ++
Sbjct: 622 TGDEIMQTATASKPEDDGTDDVVDGPTVSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVK 681

Query: 252 KDADGK------LKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLK 305
              D K        GFGF  ++  E A+  ++A++ + L+G ++          ++ +  
Sbjct: 682 TKPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVLDGHRI----------QLKLSH 731

Query: 306 KQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFG 365
           +Q         +K     + VKNL   V+ +++ E F+ +G + S ++ +  +  ++GF 
Sbjct: 732 RQGGQSSSSGKSKKGTGKIIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFA 791

Query: 366 FVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398
           FV F  P+EA  A+ +     + G+ L +  A+
Sbjct: 792 FVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAE 824

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 98/418 (23%), Positives = 167/418 (39%), Gaps = 78/418 (18%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++ ++  + +E     +F+P G +  + V  D  T  S G+AYV F +      A  +L
Sbjct: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKAL-------YDTFS----- 147
           +    +GRL  I+  ++  S R        +KNL P    ++L       +DTFS     
Sbjct: 395 DKQIFQGRLLHILPGEQKKSHR---LDEFDLKNL-PLKKQRSLKRKANASHDTFSWNSLY 450

Query: 148 -----VFGDILSSKI---------ATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNG 193
                V G + ++K+         ATD +   K          G  ++  ++  GM L  
Sbjct: 451 MNQDAVLGSV-AAKLGVQKSDLIDATDASAAVKQ-ALAEAHVIGDVRKYFES-KGMDLTK 507

Query: 194 QEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPI-------- 245
            E + +P     +RD          T L VKN    TT  +  +LF  FG +        
Sbjct: 508 FEQFKSP----SDRDD---------TVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPA 554

Query: 246 --VSASLEKDADGKLKGFGFVNYEKHEDAVKAVEA----LNDSELNGEKLYVGR--AQKK 297
             ++    +DA      F  ++Y++ +D +  +E         E  G++  V    AQ  
Sbjct: 555 QTIAVVQYRDATSARAAFSKLSYKRFKDGILYLEKGPKNCFSREPEGDETMVDEIVAQST 614

Query: 298 N---------ERMHV-LKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGT 347
           N         E M      + E    + +     V++FVKNL+ S   ++L E+F  +G 
Sbjct: 615 NVKEARTTGDEIMQTATASKPEDDGTDDVVDGPTVSIFVKNLNFSTTGKELTEKFKTFGG 674

Query: 348 ITSAKVMRTENGK------SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399
              A+V    + K      S GFGF  F T E+A   I   +  ++ G  + + ++ R
Sbjct: 675 FVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVLDGHRIQLKLSHR 732

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 324 LFVKNLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFSTPEEATKAITEK 382
           LF++N+  +  ++   + FAP+G +    V + T  GKSKGF +V F  P +A  A  E 
Sbjct: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394

Query: 383 NQQIVAGKPLYVAIAQRKDVRR 404
           ++QI  G+ L++   ++K   R
Sbjct: 395 DKQIFQGRLLHILPGEQKKSHR 416

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 90/203 (44%), Gaps = 18/203 (8%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGS--VSSIRVCRD---AITKTSLGYAYVNFNDHEAGRK 94
           ++V +L  S +   L + F   G   V+ ++   D   +    S+G+ +  F   E    
Sbjct: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710

Query: 95  AIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGN------IFIKNLHPDIDNKALYDTFSV 148
            I+ ++   + G   ++  S R          +      I +KNL  +++ K +++ FS 
Sbjct: 711 VIDAMDGAVLDGHRIQLKLSHRQGGQSSSSGKSKKGTGKIIVKNLPFEVERKQIFELFSS 770

Query: 149 FGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERD 208
           FG + S ++    +  ++GF FV F     A+ A++ L G+ L G+ + V  H   + +D
Sbjct: 771 FGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRL-VMQHAEEEPQD 829

Query: 209 SQLEETKAHYTNLYVKNINSETT 231
           +  EE  A  T    K + S+ T
Sbjct: 830 A--EEQIARMT----KKVRSQVT 846

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 123 KGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKE 181
           + +G +F++N+            F+ FG++    +A D   GKSKGF +V F+  G A  
Sbjct: 330 EATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAAN 389

Query: 182 AIDALNGMLLNGQEIYVAP 200
           A   L+  +  G+ +++ P
Sbjct: 390 AYVELDKQIFQGRLLHILP 408

 Score = 33.1 bits (74), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 30/52 (57%)

Query: 347 TITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398
           ++T  K+++   G+S+ F FV F + E+A  A+   +Q  +    + V++A+
Sbjct: 38  SLTDVKILKNRAGESRRFAFVGFKSEEDAFDAVNYFDQSFIDTSKIEVSMAK 89

>Kwal_55.20154
          Length = 522

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 73/322 (22%), Positives = 139/322 (43%), Gaps = 61/322 (18%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVS-SIRVCRDAITK-TSLGYAYVNFNDHEAGRKAIE 97
           LY+GDL+P+  EA +  +++ +G  +  I++ R + +   + GY +V F  H     A+ 
Sbjct: 47  LYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGSPGHNSGYCFVEFPSHTNASNALL 106

Query: 98  Q--LNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTF-SVFGDILS 154
           +  L       R+ ++ W+    +   + S  +F+ ++ P++    L++ F S +   L+
Sbjct: 107 KNGLVIPNTGNRILKLNWASFATTPGNEYS--VFVGDVAPNVTEAQLFELFISRYASTLN 164

Query: 155 SKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV--------------- 198
           +KI  D+  G SKG+GFV F +E   + ++  + G+ LNG+ I V               
Sbjct: 165 AKIVFDQMTGVSKGYGFVKFGQESEQQRSLLEMQGVFLNGRAIRVSTTSKNRPKFQQVQP 224

Query: 199 -----------------APHLSRKERDSQL-----------EETKAHYTNLYVKNINSET 230
                            AP  +  +  SQ            + T  + T +++  ++S  
Sbjct: 225 PLQQQQHQQHAFAKHSHAPQFNAVQPQSQFIYPVQQQPTLTQYTDPNNTTVFIGGLSSLV 284

Query: 231 TDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGE--K 288
           T+++ +  F  FG IV   +        KG GFV Y     A  A+  +    +     +
Sbjct: 285 TEDELRAFFQPFGSIVYVKIPVG-----KGCGFVQYVDRLSAETAIAKMQGFPIGNSRIR 339

Query: 289 LYVGRAQKKNERMHVLKKQYEA 310
           L  GR+ K+     V++K Y +
Sbjct: 340 LSWGRSAKQ---AAVMQKVYAS 358

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/295 (20%), Positives = 119/295 (40%), Gaps = 49/295 (16%)

Query: 125 SGNIFIKNLHPDIDNKALYDTFSVFGDI-LSSKI--ATDENGKSKGFGFVHFEEEGAAKE 181
           S ++++ +L P+ D  A+   ++  G+  +  K+  ++   G + G+ FV F        
Sbjct: 44  SNSLYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGSPGHNSGYCFVEFPSH----- 98

Query: 182 AIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELF-A 240
             +A N +L NG  I    +   K   +    T  +  +++V ++    T+ Q  ELF +
Sbjct: 99  -TNASNALLKNGLVIPNTGNRILKLNWASFATTPGNEYSVFVGDVAPNVTEAQLFELFIS 157

Query: 241 KFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNE 299
           ++   ++A +  D   G  KG+GFV + +  +  +++  +    LNG  + V    K   
Sbjct: 158 RYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQQRSLLEMQGVFLNGRAIRVSTTSKNRP 217

Query: 300 RM-------------------HVLKKQYEAYRLEK-----------MAKYQGVN---LFV 326
           +                    H    Q+ A + +            + +Y   N   +F+
Sbjct: 218 KFQQVQPPLQQQQHQQHAFAKHSHAPQFNAVQPQSQFIYPVQQQPTLTQYTDPNNTTVFI 277

Query: 327 KNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITE 381
             L   V +++L   F P+G+I   K+        KG GFV +     A  AI +
Sbjct: 278 GGLSSLVTEDELRAFFQPFGSIVYVKI-----PVGKGCGFVQYVDRLSAETAIAK 327

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 92/207 (44%), Gaps = 24/207 (11%)

Query: 201 HLSRKERDSQLEETKAHYT---NLYVKNINSETTDEQFQELFAKFG-PIVSASLEKDAD- 255
           H S     SQ   ++ H T   +LY+ +++    +   + ++A  G P V   L + +  
Sbjct: 24  HTSMSGTRSQSPASEHHSTRSNSLYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGS 83

Query: 256 -GKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLE 314
            G   G+ FV +  H +A  A+        NG  +        N    +LK  + ++   
Sbjct: 84  PGHNSGYCFVEFPSHTNASNALLK------NGLVI-------PNTGNRILKLNWASFATT 130

Query: 315 KMAKYQGVNLFVKNLDDSVDDEKLEEEF-APYGTITSAKVMRTE-NGKSKGFGFVCFSTP 372
              +Y   ++FV ++  +V + +L E F + Y +  +AK++  +  G SKG+GFV F   
Sbjct: 131 PGNEY---SVFVGDVAPNVTEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKFGQE 187

Query: 373 EEATKAITEKNQQIVAGKPLYVAIAQR 399
            E  +++ E     + G+ + V+   +
Sbjct: 188 SEQQRSLLEMQGVFLNGRAIRVSTTSK 214

>CAGL0B04169g complement(404713..407298) highly similar to tr|Q06106
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 861

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 86/171 (50%), Gaps = 7/171 (4%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSK------GFGFVHFEEEGAAK 180
           +IFIKNL+    ++ L D F VF   + +++ T  + K K      GFGFV F  +  A 
Sbjct: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700

Query: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240
             I A++G +++G +I +     +    SQ E+ KA    + VKN+  E T +   ELF 
Sbjct: 701 AVISAMDGTVIDGHKIQLKLSHRQGNAGSQ-EKKKAKNGKIIVKNLPFEATRKDVFELFN 759

Query: 241 KFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291
            FG + S  + K  D   +GF FV +   ++A  A++ L    L G +L +
Sbjct: 760 SFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVM 810

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 75/333 (22%), Positives = 136/333 (40%), Gaps = 70/333 (21%)

Query: 53  HLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIM 112
            L ++F P G +  +      +   +   A V F D  +GR A  +L +   KG +  + 
Sbjct: 527 ELGELFVPFGKLERL------LMPPAGTIAIVQFRDIASGRSAFSKLAFKRFKGTVIYL- 579

Query: 113 WSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVH 172
                    +KG  + F                         +K A++E+        + 
Sbjct: 580 ---------EKGPKDCF-------------------------TKAASNEDA-------ME 598

Query: 173 FEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTD 232
            +EE +AKEA  +   +L +     V+   +  + D   +       ++++KN+N +TT 
Sbjct: 599 HDEEKSAKEAGPSSADLLES-----VSSKKTEDKEDEDEQVVDGPTVSIFIKNLNFKTTS 653

Query: 233 EQFQELFAKFGPIVSASLEKDADGKLK------GFGFVNYEKHEDAVKAVEALNDSELNG 286
           +Q  + F  F   V A ++   D K K      GFGFV +   E A   + A++ + ++G
Sbjct: 654 QQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATAVISAMDGTVIDG 713

Query: 287 EKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYG 346
            K+          ++ +  +Q  A   EK     G  + VKNL      + + E F  +G
Sbjct: 714 HKI----------QLKLSHRQGNAGSQEKKKAKNG-KIIVKNLPFEATRKDVFELFNSFG 762

Query: 347 TITSAKVMRTENGKSKGFGFVCFSTPEEATKAI 379
            + S +V +  +  ++GF FV F  P+EA  A+
Sbjct: 763 QLKSVRVPKKFDKSARGFAFVEFVLPKEAENAM 795

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 78/171 (45%), Gaps = 10/171 (5%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGS--VSSIRVCRDAITKT---SLGYAYVNFNDHEAGRK 94
           +++ +L    +   L D F       V+ ++   D   K    S+G+ +V F   E    
Sbjct: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATA 701

Query: 95  AIEQLNYTPIKGRLCRIMWSQRDPSL-----RKKGSGNIFIKNLHPDIDNKALYDTFSVF 149
            I  ++ T I G   ++  S R  +      +K  +G I +KNL  +   K +++ F+ F
Sbjct: 702 VISAMDGTVIDGHKIQLKLSHRQGNAGSQEKKKAKNGKIIVKNLPFEATRKDVFELFNSF 761

Query: 150 GDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAP 200
           G + S ++    +  ++GF FV F     A+ A+D L G+ L G+ + + P
Sbjct: 762 GQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVMQP 812

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 54/91 (59%), Gaps = 3/91 (3%)

Query: 316 MAKYQGV-NLFVKNLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFSTPE 373
           +AK Q    LF++N+  S  ++  ++ F+PYG +    V + T  G SKGF +V F+ PE
Sbjct: 318 IAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPE 377

Query: 374 EATKAITEKNQQIVAGKPLYVAIA-QRKDVR 403
           EA +A  E ++QI  G+ L++  A + KD R
Sbjct: 378 EAVQAYIELDKQIFQGRLLHILAADEMKDHR 408

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 6/85 (7%)

Query: 322 VNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSK------GFGFVCFSTPEEA 375
           V++F+KNL+     ++L + F  +     A+V    + K K      GFGFV F T E+A
Sbjct: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699

Query: 376 TKAITEKNQQIVAGKPLYVAIAQRK 400
           T  I+  +  ++ G  + + ++ R+
Sbjct: 700 TAVISAMDGTVIDGHKIQLKLSHRQ 724

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++ ++  S +E     +FSP G +  + V  D  T  S G+AYV F   E   +A  +L
Sbjct: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386

Query: 100 NYTPIKGRLCRIM 112
           +    +GRL  I+
Sbjct: 387 DKQIFQGRLLHIL 399

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDA-DGKLKGFGFVNYEKHEDAVKAVEAL 279
           L+++NI   +T++ F++LF+ +G +    +  D   G  KGF +V + K E+AV+A   L
Sbjct: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386

Query: 280 NDSELNGEKLYV 291
           +     G  L++
Sbjct: 387 DKQIFQGRLLHI 398

 Score = 29.3 bits (64), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 28/53 (52%)

Query: 243 GPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQ 295
           G I    + K+ +GK + F F+ Y+  +DA+ AV   + S +   K+ V  A+
Sbjct: 37  GLITDLRILKNREGKSRRFAFIGYKNEQDALDAVNYFDGSFIYTSKIEVDMAK 89

>ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH]
           complement(408687..410267) [1581 bp, 526 aa]
          Length = 526

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 81/140 (57%), Gaps = 5/140 (3%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +++G L    +E +L + FS  G+V+ +++ RD  T  S G+ +++F D  +  + ++  
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 224

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT 159
           +   + G++  I   + DP+ R + +G IF+  + PD+  K   + FS +G I+ +++  
Sbjct: 225 HI--LDGKV--IDPKESDPTGRARKAGKIFVAGIGPDVRPKEFEEFFSQWGSIIDAQLML 280

Query: 160 DEN-GKSKGFGFVHFEEEGA 178
           D++ G+S+GFGF+ ++   A
Sbjct: 281 DKDTGRSRGFGFITYDSPDA 300

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 84/172 (48%), Gaps = 13/172 (7%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDAL 186
           +FI  L+ +     L + FS +G++   KI  D   G+S+GFGF+ F +  +  E +   
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKT- 223

Query: 187 NGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIV 246
                  Q I     +  KE D      KA    ++V  I  +   ++F+E F+++G I+
Sbjct: 224 -------QHILDGKVIDPKESDPTGRARKAG--KIFVAGIGPDVRPKEFEEFFSQWGSII 274

Query: 247 SASLEKDAD-GKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKK 297
            A L  D D G+ +GFGF+ Y+   DAV  V      E  G+++ + RA+ +
Sbjct: 275 DAQLMLDKDTGRSRGFGFITYDS-PDAVDRVCQNKFIEFKGKRIEIKRAEPR 325

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 81/168 (48%), Gaps = 30/168 (17%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDA-DGKLKGFGFVNYEKH---EDAVKAV 276
           +++  +N ETT++  +E F+K+G +    + +D   G+ +GFGF+++      ++ VK  
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 224

Query: 277 EALNDSELN-GEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDD 335
             L+   ++  E    GRA+K  +                        +FV  +   V  
Sbjct: 225 HILDGKVIDPKESDPTGRARKAGK------------------------IFVAGIGPDVRP 260

Query: 336 EKLEEEFAPYGTITSAKVM-RTENGKSKGFGFVCFSTPEEATKAITEK 382
           ++ EE F+ +G+I  A++M   + G+S+GFGF+ + +P+   +    K
Sbjct: 261 KEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDSPDAVDRVCQNK 308

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 38/68 (55%), Gaps = 3/68 (4%)

Query: 324 LFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRT-ENGKSKGFGFVCFSTPEEATKAITEK 382
           +F+  L+    ++ L E F+ YG +T  K+MR    G+S+GFGF+ F+      + +  K
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVV--K 222

Query: 383 NQQIVAGK 390
            Q I+ GK
Sbjct: 223 TQHILDGK 230

>CAGL0L12672g complement(1359637..1361685) similar to sp|P37838
           Saccharomyces cerevisiae YPL043w nucleolar protein,
           start by similarity
          Length = 682

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 93/202 (46%), Gaps = 20/202 (9%)

Query: 220 NLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEAL 279
            L+V++I    TDEQ  + F+ F PI  A + KD + K +GFGFV++   +D   A++  
Sbjct: 23  TLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIALKEA 82

Query: 280 NDSELNGEKLYVGRAQKKNERMHVLKK--QYEAYRLEKMAKYQGVN-------------- 323
             ++L+G +L V  A++++       K  Q E  R      Y   N              
Sbjct: 83  RKTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESSLLKG 142

Query: 324 ---LFVKNLDDSVDD-EKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAI 379
              L ++N+  S  D  KL++ F  YG +  A + R  +GK  GF FV  +      KA+
Sbjct: 143 KPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNCKKAL 202

Query: 380 TEKNQQIVAGKPLYVAIAQRKD 401
            +     + G+ + V  A +K+
Sbjct: 203 EDTKNLTIDGRKVAVDFAVQKN 224

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/214 (26%), Positives = 96/214 (44%), Gaps = 33/214 (15%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDAL 186
            +F++++   + ++ L D FS F  I  + +  D N KS+GFGFV F  E   K A+   
Sbjct: 23  TLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIALKEA 82

Query: 187 NGMLLNGQEIYVAPHLSRKERDSQLEETKAHYT--------------------------- 219
               L+G ++ V     R++R  + E+  A                              
Sbjct: 83  RKTKLDGAQLKVDI-ARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESSLLK 141

Query: 220 ---NLYVKNINSETTD-EQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKA 275
               L ++N+     D  + +++F K+G +V AS+ +  DGKL GF FV   K  +  KA
Sbjct: 142 GKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNCKKA 201

Query: 276 VEALNDSELNGEKLYVGRAQKKNERMHVLKKQYE 309
           +E   +  ++G K+ V  A +KN +    K +YE
Sbjct: 202 LEDTKNLTIDGRKVAVDFAVQKN-KWEEYKTKYE 234

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/218 (20%), Positives = 86/218 (39%), Gaps = 37/218 (16%)

Query: 17  IQDDQKQAATGXXXXXXXXXXXXLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITK 76
           + D  ++A  G            L+V  +  SV++  L D FS    +    V +D + K
Sbjct: 1   MSDRVQEANVGESAVDNGLDMKTLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKD-VNK 59

Query: 77  TSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQR--------DPSLRK------ 122
            S G+ +V+F   +  + A+++   T + G   ++  ++R        D S +K      
Sbjct: 60  KSRGFGFVSFAVEDDTKIALKEARKTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNS 119

Query: 123 ---------------------KGSGNIFIKNLHPDI-DNKALYDTFSVFGDILSSKIATD 160
                                KG   + I+N+     D   L   F  +G ++ + I   
Sbjct: 120 SKRSYGDENTEGGEEDESSLLKGKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRK 179

Query: 161 ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
            +GK  GF FV   +    K+A++    + ++G+++ V
Sbjct: 180 RDGKLCGFAFVTMNKISNCKKALEDTKNLTIDGRKVAV 217

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 46/98 (46%), Gaps = 16/98 (16%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDEN-GKSKGFGFVHFEEEGAAKEAI-- 183
           ++F++N+  D   ++L+D FS FG +  +    D+N G +KG  FV F++E   K  +  
Sbjct: 291 SVFVRNVPYDATEESLFDHFSKFGPVKYALPVIDKNTGLAKGTAFVAFKDEKTYKYCVDN 350

Query: 184 -------------DALNGMLLNGQEIYVAPHLSRKERD 208
                        D L   +  G+ + V P L R+  D
Sbjct: 351 SPQTGATSLLIGDDVLPEYVYEGRVLAVTPTLEREHAD 388

>CAGL0M03795g complement(428607..430148) highly similar to sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 513

 Score = 74.3 bits (181), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 120/236 (50%), Gaps = 41/236 (17%)

Query: 192 NGQEIYVAPHLSRKERDSQLEET---------KAHYTN----LYVKNINSETTDEQFQEL 238
           NG  +   P +S + ++S+  E+         KA  +     +++  +N ETT++  +E 
Sbjct: 90  NGSNVSSEPQVSNQTQNSEQRESIEEANRRQVKADLSRENCKMFIGGLNWETTEDGLREY 149

Query: 239 FAKFGPIVSASLEKDAD-GKLKGFGFVNYEKHEDAVKAVEALNDSE--LNGEKLYVGRAQ 295
           F+K+G +V   + KD + G+ +GFGF+++    DA  +V+ +  ++  L+G+ +   RA 
Sbjct: 150 FSKYGNVVELKIMKDPNTGRSRGFGFLSF----DAPSSVDEVVKTQHILDGKVIDPKRAI 205

Query: 296 KKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVM- 354
            + E+             +K  K     +FV  L   V  ++ EE F+ +GTI  A++M 
Sbjct: 206 PREEQ-------------DKTGK-----IFVGGLGTDVRPKEFEEYFSQWGTIIDAQLML 247

Query: 355 RTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQ 410
             + G+S+GFGFV + +P+ A K + E   +   GK + +  A+ +  ++ Q  QQ
Sbjct: 248 DKDTGRSRGFGFVTYDSPDAAEK-VCESRYREFKGKQIEIKRAEPRHQQK-QAGQQ 301

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 80/147 (54%), Gaps = 5/147 (3%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +++G L    +E  L + FS  G+V  +++ +D  T  S G+ +++F+   +  + ++  
Sbjct: 132 MFIGGLNWETTEDGLREYFSKYGNVVELKIMKDPNTGRSRGFGFLSFDAPSSVDEVVKTQ 191

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT 159
           +   + G++  I   +  P   +  +G IF+  L  D+  K   + FS +G I+ +++  
Sbjct: 192 HI--LDGKV--IDPKRAIPREEQDKTGKIFVGGLGTDVRPKEFEEYFSQWGTIIDAQLML 247

Query: 160 DEN-GKSKGFGFVHFEEEGAAKEAIDA 185
           D++ G+S+GFGFV ++   AA++  ++
Sbjct: 248 DKDTGRSRGFGFVTYDSPDAAEKVCES 274

>Scas_558.1
          Length = 435

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 80/376 (21%), Positives = 151/376 (40%), Gaps = 61/376 (16%)

Query: 81  YAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNK 140
           Y     +D   G     + +Y P+   L R + S  +  + +  + +IF+ NL  D   +
Sbjct: 63  YRSRGVDDRRRGPSRYAKGDYGPV---LARELDSTYEEKVNRNYANSIFVGNLTYDCTPE 119

Query: 141 ALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVA- 199
            L D FS  G+++ + I T + G  +G G V F      +EAI   +      ++I+V  
Sbjct: 120 DLRDYFSGIGEVVRADIITSK-GHHRGMGTVEFTNSRDVEEAIRQYDSSYFMDRQIFVRQ 178

Query: 200 ----PHLSRKER----------DSQLEETKAHYT---------NLYVKNINSETTDEQFQ 236
               P   R ER            Q + +   Y+          ++V N+      +  +
Sbjct: 179 DNPPPDNGRNERTPSRRTTAPSSRQQDISSGAYSMQSNMKQGYEIFVANLPYSINWQALK 238

Query: 237 ELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV--GRA 294
           ++F + G ++ A +E D  G+ +GFG V +   +D  +A++  N  E++G  L V  G +
Sbjct: 239 DMFKECGDVMRADVELDRAGRSRGFGTVIFRTRDDMERAIDRYNRFEVDGRTLDVREGHS 298

Query: 295 QKKNERMHVLKKQYEAYRLEKMAK-----------------------YQGVN-------- 323
             +N+ M++  +   A   +  +                         +GV         
Sbjct: 299 NNRNDDMNIQHQTQNAMTNDATSDATSNERSLPTQPSEPASNRTSTFTEGVVEGGERNTL 358

Query: 324 LFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKN 383
           ++  NL  S     L + F   G + +A++    NG++ G   V F + ++A   I   N
Sbjct: 359 IYCSNLPPSTARSDLYDLFESIGKVRNAELKYDRNGETTGVAIVEFISQDDADVCIERLN 418

Query: 384 QQIVAGKPLYVAIAQR 399
           +    G  L ++ A+R
Sbjct: 419 KYNYGGCDLEISYAKR 434

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 106/236 (44%), Gaps = 21/236 (8%)

Query: 199 APHLSRKERDSQLEE-TKAHYTN-LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADG 256
            P L+R E DS  EE    +Y N ++V N+  + T E  ++ F+  G +V A +   + G
Sbjct: 84  GPVLAR-ELDSTYEEKVNRNYANSIFVGNLTYDCTPEDLRDYFSGIGEVVRADIIT-SKG 141

Query: 257 KLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV---------GRAQKKNERMHVLKKQ 307
             +G G V +    D  +A+   + S     +++V         GR ++   R       
Sbjct: 142 HHRGMGTVEFTNSRDVEEAIRQYDSSYFMDRQIFVRQDNPPPDNGRNERTPSRRTTAPSS 201

Query: 308 YE------AYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKS 361
            +      AY ++   K QG  +FV NL  S++ + L++ F   G +  A V     G+S
Sbjct: 202 RQQDISSGAYSMQSNMK-QGYEIFVANLPYSINWQALKDMFKECGDVMRADVELDRAGRS 260

Query: 362 KGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQM 417
           +GFG V F T ++  +AI   N+  V G+ L V      + R   +  Q Q +N M
Sbjct: 261 RGFGTVIFRTRDDMERAIDRYNRFEVDGRTLDVREGHSNN-RNDDMNIQHQTQNAM 315

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 77/338 (22%), Positives = 122/338 (36%), Gaps = 91/338 (26%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTS--LGYAYVNFNDHEAGRKAIE 97
           ++VG+L    +   L D FS IG V    V  D IT      G   V F +     +AI 
Sbjct: 107 IFVGNLTYDCTPEDLRDYFSGIGEV----VRADIITSKGHHRGMGTVEFTNSRDVEEAIR 162

Query: 98  QLNYT---------------PIKGRLCRIMWSQRDPSLRKKGSGN--------------- 127
           Q + +               P  GR      ++R PS R     +               
Sbjct: 163 QYDSSYFMDRQIFVRQDNPPPDNGR------NERTPSRRTTAPSSRQQDISSGAYSMQSN 216

Query: 128 ------IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKE 181
                 IF+ NL   I+ +AL D F   GD++ + +  D  G+S+GFG V F      + 
Sbjct: 217 MKQGYEIFVANLPYSINWQALKDMFKECGDVMRADVELDRAGRSRGFGTVIFRTRDDMER 276

Query: 182 AIDALNGMLLNGQEIYVAP-HLSRKERDSQLE-ETKAHYTN------------------- 220
           AID  N   ++G+ + V   H + +  D  ++ +T+   TN                   
Sbjct: 277 AIDRYNRFEVDGRTLDVREGHSNNRNDDMNIQHQTQNAMTNDATSDATSNERSLPTQPSE 336

Query: 221 ----------------------LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKL 258
                                 +Y  N+   T      +LF   G + +A L+ D +G+ 
Sbjct: 337 PASNRTSTFTEGVVEGGERNTLIYCSNLPPSTARSDLYDLFESIGKVRNAELKYDRNGET 396

Query: 259 KGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQK 296
            G   V +   +DA   +E LN     G  L +  A++
Sbjct: 397 TGVAIVEFISQDDADVCIERLNKYNYGGCDLEISYAKR 434

>Scas_645.14
          Length = 717

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 92/221 (41%), Gaps = 35/221 (15%)

Query: 109 CRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE------- 161
           C   WS           GNIFI  ++  ID   +   F  FG ILS K+  D        
Sbjct: 164 CIEKWSISINKHALTHPGNIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTN 223

Query: 162 ---NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERD----SQLEET 214
              +    G+GF+ F     A E I+  NG ++ G ++++  H+ RKER+    S ++E 
Sbjct: 224 NSTSSNPIGYGFISFVLGSQASECINEFNGKIIEGTKLFLNYHVERKERERIQWSHIKEN 283

Query: 215 K--AHYTNLYVKNINSETTDEQFQELFAKFGPIVSASL-------------------EKD 253
                +  +++ N+ +  TD     +  K    +S  L                     +
Sbjct: 284 NDDEKFKCIFIGNLPTTLTDLTIDLILDKIKTELSEVLPSLQILSYYFPQSKNVNNNINN 343

Query: 254 ADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRA 294
               LKG+GFVN   HE A+K ++ L+  E  G +L V +A
Sbjct: 344 KSSPLKGYGFVNLGSHEQALKVIQTLDGLEWKGNRLVVNKA 384

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 96/236 (40%), Gaps = 34/236 (14%)

Query: 173 FEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTD 232
           F  E   ++  D+++   L+ +E    P+   K   S  +    H  N+++  IN +  +
Sbjct: 136 FHNEAKLEKCRDSID-TFLHSKEDPSFPNCIEKWSISINKHALTHPGNIFIGGINHKIDE 194

Query: 233 EQFQELFAKFGPIVSASLEKD----------ADGKLKGFGFVNYEKHEDAVKAVEALNDS 282
            + + LF KFG I+S  L  D                G+GF+++     A + +   N  
Sbjct: 195 SKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLGSQASECINEFNGK 254

Query: 283 ELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDD------- 335
            + G KL++    ++ ER  +     +    ++  K     +F+ NL  ++ D       
Sbjct: 255 IIEGTKLFLNYHVERKERERIQWSHIKENNDDEKFKC----IFIGNLPTTLTDLTIDLIL 310

Query: 336 EKLEEEFA---PYGTITS---------AKVMRTENGKSKGFGFVCFSTPEEATKAI 379
           +K++ E +   P   I S            +  ++   KG+GFV   + E+A K I
Sbjct: 311 DKIKTELSEVLPSLQILSYYFPQSKNVNNNINNKSSPLKGYGFVNLGSHEQALKVI 366

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 55/131 (41%), Gaps = 50/131 (38%)

Query: 320 QGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVM----------RTENGK--------- 360
           Q  NL+VK++  S  D++L + F+ +G I S+KV+          + EN K         
Sbjct: 522 QESNLYVKHIPLSWRDDELNDFFSQFGDIISSKVITVGGSKKLDNQNENDKENQEEQEQE 581

Query: 361 ------------------------------SKGFGFVCFSTPEEATKAITEKNQQIVA-G 389
                                         S+G+GFVCF  P +A++AI   +  I++  
Sbjct: 582 HNDKNDQEVEEGGEEEEEEEDEDENLPVGFSRGYGFVCFENPLDASRAIMATDGVIISPN 641

Query: 390 KPLYVAIAQRK 400
             L V+ AQ++
Sbjct: 642 NILNVSFAQKR 652

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/207 (18%), Positives = 76/207 (36%), Gaps = 56/207 (27%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTS---------LGYAYVNFNDHE 90
           +++G +   + E+ +  +F   GS+ SI++  D +  ++         +GY +++F    
Sbjct: 183 IFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLGS 242

Query: 91  AGRKAIEQLNYTPIKGRLC------------RIMWSQRDPSLRKKGSGNIFIKNLHPDID 138
              + I + N   I+G               RI WS    +   +    IFI NL   + 
Sbjct: 243 QASECINEFNGKIIEGTKLFLNYHVERKERERIQWSHIKENNDDEKFKCIFIGNLPTTLT 302

Query: 139 NKALYDTFSVFGDILSSKIATD---------------------------ENGKSKGFGFV 171
           +  +        D++  KI T+                           ++   KG+GFV
Sbjct: 303 DLTI--------DLILDKIKTELSEVLPSLQILSYYFPQSKNVNNNINNKSSPLKGYGFV 354

Query: 172 HFEEEGAAKEAIDALNGMLLNGQEIYV 198
           +      A + I  L+G+   G  + V
Sbjct: 355 NLGSHEQALKVIQTLDGLEWKGNRLVV 381

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 46/120 (38%), Gaps = 49/120 (40%)

Query: 126 GNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT----------DENGK----------- 164
            N+++K++     +  L D FS FGDI+SSK+ T          +EN K           
Sbjct: 524 SNLYVKHIPLSWRDDELNDFFSQFGDIISSKVITVGGSKKLDNQNENDKENQEEQEQEHN 583

Query: 165 ----------------------------SKGFGFVHFEEEGAAKEAIDALNGMLLNGQEI 196
                                       S+G+GFV FE    A  AI A +G++++   I
Sbjct: 584 DKNDQEVEEGGEEEEEEEDEDENLPVGFSRGYGFVCFENPLDASRAIMATDGVIISPNNI 643

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 22/32 (68%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASL 250
           +NLYVK+I     D++  + F++FG I+S+ +
Sbjct: 524 SNLYVKHIPLSWRDDELNDFFSQFGDIISSKV 555

>Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement
          Length = 697

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 88/187 (47%), Gaps = 16/187 (8%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALN 187
           +F++++  D +++   D FS F  I  S I  D   +S+GFGFV F  E   KEA+    
Sbjct: 28  LFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEKQSRGFGFVSFAVEDDTKEALAQAR 87

Query: 188 GMLLNGQ--EIYVAPHLSRKER-------------DSQLEETKAHYTNLYVKNINSETTD 232
                 +   I +A    R +R             +S  EE       L ++N+     D
Sbjct: 88  KAKFKNRLLRIDIAKRRERSKRNEPRQESEHKSYKESNEEELMKGKPKLIIRNMPWSCRD 147

Query: 233 EQ-FQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291
               ++LF++FG +V A + K A GKL GF FV  +K     +A+E   D +++G ++ +
Sbjct: 148 AAVLKKLFSRFGTVVEAKIPKKAGGKLCGFAFVTMKKLSACKRAIEEGKDMKIDGRQVAI 207

Query: 292 GRAQKKN 298
             A +KN
Sbjct: 208 DFAIQKN 214

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 96/188 (51%), Gaps = 8/188 (4%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALN 280
           L+V++I  +  DE+F + F++F PI  + + KD++ + +GFGFV++   +D  +A+    
Sbjct: 28  LFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEKQSRGFGFVSFAVEDDTKEALAQAR 87

Query: 281 DSELNGEKLYVGRAQ-----KKNE-RMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVD 334
            ++     L +  A+     K+NE R     K Y+    E++ K +   L ++N+  S  
Sbjct: 88  KAKFKNRLLRIDIAKRRERSKRNEPRQESEHKSYKESNEEELMKGKP-KLIIRNMPWSCR 146

Query: 335 DEK-LEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLY 393
           D   L++ F+ +GT+  AK+ +   GK  GF FV         +AI E     + G+ + 
Sbjct: 147 DAAVLKKLFSRFGTVVEAKIPKKAGGKLCGFAFVTMKKLSACKRAIEEGKDMKIDGRQVA 206

Query: 394 VAIAQRKD 401
           +  A +K+
Sbjct: 207 IDFAIQKN 214

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 220 NLYVKNINSETTDEQFQELFAKFGPIVSA--SLEKDADGKLKGFGFVNYEKHE 270
           +++V+N+  + T E  +  F KFGP+  A   L+K+  G  KG  FV ++  E
Sbjct: 299 SIFVRNVPYDATQESLESHFGKFGPVKYALPVLDKET-GLAKGTAFVAFKTEE 350

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 254 ADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRA--QKKNERMHVLKKQ 307
           A G+ +G+GFV Y  H+ A+  +  LN  E+  +++  G    +KKN      KK+
Sbjct: 556 AIGRSRGYGFVEYRDHKAALMGLRWLNAHEVTRQEILEGLTDEEKKNLDADAFKKR 611

>YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein with
           similarity to Pab1p, Pub1p, Nsr1p, Nop4p and other
           RNA-binding proteins, contains multiple RNA-binding
           domains, is required for 35S rRNA processing [2664 bp,
           887 aa]
          Length = 887

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 91/174 (52%), Gaps = 11/174 (6%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGK------SKGFGFVHFEEEGAAK 180
           +IFIKNL+    N+ L D F VF   + +++ T  + K      S GFGFV F  +  A 
Sbjct: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723

Query: 181 EAIDALNGMLLNGQEIYVAPHLS-RKERDSQLEETKAHYTN--LYVKNINSETTDEQFQE 237
             I A++G +++G +I +   LS R+   S   +TK++  +  + VKN+  E T +   E
Sbjct: 724 AVIAAMDGTVIDGHKIQL--KLSHRQASQSGNTKTKSNKKSGKIIVKNLPFEATRKDVFE 781

Query: 238 LFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291
           LF  FG + S  + K  D   +GF FV +   ++A  A++ L+   L G +L +
Sbjct: 782 LFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVM 835

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 7/128 (5%)

Query: 78  SLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLR-------KKGSGNIFI 130
           S+G+ +V F   E     I  ++ T I G   ++  S R  S          K SG I +
Sbjct: 708 SMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSGNTKTKSNKKSGKIIV 767

Query: 131 KNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGML 190
           KNL  +   K +++ F+ FG + S ++    +  ++GF FV F     A+ A+D L+G+ 
Sbjct: 768 KNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVH 827

Query: 191 LNGQEIYV 198
           L G+ + +
Sbjct: 828 LLGRRLVM 835

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 86/182 (47%), Gaps = 15/182 (8%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKG------FGFVNYEKHEDA 272
            ++++KN+N  TT++   + F  F   V A ++   D K +G      FGFV +   E A
Sbjct: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722

Query: 273 VKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDS 332
              + A++ + ++G K+ +  + ++  +    K         K  K  G  + VKNL   
Sbjct: 723 NAVIAAMDGTVIDGHKIQLKLSHRQASQSGNTKT--------KSNKKSG-KIIVKNLPFE 773

Query: 333 VDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392
              + + E F  +G + S +V +  +  ++GF FV F  P+EA  A+ + +   + G+ L
Sbjct: 774 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833

Query: 393 YV 394
            +
Sbjct: 834 VM 835

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 53/103 (51%), Gaps = 3/103 (2%)

Query: 303 VLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKS 361
           V +K  E   +EK+   Q   LF++N+  +  +E   + F+P+G +    V + T  G+S
Sbjct: 328 VPQKTDEELAIEKIN--QTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQS 385

Query: 362 KGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRR 404
           KGF +V F   + A  A  E ++QI  G+ L++   + K   R
Sbjct: 386 KGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHILPGEEKKSHR 428

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++ ++  +  E     +FSP G +  + V  D  T  S G+AYV F D +    A  +L
Sbjct: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406

Query: 100 NYTPIKGRLCRIMWSQRDPSLR 121
           +    +GRL  I+  +   S R
Sbjct: 407 DKQIFQGRLLHILPGEEKKSHR 428

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 322 VNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGK------SKGFGFVCFSTPEEA 375
           V++F+KNL+ S  ++ L + F  +     A+V    + K      S GFGFV F T E+A
Sbjct: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722

Query: 376 TKAITEKNQQIVAGKPLYVAIAQRK 400
              I   +  ++ G  + + ++ R+
Sbjct: 723 NAVIAAMDGTVIDGHKIQLKLSHRQ 747

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 15/92 (16%)

Query: 219 TNLYVKNINSETTDEQFQELFAK-------------FGP--IVSASLEKDADGKLKGFGF 263
           + + VK +    TD+  +E F K              GP  I    + +D +G+ + FGF
Sbjct: 2   SRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFGF 61

Query: 264 VNYEKHEDAVKAVEALNDSELNGEKLYVGRAQ 295
           + Y   EDA  AVE  N S +N  K+ V  A+
Sbjct: 62  IGYRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 125 SGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAI 183
           +G +F++N+      +     FS FG++    +A D   G+SKGF +V F++   A  A 
Sbjct: 344 TGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAY 403

Query: 184 DALNGMLLNGQEIYVAP 200
             L+  +  G+ +++ P
Sbjct: 404 VELDKQIFQGRLLHILP 420

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%)

Query: 152 ILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVA 199
           I   KI  D NG+S+ FGF+ +  E  A +A++  NG  +N  +I V+
Sbjct: 43  ITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVS 90

 Score = 36.2 bits (82), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%)

Query: 348 ITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398
           IT  K++R  NG+S+ FGF+ +   E+A  A+   N   +    + V++A+
Sbjct: 43  ITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           + V +L    +   ++++F+  G + S+RV +    K++ G+A+V F   +    A++QL
Sbjct: 765 IIVKNLPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQL 823

Query: 100 NYTPIKGR 107
           +   + GR
Sbjct: 824 HGVHLLGR 831

>YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylated
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           [1605 bp, 534 aa]
          Length = 534

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 89/178 (50%), Gaps = 13/178 (7%)

Query: 123 KGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKE 181
           K S  +FI  L+ D     L + F  +G +   KI  D   G+S+GFGF+ FE+  +  E
Sbjct: 156 KESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDE 215

Query: 182 AIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAK 241
            +   +  +L+G+ I     + R E+D   +        ++V  I  +   ++F+E F++
Sbjct: 216 VVKTQH--ILDGKVIDPKRAIPRDEQDKTGK--------IFVGGIGPDVRPKEFEEFFSQ 265

Query: 242 FGPIVSASLEKDAD-GKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKN 298
           +G I+ A L  D D G+ +GFGFV Y+   DAV  V      +    K+ + RA+ ++
Sbjct: 266 WGTIIDAQLMLDKDTGQSRGFGFVTYDS-ADAVDRVCQNKFIDFKDRKIEIKRAEPRH 322

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 85/164 (51%), Gaps = 22/164 (13%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEAL 279
           +++  +N +TT++  +E F K+G +    + KD A G+ +GFGF+++EK     + V+  
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 220

Query: 280 NDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLE 339
           +   L+G+ +   RA  ++E+             +K  K     +FV  +   V  ++ E
Sbjct: 221 H--ILDGKVIDPKRAIPRDEQ-------------DKTGK-----IFVGGIGPDVRPKEFE 260

Query: 340 EEFAPYGTITSAKVM-RTENGKSKGFGFVCFSTPEEATKAITEK 382
           E F+ +GTI  A++M   + G+S+GFGFV + + +   +    K
Sbjct: 261 EFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNK 304

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 76/141 (53%), Gaps = 5/141 (3%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +++G L    +E +L + F   G+V+ +++ +D  T  S G+ +++F    +  + ++  
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 220

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT 159
           +   + G++  I   +  P   +  +G IF+  + PD+  K   + FS +G I+ +++  
Sbjct: 221 HI--LDGKV--IDPKRAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLML 276

Query: 160 DEN-GKSKGFGFVHFEEEGAA 179
           D++ G+S+GFGFV ++   A 
Sbjct: 277 DKDTGQSRGFGFVTYDSADAV 297

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 320 QGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRT-ENGKSKGFGFVCFSTPEEATKA 378
           +   +F+  L+    ++ L E F  YGT+T  K+M+    G+S+GFGF+ F  P    + 
Sbjct: 157 ESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEV 216

Query: 379 ITEKNQQIVAGK 390
           +  K Q I+ GK
Sbjct: 217 V--KTQHILDGK 226

>KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces
           cerevisiae YPL043w NOP4 nucleolar protein, start by
           similarity
          Length = 685

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 93/198 (46%), Gaps = 18/198 (9%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALN 280
           L+V+ +  E+TDE+F   F++F PI  A + KD +G  +GFGFV++   +D   A+    
Sbjct: 17  LFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGEGASRGFGFVSFAVEDDTKTALNQAR 76

Query: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEA--------YRLEKMAKYQGVN--------L 324
            ++  G  L +  A K+ ER    K   E          + E+ +K +  N        L
Sbjct: 77  KTKFMGRLLRIDIA-KRRERSRGKKDADEVSSAPSVDNVKDEEESKPEDDNDLMKGKPKL 135

Query: 325 FVKNLDDSVDD-EKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKN 383
            ++N+  S  D  KL++ F  YGT+  A + R  +G+  GF FV  +       AI    
Sbjct: 136 IIRNMPWSCRDPTKLKKIFGLYGTVVEATIPRKRDGRLCGFAFVTMNRISNCKAAIEGTK 195

Query: 384 QQIVAGKPLYVAIAQRKD 401
              + G+ + V  A +K+
Sbjct: 196 DLKIDGRKVAVDFAIQKN 213

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 91/200 (45%), Gaps = 32/200 (16%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAID--- 184
           +F++ +  +  ++   + FS F  I  + I  D  G S+GFGFV F  E   K A++   
Sbjct: 17  LFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGEGASRGFGFVSFAVEDDTKTALNQAR 76

Query: 185 --ALNGMLL---------------NGQEIYVAPHL--------SRKERDSQLEETKAHYT 219
                G LL               +  E+  AP +        S+ E D+ L + K    
Sbjct: 77  KTKFMGRLLRIDIAKRRERSRGKKDADEVSSAPSVDNVKDEEESKPEDDNDLMKGKPK-- 134

Query: 220 NLYVKNINSETTD-EQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEA 278
            L ++N+     D  + +++F  +G +V A++ +  DG+L GF FV   +  +   A+E 
Sbjct: 135 -LIIRNMPWSCRDPTKLKKIFGLYGTVVEATIPRKRDGRLCGFAFVTMNRISNCKAAIEG 193

Query: 279 LNDSELNGEKLYVGRAQKKN 298
             D +++G K+ V  A +KN
Sbjct: 194 TKDLKIDGRKVAVDFAIQKN 213

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 52/96 (54%), Gaps = 3/96 (3%)

Query: 314 EKMAKYQGVNL---FVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFS 370
           +K+ K +G++L   FV+ +     DE+    F+ +  I  A +++   G S+GFGFV F+
Sbjct: 4   KKVIKDEGLDLKTLFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGEGASRGFGFVSFA 63

Query: 371 TPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQ 406
             ++   A+ +  +    G+ L + IA+R++  R +
Sbjct: 64  VEDDTKTALNQARKTKFMGRLLRIDIAKRRERSRGK 99

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 67/178 (37%), Gaps = 36/178 (20%)

Query: 53  HLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIM 112
           + +  FSPI     ++    A    S G+ +V+F   +  + A+ Q   T   GRL RI 
Sbjct: 33  NFFSQFSPIKHAVIVKDGEGA----SRGFGFVSFAVEDDTKTALNQARKTKFMGRLLRID 88

Query: 113 WSQRDPSLR-------------------------------KKGSGNIFIKNLHPDI-DNK 140
            ++R    R                                KG   + I+N+     D  
Sbjct: 89  IAKRRERSRGKKDADEVSSAPSVDNVKDEEESKPEDDNDLMKGKPKLIIRNMPWSCRDPT 148

Query: 141 ALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
            L   F ++G ++ + I    +G+  GF FV        K AI+    + ++G+++ V
Sbjct: 149 KLKKIFGLYGTVVEATIPRKRDGRLCGFAFVTMNRISNCKAAIEGTKDLKIDGRKVAV 206

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAID 184
           +IF++N+  D   ++L   F VFG +  +    D E G +KG  FV F  E A  + ++
Sbjct: 297 SIFVRNVPYDATQESLERHFGVFGPVKYALPVIDKETGLAKGTAFVAFRSEDAYNDCLN 355

>CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces
           cerevisiae YCL011c GBP2 or sp|P38922 Saccharomyces
           cerevisiae YNL004w HRB1, hypothetical start
          Length = 419

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 80/176 (45%), Gaps = 12/176 (6%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDAL 186
           +IFI NL  D   + L+D F   G++L + I T   G+ +G G V F        AI   
Sbjct: 120 SIFIGNLSFDATPEDLHDFFGQAGEVLRADIIT-SRGRHRGMGTVEFTSPEGVDNAIRDF 178

Query: 187 NGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTN-----------LYVKNINSETTDEQF 235
           NG+   G+ ++V       E    L   +  + +           +++ N+    T +  
Sbjct: 179 NGVEFMGRPLFVRQDNPPPEPMESLPPMRERFNDYPPEGRPPMFEVFIVNLPYSMTWQTL 238

Query: 236 QELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291
           ++LF + G ++ A +E D +G  +GFG V Y   E+   A+E  N  +++G  L V
Sbjct: 239 KDLFREAGDVIRADIELDRNGFSRGFGTVFYGTQEEMFNAIERFNGFDVDGRILQV 294

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 87/197 (44%), Gaps = 3/197 (1%)

Query: 200 PHLSRKERDSQLEETKAHYTN-LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKL 258
           P ++R+      E+   +Y N +++ N++ + T E   + F + G ++ A +   + G+ 
Sbjct: 99  PMMAREMEPPYEEKIDRNYDNSIFIGNLSFDATPEDLHDFFGQAGEVLRADIIT-SRGRH 157

Query: 259 KGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYR-LEKMA 317
           +G G V +   E    A+   N  E  G  L+V +     E M  L    E +       
Sbjct: 158 RGMGTVEFTSPEGVDNAIRDFNGVEFMGRPLFVRQDNPPPEPMESLPPMRERFNDYPPEG 217

Query: 318 KYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATK 377
           +     +F+ NL  S+  + L++ F   G +  A +    NG S+GFG V + T EE   
Sbjct: 218 RPPMFEVFIVNLPYSMTWQTLKDLFREAGDVIRADIELDRNGFSRGFGTVFYGTQEEMFN 277

Query: 378 AITEKNQQIVAGKPLYV 394
           AI   N   V G+ L V
Sbjct: 278 AIERFNGFDVDGRILQV 294

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 70/304 (23%), Positives = 112/304 (36%), Gaps = 55/304 (18%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSL--GYAYVNFNDHEAGRKAIE 97
           +++G+L    +   L+D F   G V    +  D IT      G   V F   E    AI 
Sbjct: 121 IFIGNLSFDATPEDLHDFFGQAGEV----LRADIITSRGRHRGMGTVEFTSPEGVDNAIR 176

Query: 98  QLNYTPIKGRLCRIMWSQRD----------PSLRKKGSG----------NIFIKNLHPDI 137
             N     GR    ++ ++D          P +R++ +            +FI NL   +
Sbjct: 177 DFNGVEFMGR---PLFVRQDNPPPEPMESLPPMRERFNDYPPEGRPPMFEVFIVNLPYSM 233

Query: 138 DNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQ--- 194
             + L D F   GD++ + I  D NG S+GFG V +  +     AI+  NG  ++G+   
Sbjct: 234 TWQTLKDLFREAGDVIRADIELDRNGFSRGFGTVFYGTQEEMFNAIERFNGFDVDGRILQ 293

Query: 195 -----------------------EIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETT 231
                                  EI + P     +    +       T +Y  N+   T 
Sbjct: 294 VREGKNSTGYQAPYQAPPPPQEQEIEMEPPTGPSQFTENVVGGGERSTLIYCSNLPLTTA 353

Query: 232 DEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291
                +LF   G +  A L+ D  G   G   + YE  EDA   ++ LN+    G  L +
Sbjct: 354 TGDLYDLFETIGRVRHAELKFDESGAPTGIAVIEYENVEDADFCIQRLNNYNYGGCDLDI 413

Query: 292 GRAQ 295
             A+
Sbjct: 414 SYAK 417

>YOR319W (HSH49) [5101] chr15 (912817..913458) U2 snRNP protein and
           pre-mRNA splicing factor with similarity to human SAP49,
           has 2 RNA recognition (RRM) domains [642 bp, 213 aa]
          Length = 213

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 85/171 (49%), Gaps = 13/171 (7%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +YVG+++P +++  LY++F  I  V  I+  +D + +   GYA++ F +    + AI+ +
Sbjct: 11  VYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIM 70

Query: 100 NYTP-IKGRLCRI------MWSQRDPSLRKKGS----GNIFIKNLHPDIDNKALYDTFSV 148
           N T  +  RL ++        +   PS   K        +FIKNL   ID+  L   F+ 
Sbjct: 71  NNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAKLFIKNLADSIDSDQLVKIFNK 130

Query: 149 FGDILSS-KIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
           FG ++   +I    NGK K   +V+FE+   A  AI +LN  L+    I V
Sbjct: 131 FGKLIREPEIFYLSNGKLKC-AYVYFEDFEKADLAIKSLNNQLVANNRITV 180

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 83/179 (46%), Gaps = 8/179 (4%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEAL 279
           +YV NI+   T EQ  ELF +  P++     KD      +G+ F+ +    DA  A++ +
Sbjct: 11  VYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIM 70

Query: 280 NDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLE 339
           N++    ++L   R    +     L        +  +AK     LF+KNL DS+D ++L 
Sbjct: 71  NNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAK-----LFIKNLADSIDSDQLV 125

Query: 340 EEFAPYG-TITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIA 397
           + F  +G  I   ++    NGK K   +V F   E+A  AI   N Q+VA   + V  A
Sbjct: 126 KIFNKFGKLIREPEIFYLSNGKLKC-AYVYFEDFEKADLAIKSLNNQLVANNRITVDYA 183

>KLLA0A05346g 485886..488510 some similarities with sp|P53316
           Saccharomyces cerevisiae YGR250c singleton, hypothetical
           start
          Length = 874

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 82/317 (25%), Positives = 136/317 (42%), Gaps = 40/317 (12%)

Query: 113 WSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDEN-GKSKGFGFV 171
           WS  +        GN++++ +  ++  + L   F+ FG IL  KI  D N  +S GFGFV
Sbjct: 178 WSISENPHALNHPGNLYVRGIPKNLTKEDLVPIFAKFGPILVLKIILDSNTNESMGFGFV 237

Query: 172 HFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKER----------DSQLEETKAHYTNL 221
            +     A   I  LNG L+NG  ++V  H+ RKER          + Q E TK  +  +
Sbjct: 238 SYALGSQASNCIKELNGNLMNGSPLFVNYHVERKERERIHFDQWKQNEQEESTK--FKGV 295

Query: 222 YVKNINSETTDEQFQELFAKFGPIVSASLEKDA--DGKLKGFGF--------VNYEKHED 271
           +V N+   TT+ +         P +     K A  D ++  + F        V Y + ++
Sbjct: 296 FVGNLPIFTTENKL------LTPSIVLEKFKKALPDCEMVSYFFPKTNSQTNVEYSETDE 349

Query: 272 AVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQ---GVNLFVKN 328
             K+   L+   LN E   V      +E      ++ E  +L+ + K+      ++ +KN
Sbjct: 350 DSKSESPLH---LNAESFPVKSKHNSDETNKRNNEKIEDPQLKTIEKHHDNGDEDIVMKN 406

Query: 329 LDDSVDDEKLEEEFAPYGTITSA---KVMRTENGKS--KGFGFVCFSTPEEATKAITEKN 383
              +  D ++ +  +     T A   +   ++N +S  KG+GF  F+T E A K I   N
Sbjct: 407 DATTSSDTEVPKSSSSSDDETEATNEETCSSQNEESPLKGYGFFRFATHEMALKCIETFN 466

Query: 384 QQIVAGKPLYVAIAQRK 400
                G  L V  A +K
Sbjct: 467 DSQWYGHQLVVNKAIQK 483

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 134/311 (43%), Gaps = 62/311 (19%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           LYV  +  ++++  L  IF+  G +  +++  D+ T  S+G+ +V++         I++L
Sbjct: 193 LYVRGIPKNLTKEDLVPIFAKFGPILVLKIILDSNTNESMGFGFVSYALGSQASNCIKEL 252

Query: 100 NYTPIKG---------------RLCRIMWSQ--RDPSLRKKG--SGNIFI-----KNLHP 135
           N   + G               R+    W Q  ++ S + KG   GN+ I     K L P
Sbjct: 253 NGNLMNGSPLFVNYHVERKERERIHFDQWKQNEQEESTKFKGVFVGNLPIFTTENKLLTP 312

Query: 136 DID----NKALYDT--FSVFGDILSSKI-----ATDENGKSKGFGFVHFEEEG---AAKE 181
            I      KAL D    S F    +S+       TDE+ KS+    +H   E     +K 
Sbjct: 313 SIVLEKFKKALPDCEMVSYFFPKTNSQTNVEYSETDEDSKSE--SPLHLNAESFPVKSKH 370

Query: 182 AIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTN----LYVKNINSETTDEQFQE 237
             D  N    N ++I           D QL+  + H+ N    + +KN  + ++D +  +
Sbjct: 371 NSDETNKR--NNEKI----------EDPQLKTIEKHHDNGDEDIVMKNDATTSSDTEVPK 418

Query: 238 LFAKFGPIVSASLE-----KDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVG 292
             +       A+ E     ++ +  LKG+GF  +  HE A+K +E  NDS+  G +L V 
Sbjct: 419 SSSSSDDETEATNEETCSSQNEESPLKGYGFFRFATHEMALKCIETFNDSQWYGHQLVVN 478

Query: 293 RA-QKKNERMH 302
           +A QK ++  H
Sbjct: 479 KAIQKFHQHQH 489

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 51/98 (52%), Gaps = 17/98 (17%)

Query: 320 QGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTEN----------------GKSKG 363
           Q  NL+VK+L     DE L + F  +G I SAK++                    GKSKG
Sbjct: 728 QESNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKG 787

Query: 364 FGFVCFSTPEEATKAITEKN-QQIVAGKPLYVAIAQRK 400
           +GFVCF  P +A++A+   +  ++ +   L+V+ AQR+
Sbjct: 788 YGFVCFQNPLDASRAMYHTDGLKLNSDNTLFVSFAQRR 825

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 56/104 (53%), Gaps = 17/104 (16%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASL---------EKDAD-------GKLKGFG 262
           +NLYVK++  +  DE   + F KFG I+SA +         + D D       GK KG+G
Sbjct: 730 SNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKGYG 789

Query: 263 FVNYEKHEDAVKAVEALNDSELNGEK-LYVGRAQKKNERMHVLK 305
           FV ++   DA +A+   +  +LN +  L+V  AQ++++ +  +K
Sbjct: 790 FVCFQNPLDASRAMYHTDGLKLNSDNTLFVSFAQRRSKSIDSIK 833

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 48/98 (48%), Gaps = 16/98 (16%)

Query: 126 GNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT---------DEN-------GKSKGFG 169
            N+++K+L  D  ++ LY  F  FG+I+S+KI T         D++       GKSKG+G
Sbjct: 730 SNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKGYG 789

Query: 170 FVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKER 207
           FV F+    A  A+   +G+ LN           R+ +
Sbjct: 790 FVCFQNPLDASRAMYHTDGLKLNSDNTLFVSFAQRRSK 827

>AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C
           (GBP2) - SH] complement(309542..310555) [1014 bp, 337
           aa]
          Length = 337

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 79/180 (43%), Gaps = 9/180 (5%)

Query: 120 LRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAA 179
           + +  S ++FI NL  D   + L   F   G ++ + I T   G  +G G V +      
Sbjct: 1   MSRNYSNSVFIGNLTYDTTPEDLRQLFGEVGHVVRADIITSR-GHHRGMGTVEYTNAQDV 59

Query: 180 KEAIDALNGMLLNGQEIYV-----APHLSRKERDSQ---LEETKAHYTNLYVKNINSETT 231
            EAI   NGM    +E++V      P   R+ER         T      ++V N+    +
Sbjct: 60  DEAIRRFNGMDFMHRELFVRRDNPPPVGERRERRGPGPLPRRTHPGGFEIFVANLPYSIS 119

Query: 232 DEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291
            +  +++F +   ++ A +  DADG  +GFG V     E+ + A+E  N  EL G  L V
Sbjct: 120 WQTLKDMFKECSEVIHADVSVDADGYSRGFGTVYVTTRENQIAAIERWNGYELEGRILEV 179

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 87/189 (46%), Gaps = 8/189 (4%)

Query: 217 HYTN-LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKA 275
           +Y+N +++ N+  +TT E  ++LF + G +V A +   + G  +G G V Y   +D  +A
Sbjct: 4   NYSNSVFIGNLTYDTTPEDLRQLFGEVGHVVRADI-ITSRGHHRGMGTVEYTNAQDVDEA 62

Query: 276 VEALNDSELNGEKLYVGRAQKK--NERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSV 333
           +   N  +    +L+V R       ER    +++     L +     G  +FV NL  S+
Sbjct: 63  IRRFNGMDFMHRELFVRRDNPPPVGER----RERRGPGPLPRRTHPGGFEIFVANLPYSI 118

Query: 334 DDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLY 393
             + L++ F     +  A V    +G S+GFG V  +T E    AI   N   + G+ L 
Sbjct: 119 SWQTLKDMFKECSEVIHADVSVDADGYSRGFGTVYVTTRENQIAAIERWNGYELEGRILE 178

Query: 394 VAIAQRKDV 402
           V   +  DV
Sbjct: 179 VREGKGTDV 187

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 72/178 (40%), Gaps = 26/178 (14%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTS--LGYAYVNFNDHEAGRKAIE 97
           +++G+L    +   L  +F  +G V    V  D IT      G   V + + +   +AI 
Sbjct: 9   VFIGNLTYDTTPEDLRQLFGEVGHV----VRADIITSRGHHRGMGTVEYTNAQDVDEAIR 64

Query: 98  QLNYTPIKGRLCRIMWSQRD-----------------PSLRKKGSGNIFIKNLHPDIDNK 140
           + N       + R ++ +RD                 P     G   IF+ NL   I  +
Sbjct: 65  RFNGMDF---MHRELFVRRDNPPPVGERRERRGPGPLPRRTHPGGFEIFVANLPYSISWQ 121

Query: 141 ALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
            L D F    +++ + ++ D +G S+GFG V+         AI+  NG  L G+ + V
Sbjct: 122 TLKDMFKECSEVIHADVSVDADGYSRGFGTVYVTTRENQIAAIERWNGYELEGRILEV 179

 Score = 35.8 bits (81), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 29/69 (42%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALN 187
           I+ +N+        LYD F   G +L + +  D  G   G     FE    A+E I+ LN
Sbjct: 261 IYCENMPLATAESDLYDLFETAGKVLRANLQYDSEGNPTGSSVCEFETVADAQECIERLN 320

Query: 188 GMLLNGQEI 196
                G ++
Sbjct: 321 NYHYGGCDL 329

>Scas_665.4
          Length = 219

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 84/175 (48%), Gaps = 17/175 (9%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +YVG+++P V++  LY++F  +  +S +R  +D I +   GYA++ F   +  +  I+ +
Sbjct: 12  VYVGNIDPKVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEFYTAKDVQYVIQVM 71

Query: 100 NYT-PIKGRLCRIMWSQRDPSLRKKGSGN--------------IFIKNLHPDIDNKALYD 144
           N T  +  R  ++  S ++P+    G+                +F+KNL   I+N  L  
Sbjct: 72  NNTVALYDRFLKVRQSVQNPTSSMGGANTSENSNQSIVLPIAKLFVKNLDESIENPQLIK 131

Query: 145 TFSVFGDILSS-KIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
            F  FG +    +I    NGK +   +++F+    +  AI  LN  L+  + I V
Sbjct: 132 LFQKFGPLFKDPEIFFLSNGKLRC-AYIYFKFYENSDMAIAKLNNELIVNKRINV 185

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 90/189 (47%), Gaps = 12/189 (6%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKL-KGFGFVNYEKHEDAVKAVE 277
           T +YV NI+ + T EQ  ELF +  PI      KD   ++ +G+ F+ +   +D    ++
Sbjct: 10  TTVYVGNIDPKVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEFYTAKDVQYVIQ 69

Query: 278 ALNDSELNGEKLYVGRAQKKNERMHV----LKKQYEAYRLEKMAKYQGVNLFVKNLDDSV 333
            +N++    ++    R   +N    +      +      +  +AK     LFVKNLD+S+
Sbjct: 70  VMNNTVALYDRFLKVRQSVQNPTSSMGGANTSENSNQSIVLPIAK-----LFVKNLDESI 124

Query: 334 DDEKLEEEFAPYGTI-TSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392
           ++ +L + F  +G +    ++    NGK +   ++ F   E +  AI + N +++  K +
Sbjct: 125 ENPQLIKLFQKFGPLFKDPEIFFLSNGKLRC-AYIYFKFYENSDMAIAKLNNELIVNKRI 183

Query: 393 YVAIAQRKD 401
            V  A +++
Sbjct: 184 NVDYAFKEN 192

>KLLA0F18216g 1677731..1679857 some similarities with sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation
           singleton, hypothetical start
          Length = 708

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/316 (24%), Positives = 140/316 (44%), Gaps = 39/316 (12%)

Query: 114 SQRDPSLRKKGSGNIFIKNLHPDID----NKALYDTFSVFGDILSSKIATDENGKSKGFG 169
           S  DPS  +  S  IF+ +L   +     N ++   F+ +G I+S K+  D    ++ + 
Sbjct: 109 SSDDPSFSRPSSC-IFVASLAATLSDSELNASVTKEFAKYGKIVSVKVLRDP--ANRPYA 165

Query: 170 FVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSE 229
           FV +  +  A  A+    G  LN + I       R ER +++  T    ++ +   +  +
Sbjct: 166 FVQYASDDEALNALSQAQGTTLNNRNI-------RCER-AKVNRT-VFISSSFANPLEGK 216

Query: 230 TTDEQFQELFAKFGPIVSASLEKDA-------DGKLKGFGFVNYEKHEDAVKAVEALNDS 282
            T E+  +L +KFG +      +D          ++    F+ Y   +DA++A   +   
Sbjct: 217 LTVEKVVDLMSKFGELEQVVPSRDQMYKKNYYPSEVANSWFIQYAYRDDAIRAYLQM--- 273

Query: 283 ELNGEKLYVGRAQKKN--ERMHVL--------KKQYEAYRLEKMAKY-QGVNLFVKNLDD 331
           +LN E + V  AQ  +   R ++L        K++ E  R  K   +    ++F+  L+ 
Sbjct: 274 KLNYEYM-VEWAQNVDVPPRFNLLLSKAKICEKERLERERFGKQPIFIDNKSIFIGQLNF 332

Query: 332 SVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKP 391
            V    L E F+ YG I +  ++  +  + K F F+ + TP  A KA+  +N  I   K 
Sbjct: 333 KVTKPLLLERFSKYGEIDNCNLIHKQE-QLKCFAFIKYKTPASAAKALERENHSIFVEKI 391

Query: 392 LYVAIAQRKDVRRSQL 407
           L+V I +  + RRS +
Sbjct: 392 LHVQIREVSNSRRSSI 407

>Scas_598.1
          Length = 516

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 102/210 (48%), Gaps = 34/210 (16%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEAL 279
           L++  +N ETT+++ ++ F+K+G +V   + KD A G+ +GFGF+ +E      + V+  
Sbjct: 202 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFELSSSVDEVVKTQ 261

Query: 280 NDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLE 339
           +   L+G+ +   RA  + E+             +K  K     +FV  +   V  ++ E
Sbjct: 262 H--ILDGKVIDPKRAIPREEQ-------------DKTGK-----IFVGGIGPDVRPKEFE 301

Query: 340 EEFAPYGTITSAKVM----RTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVA 395
           E FA +GTI  A++M      + G+S+GFGF+ + +  EA   + +       GK + + 
Sbjct: 302 EFFAQWGTIIDAQLMLLMLDKDTGRSRGFGFITYDS-SEAVDRVCQNKYIDFKGKQIEIK 360

Query: 396 IAQRKDVRRS--------QLAQQIQARNQM 417
            A  + +++         Q   Q+QA  QM
Sbjct: 361 RAAPRHMQKGANNGRNPRQFQNQMQAPPQM 390

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 77/151 (50%), Gaps = 12/151 (7%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++G L    +E  L D FS  G+V  +++ +D  T  S G+ ++ F    +  + ++  
Sbjct: 202 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFELSSSVDEVVKTQ 261

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIA- 158
           +   + G++  I   +  P   +  +G IF+  + PD+  K   + F+ +G I+ +++  
Sbjct: 262 HI--LDGKV--IDPKRAIPREEQDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQLML 317

Query: 159 ---TDENGKSKGFGFVHFEEEGAAKEAIDAL 186
                + G+S+GFGF+ ++    + EA+D +
Sbjct: 318 LMLDKDTGRSRGFGFITYD----SSEAVDRV 344

>Kwal_27.11832
          Length = 686

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 89/192 (46%), Gaps = 13/192 (6%)

Query: 220 NLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEAL 279
            L+V++I  + TDE+    F+   PI  A + KD     +GFGFV++   +D   A++  
Sbjct: 22  TLFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDALDKA 81

Query: 280 NDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGV---------NLFVKNLD 330
             ++  G  L V  A++++      K Q  A   E  +  Q            L V+N+ 
Sbjct: 82  RKTKFKGRLLRVDIAKRRD---RTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIVRNMP 138

Query: 331 DSVDD-EKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAG 389
            SV + ++L++ F  YGT+  AK+ +  +GK  GF FV          AI E     + G
Sbjct: 139 WSVRNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKSLKIGG 198

Query: 390 KPLYVAIAQRKD 401
           + + V  A +K+
Sbjct: 199 RQVAVDFAVQKN 210

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 88/190 (46%), Gaps = 17/190 (8%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDAL 186
            +F++++  D  ++ L + FS    I  + I  D+   S+GFGFV F  E   K+A+D  
Sbjct: 22  TLFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDALDKA 81

Query: 187 NGMLLNGQ--EIYVAPHLSRKERD--------------SQLEETKAHYTNLYVKNIN-SE 229
                 G+   + +A    R ++D               + +E       L V+N+  S 
Sbjct: 82  RKTKFKGRLLRVDIAKRRDRTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIVRNMPWSV 141

Query: 230 TTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKL 289
              ++ +++F ++G +V A + K  DGKL GF FV  +K      A+E     ++ G ++
Sbjct: 142 RNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKSLKIGGRQV 201

Query: 290 YVGRAQKKNE 299
            V  A +KN+
Sbjct: 202 AVDFAVQKNK 211

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 79/182 (43%), Gaps = 24/182 (13%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+V  +    ++  L + FS +  +    + +D   K S G+ +V+F   +  + A+++ 
Sbjct: 23  LFVRSIPFDATDEELANYFSNLAPIKHAVIVKDD-QKNSRGFGFVSFAVEDDTKDALDKA 81

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKK----------------------GSGNIFIKNLHPDI 137
             T  KGRL R+  ++R    +K                       G   + ++N+   +
Sbjct: 82  RKTKFKGRLLRVDIAKRRDRTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIVRNMPWSV 141

Query: 138 DN-KALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEI 196
            N   L   F  +G ++ +KI    +GK  GF FV  ++  + K AI+    + + G+++
Sbjct: 142 RNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKSLKIGGRQV 201

Query: 197 YV 198
            V
Sbjct: 202 AV 203

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 318 KYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSA-KVMRTENGKSKGFGFVCFSTPE 373
           K + + +FV+N+      E LEE F  +G +  A  V   E G +KG  FV F T E
Sbjct: 287 KKEQLAVFVRNVPYDATQESLEEHFNKFGPVKYALPVQDKETGLAKGSAFVVFQTQE 343

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDAD-GKLKGFGFVNYEKHE 270
           ++V+N+  + T E  +E F KFGP+  A   +D + G  KG  FV ++  E
Sbjct: 293 VFVRNVPYDATQESLEEHFNKFGPVKYALPVQDKETGLAKGSAFVVFQTQE 343

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 47/103 (45%), Gaps = 16/103 (15%)

Query: 118 PSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEE 176
           P   KK    +F++N+  D   ++L + F+ FG +  +    D E G +KG  FV F+ +
Sbjct: 283 PKPNKKEQLAVFVRNVPYDATQESLEEHFNKFGPVKYALPVQDKETGLAKGSAFVVFQTQ 342

Query: 177 GAAKEAID-----ALNGMLL----------NGQEIYVAPHLSR 204
            A  E ++         +L+          +G+ + +AP L R
Sbjct: 343 EAFDECVNNAPASGTTSLLISDDVPYRYVYDGRILSIAPALDR 385

>CAGL0H03861g complement(361189..362520) similar to sp|P38922
           Saccharomyces cerevisiae YNL004w HRB1, start by
           similarity
          Length = 443

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 88/203 (43%), Gaps = 19/203 (9%)

Query: 107 RLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSK 166
           RL R + S  +  + +  + +IF+ NL  D   + L D FS  G ++ + I T   G  +
Sbjct: 88  RLARELDSTYEEKVNRNYTNSIFVGNLTYDCTPEDLKDFFSQVGKVVRADIIT-SRGHHR 146

Query: 167 GFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETK--AHYTN---- 220
           G G V F       EAI   +G  L  ++I+V       E  S         H TN    
Sbjct: 147 GMGTVEFTSGEEVDEAIRKFDGAYLMNRQIFVRQDNPPPESSSTHSSGSNSGHTTNVTKP 206

Query: 221 ------------LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEK 268
                       L + N+    + +  + +F +FG ++ A++E D+ G   G G V ++ 
Sbjct: 207 KKAVKPQKKGYELMILNLPYSISWQTLKTMFKEFGDVLKANVEVDSTGMSIGVGNVIFKN 266

Query: 269 HEDAVKAVEALNDSELNGEKLYV 291
            ED VKA E  N  E+ G+ L V
Sbjct: 267 QEDMVKAYEHFNGFEIEGKVLEV 289

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 72/188 (38%), Gaps = 36/188 (19%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTS--LGYAYVNFNDHEAGRKAIE 97
           ++VG+L    +   L D FS +G V    V  D IT      G   V F   E   +AI 
Sbjct: 109 IFVGNLTYDCTPEDLKDFFSQVGKV----VRADIITSRGHHRGMGTVEFTSGEEVDEAIR 164

Query: 98  QLNYTPIKGRLCRIMWSQRDP---------------------------SLRKKGSGNIFI 130
           + +   +  R  +I   Q +P                             +KKG   + I
Sbjct: 165 KFDGAYLMNR--QIFVRQDNPPPESSSTHSSGSNSGHTTNVTKPKKAVKPQKKGY-ELMI 221

Query: 131 KNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGML 190
            NL   I  + L   F  FGD+L + +  D  G S G G V F+ +    +A +  NG  
Sbjct: 222 LNLPYSISWQTLKTMFKEFGDVLKANVEVDSTGMSIGVGNVIFKNQEDMVKAYEHFNGFE 281

Query: 191 LNGQEIYV 198
           + G+ + V
Sbjct: 282 IEGKVLEV 289

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 47/91 (51%), Gaps = 1/91 (1%)

Query: 304 LKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKG 363
           L ++ ++   EK+ +    ++FV NL      E L++ F+  G +  A ++ T  G  +G
Sbjct: 89  LARELDSTYEEKVNRNYTNSIFVGNLTYDCTPEDLKDFFSQVGKVVRADII-TSRGHHRG 147

Query: 364 FGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
            G V F++ EE  +AI + +   +  + ++V
Sbjct: 148 MGTVEFTSGEEVDEAIRKFDGAYLMNRQIFV 178

>ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH]
           (768392..770908) [2517 bp, 838 aa]
          Length = 838

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 87/184 (47%), Gaps = 15/184 (8%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGK------SKGFGFVHFEEEGAAK 180
           +IF+KNL+    +  L + F  F   + +++ T  + K      S GFGF+ F  +  A 
Sbjct: 613 SIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQAG 672

Query: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLY-----VKNINSETTDEQF 235
             I A++G +++G +I     L    + S L +T             VKN+  E T +  
Sbjct: 673 AVIAAMDGAVIDGHKI----QLKISHKQSSLPKTSKGSKKKISGKIIVKNLPFEATRKDV 728

Query: 236 QELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQ 295
            ELF+ FG + S  + K  D   +GF FV +    +A  A++ L    L G +L +  A+
Sbjct: 729 FELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLLGRRLVMQYAE 788

Query: 296 KKNE 299
           ++++
Sbjct: 789 QESD 792

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 97/403 (24%), Positives = 170/403 (42%), Gaps = 51/403 (12%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++ ++    +E     +FSP G +  + V  D  T  S G+AYV F D E    A  +L
Sbjct: 303 LFLRNILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDPEHAANAYIEL 362

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNL----HPDIDNKALY--DTFS---VFG 150
           +    +GRL  I+ +    + R        +KNL      ++  KA     TFS   +F 
Sbjct: 363 DKQIFQGRLLHILPADAKKTHR---LDEFDLKNLPLKKQRELKRKATAAQQTFSWNSLFM 419

Query: 151 D---ILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKER 207
           +   +LSS  A     KS+    +  E  G+A +   A   ++ + ++ + A  +   + 
Sbjct: 420 NQDAVLSSVAAKLGMEKSQ---LIDPENSGSAVKQALAEAHVIGDVRKYFEARGVDLTQF 476

Query: 208 DSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPI----------VSASLEKDADGK 257
           +   + T+     + VKN    TT E+  ELF  FG I          ++    +D    
Sbjct: 477 EKFKKVTERDDRIILVKNFPHGTTREELAELFLPFGKIERMLMPPSGTIAIIQYRDVPAA 536

Query: 258 LKGFGFVNYEKHEDAVKAVEA----LNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRL 313
              F  ++Y++ +  +  +E         E  G++L  G A    E +  +KK  E   +
Sbjct: 537 RGAFTKLSYKRFKAPILYLEKGPKDCFSREPRGDELLEGDAAP--EDVKEIKKSVEDV-M 593

Query: 314 EKMAKYQG----------VNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGK--- 360
           +  +K             V++FVKNL+ S    +L E+F P+     A+V    + K   
Sbjct: 594 DADSKTPSSEATAIDGPTVSIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPDPKNSD 653

Query: 361 ---SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 400
              S GFGF+ F T E+A   I   +  ++ G  + + I+ ++
Sbjct: 654 KKLSMGFGFIEFRTKEQAGAVIAAMDGAVIDGHKIQLKISHKQ 696

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 92/188 (48%), Gaps = 15/188 (7%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLE-----KDADGKLK-GFGFVNYEKHEDA 272
            +++VKN+N  TT  Q  E F  F   V A ++     K++D KL  GFGF+ +   E A
Sbjct: 612 VSIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQA 671

Query: 273 VKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDS 332
              + A++ + ++G K+ +  + K++     L K  +  + +   K       VKNL   
Sbjct: 672 GAVIAAMDGAVIDGHKIQLKISHKQSS----LPKTSKGSKKKISGKII-----VKNLPFE 722

Query: 333 VDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392
              + + E F+ +G + S +V +  +  ++GF FV F  P EA  A+ +     + G+ L
Sbjct: 723 ATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLLGRRL 782

Query: 393 YVAIAQRK 400
            +  A+++
Sbjct: 783 VMQYAEQE 790

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 81/171 (47%), Gaps = 12/171 (7%)

Query: 40  LYVGDLEPSVSEAHLYDIFSP-----IGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRK 94
           ++V +L  S + A L + F P     +  V +    +++  K S+G+ ++ F   E    
Sbjct: 614 IFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQAGA 673

Query: 95  AIEQLNYTPIKGRLCRIMWSQRDPSLRK-------KGSGNIFIKNLHPDIDNKALYDTFS 147
            I  ++   I G   ++  S +  SL K       K SG I +KNL  +   K +++ FS
Sbjct: 674 VIAAMDGAVIDGHKIQLKISHKQSSLPKTSKGSKKKISGKIIVKNLPFEATRKDVFELFS 733

Query: 148 VFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
            FG + S ++    +  ++GF FV F     A+ A+D L G+ L G+ + +
Sbjct: 734 SFGQLKSVRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLLGRRLVM 784

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 324 LFVKNLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFSTPEEATKAITEK 382
           LF++N+     +E  ++ F+PYG +    V + T  G+SKGF +V F  PE A  A  E 
Sbjct: 303 LFLRNILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDPEHAANAYIEL 362

Query: 383 NQQIVAGKPLYVAIAQRKDVRR 404
           ++QI  G+ L++  A  K   R
Sbjct: 363 DKQIFQGRLLHILPADAKKTHR 384

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 106/234 (45%), Gaps = 25/234 (10%)

Query: 123 KGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKE 181
           + +G +F++N+  D   +     FS +G++    +A D   G+SKGF +V F++   A  
Sbjct: 298 RATGRLFLRNILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDPEHAAN 357

Query: 182 AIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKN---INSETTDEQ---- 234
           A   L+  +  G+ +++ P  ++K    +L+E      NL +K    +  + T  Q    
Sbjct: 358 AYIELDKQIFQGRLLHILPADAKKTH--RLDEF--DLKNLPLKKQRELKRKATAAQQTFS 413

Query: 235 FQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRA 294
           +  LF     ++S+   K     ++    ++ E    AVK  +AL ++ +      +G  
Sbjct: 414 WNSLFMNQDAVLSSVAAKLG---MEKSQLIDPENSGSAVK--QALAEAHV------IGDV 462

Query: 295 QKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTI 348
           +K  E   V   Q+E ++  K+ +     + VKN       E+L E F P+G I
Sbjct: 463 RKYFEARGVDLTQFEKFK--KVTERDDRIILVKNFPHGTTREELAELFLPFGKI 514

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 152 ILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVA 199
           I   KI  D++G S+ F F+ +  E  A +AI+  NG  ++   I VA
Sbjct: 37  ITDVKIVKDKSGNSRRFAFIGYRSEQDAFDAIEYFNGSFIDTARIEVA 84

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 42  VGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNY 101
           V +L    +   ++++FS  G + S+RV +    K++ G+A+V F        A++QL  
Sbjct: 716 VKNLPFEATRKDVFELFSSFGQLKSVRVPK-KFDKSARGFAFVEFLLPSEAENAMDQLQG 774

Query: 102 TPIKGRLCRIMWSQRD 117
             + GR   + +++++
Sbjct: 775 VHLLGRRLVMQYAEQE 790

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%)

Query: 245 IVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQ 295
           I    + KD  G  + F F+ Y   +DA  A+E  N S ++  ++ V  A+
Sbjct: 37  ITDVKIVKDKSGNSRRFAFIGYRSEQDAFDAIEYFNGSFIDTARIEVAMAK 87

>Sklu_2085.2 YOR319W, Contig c2085 3158-3787
          Length = 209

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 58/117 (49%), Gaps = 6/117 (5%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           LY+G+++P+V++  LY++F  +  +S IR  RD I  T  GYA++ F   E     ++ +
Sbjct: 12  LYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTHQGYAFIEFFTKEDADYVVKVM 71

Query: 100 NYT------PIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFG 150
           N T       +K R      +   PS   +    +F+KNL   +D  AL   F  FG
Sbjct: 72  NNTVQLYNRTLKVRRANSNTAASQPSKHVEIGAKLFVKNLDDLVDVAALAKIFGKFG 128

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 82/182 (45%), Gaps = 15/182 (8%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDAD-GKLKGFGFVNYEKHEDAVKAVE 277
           T LY+ NI+   T +   ELF +  PI      +D      +G+ F+ +   EDA   V+
Sbjct: 10  TTLYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTHQGYAFIEFFTKEDADYVVK 69

Query: 278 ALNDS-ELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDE 336
            +N++ +L    L V RA   N       K  E           G  LFVKNLDD VD  
Sbjct: 70  VMNNTVQLYNRTLKVRRANS-NTAASQPSKHVEI----------GAKLFVKNLDDLVDVA 118

Query: 337 KLEEEFAPYGTITS-AKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVA 395
            L + F  +G  +   ++   +    K   ++ ++T +++ +A+ + N QIV  + + V 
Sbjct: 119 ALAKIFGKFGPFSKQPEIFHVKQADYKC-AYIYYTTFDDSDQALAKLNNQIVFNRSISVD 177

Query: 396 IA 397
            A
Sbjct: 178 YA 179

>KLLA0D14949g complement(1259860..1262496) similar to sgd|S0006316
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 878

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 88/175 (50%), Gaps = 12/175 (6%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGK------SKGFGFVHFEEEGAAK 180
           +IFIKNL+    ++ L + F  F   + +++ T  + K      S GFGF  F+ +  A 
Sbjct: 652 SIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQAN 711

Query: 181 EAIDALNGMLLNGQEIYVAPHLSRKE----RDSQLEETKAHYTNLYVKNINSETTDEQFQ 236
             I A+ G +L+G ++ +   LS ++     ++  ++ K +   + VKN+  E T +   
Sbjct: 712 AVISAMEGTILDGHKLQL--KLSHRQGTSTTNASSKKKKKNQGKIIVKNLPFEATRKDVF 769

Query: 237 ELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291
           ELF+ FG + S  + K  D   +GF FV +   ++A  A++ L    L G +L +
Sbjct: 770 ELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 824

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 93/419 (22%), Positives = 163/419 (38%), Gaps = 73/419 (17%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++ ++  + +E     +FSP G +  + +  D  T  S G+AYV F + +    A  +L
Sbjct: 332 LFLRNILYTATEDDFRKLFSPYGELEEVHIAVDTRTGQSKGFAYVLFKNADNAATAFVEL 391

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGS--GNIFIKNL----HPDIDNKA-------LYDTF 146
           +    +GRL  I+     P+  KK        +KNL      ++  KA        +++ 
Sbjct: 392 DKQIFQGRLLHIL-----PADAKKSHKLDEFDLKNLPLKKQRELKRKANSAQQTFSWNSL 446

Query: 147 SVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAI-------DALNGMLLNGQEIYVA 199
            +  D + S +A D+ G  K           A K+A+       D        G ++   
Sbjct: 447 YMNQDAVLSSVA-DKLGMKKSELIDAENSSSAVKQALAEASVIGDVRKFFETRGVDLTKF 505

Query: 200 PHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLE-------- 251
             L   ERD ++         + VKN    TT E+  ELF  FG +    L         
Sbjct: 506 AQLKNSERDDRV---------ILVKNFPYGTTREEIAELFLPFGKLQRLLLPPSGTIAIL 556

Query: 252 --KDADGKLKGFGFVNYEKHEDAVKAVEA--------------LNDSELNGEKLYVGRAQ 295
             +D       F  ++Y++ +D +  +E               L +SE + +K     A+
Sbjct: 557 QFRDVPAARAAFSKISYKRFKDGIIYLEKGPSDCFTRDAQGDELVESETDIQKATAKEAK 616

Query: 296 KKNERMHVLKKQYEAYRLEKMAKYQ--------GVNLFVKNLDDSVDDEKLEEEFAPYGT 347
                +   +    A + +               V++F+KNL+ S   ++L E+F P+  
Sbjct: 617 ISGADLLEAQSLPAADKDDHDDDDDDDDVQAGPTVSIFIKNLNFSTTSQQLTEKFKPFNG 676

Query: 348 ITSAKVMRTENGK------SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 400
              A+V    + K      S GFGF  F T E+A   I+     I+ G  L + ++ R+
Sbjct: 677 FVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQANAVISAMEGTILDGHKLQLKLSHRQ 735

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 85/187 (45%), Gaps = 14/187 (7%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGK------LKGFGFVNYEKHEDA 272
            ++++KN+N  TT +Q  E F  F   V A ++   D K        GFGF  ++  E A
Sbjct: 651 VSIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQA 710

Query: 273 VKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDS 332
              + A+  + L+G KL +  + ++         + +          QG  + VKNL   
Sbjct: 711 NAVISAMEGTILDGHKLQLKLSHRQGTSTTNASSKKKKKN-------QG-KIIVKNLPFE 762

Query: 333 VDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392
              + + E F+ +G + S +V +  +  ++GF FV F  P+EA  A+ +     + G+ L
Sbjct: 763 ATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 822

Query: 393 YVAIAQR 399
            +   ++
Sbjct: 823 VMEFVEQ 829

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 78/172 (45%), Gaps = 13/172 (7%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGS--VSSIRVCRDAIT--KT-SLGYAYVNFNDHEAGRK 94
           +++ +L  S +   L + F P     V+ ++   D     KT S+G+ +  F   E    
Sbjct: 653 IFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQANA 712

Query: 95  AIEQLNYTPIKGRLCRIMWSQRDPS--------LRKKGSGNIFIKNLHPDIDNKALYDTF 146
            I  +  T + G   ++  S R  +         +KK  G I +KNL  +   K +++ F
Sbjct: 713 VISAMEGTILDGHKLQLKLSHRQGTSTTNASSKKKKKNQGKIIVKNLPFEATRKDVFELF 772

Query: 147 SVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
           S FG + S ++    +  ++GF FV F     A+ A+D L G+ L G+ + +
Sbjct: 773 SSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 824

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 49/93 (52%), Gaps = 4/93 (4%)

Query: 324 LFVKNLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFSTPEEATKAITEK 382
           LF++N+  +  ++   + F+PYG +    + + T  G+SKGF +V F   + A  A  E 
Sbjct: 332 LFLRNILYTATEDDFRKLFSPYGELEEVHIAVDTRTGQSKGFAYVLFKNADNAATAFVEL 391

Query: 383 NQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARN 415
           ++QI  G+ L++  A   D ++S    +   +N
Sbjct: 392 DKQIFQGRLLHILPA---DAKKSHKLDEFDLKN 421

 Score = 37.4 bits (85), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           + V +L    +   ++++FS  G + S+RV +    K++ G+A+V F   +    A++QL
Sbjct: 754 IIVKNLPFEATRKDVFELFSSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQL 812

Query: 100 NYTPIKGRLCRIMWSQRDP 118
               + GR   + + ++DP
Sbjct: 813 QGVHLLGRRLVMEFVEQDP 831

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 144 DTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVA 199
           D  S   D+   K+  + +G+S+ F F+ F +E  A + ++  NG  ++  +I V+
Sbjct: 34  DVQSYLSDV---KLMKNRDGESRRFAFIGFRDEEDAFDCVNYFNGTFVDTSKIEVS 86

>ABL059W [533] [Homologous to ScYOR319W (HSH49) - SH]
           complement(287620..288234) [615 bp, 204 aa]
          Length = 204

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 81/163 (49%), Gaps = 5/163 (3%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +YVG+L+P VS+  LY++F  +  VS IR  +D + +   G+A+V          AI+ L
Sbjct: 9   VYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQEHQGFAFVELFSEADCDFAIKSL 68

Query: 100 NYT-PIKGRLCRIMWSQRDP--SLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILS-S 155
           N T  + G++ ++  +  +   S        +F+KNL   ID   L   F  FG +    
Sbjct: 69  NNTVSLFGKVLKVRRTLENAKNSAPVFARAKLFVKNLDSTIDAVQLQKLFGKFGPLAKPP 128

Query: 156 KIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
           ++ T ++G  +   +V+F     + EA++ LN  ++  Q I +
Sbjct: 129 QLFTLKDGALRC-AYVYFTTFRHSDEALEKLNNQIVANQIISI 170

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 81/181 (44%), Gaps = 16/181 (8%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVE 277
             +YV N++ + + E   ELF +  P+      KD    + +GF FV      D   A++
Sbjct: 7   CTVYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQEHQGFAFVELFSEADCDFAIK 66

Query: 278 ALNDS-ELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDE 336
           +LN++  L G+ L V R  +  +                   +    LFVKNLD ++D  
Sbjct: 67  SLNNTVSLFGKVLKVRRTLENAKN--------------SAPVFARAKLFVKNLDSTIDAV 112

Query: 337 KLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 396
           +L++ F  +G +     + T    +    +V F+T   + +A+ + N QIVA + + +  
Sbjct: 113 QLQKLFGKFGPLAKPPQLFTLKDGALRCAYVYFTTFRHSDEALEKLNNQIVANQIISIDY 172

Query: 397 A 397
           A
Sbjct: 173 A 173

>CAGL0H02123g complement(188454..190121) similar to sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 555

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 76/326 (23%), Positives = 134/326 (41%), Gaps = 77/326 (23%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVS-SIRVCR--DA-ITKTSLGYAYVNFNDHEAGRKA 95
           LY+GDL+PS  EA +  I++ +G  +  +R+    DA   + +LGY +V F        A
Sbjct: 86  LYMGDLDPSWDEAVVKGIWAALGEENIGVRMMWGGDADFHRKNLGYCFVEFPSPAHASNA 145

Query: 96  IEQLNYTPIKG---RLCRIMWSQRDPSLRKKGSG---------------NIFIKNLHPDI 137
           + + N   I G   +  ++ WS +       GSG               +IF+ +L P +
Sbjct: 146 LMK-NGMEIPGFVHKKLKLNWSAQS---VNNGSGASVANGAVANQQTNNSIFVGDLAPSV 201

Query: 138 DNKALYDTF-SVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQE 195
               L+D F + +   + +K+  D+  G SKG+GFV F+     + A+  + G  LNG+ 
Sbjct: 202 TEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVEMQGCFLNGRA 261

Query: 196 I-------------------------YVAPHLSRKER--DSQLEE--------------- 213
           I                          ++  L ++ R  + QL +               
Sbjct: 262 IKIGIAGGNNNNNSNSNYNNQRMANDNISNGLGQQSRSLNGQLPQQFVNATPQQPVLNHF 321

Query: 214 TKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAV 273
           T  + T ++V  ++   T+++ +  F  FG I+   +        KG GFV Y +   A 
Sbjct: 322 TDPNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAG-----KGCGFVQYVERSSAE 376

Query: 274 KAVEALNDSELNGE--KLYVGRAQKK 297
            A+  +    +     +L  GR+ KK
Sbjct: 377 TAITKMQGFPIANSRVRLSWGRSAKK 402

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 73/343 (21%), Positives = 131/343 (38%), Gaps = 68/343 (19%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGD------ILSSKIATDENGKSKGFGFVHFEEEGAAKE 181
           +++ +L P  D   +   ++  G+      ++    A D + K+ G+ FV F     A  
Sbjct: 86  LYMGDLDPSWDEAVVKGIWAALGEENIGVRMMWGGDA-DFHRKNLGYCFVEFPSPAHAS- 143

Query: 182 AIDALNGMLLNGQEI-----------YVAPHLSRKERDSQLEETKAHY---TNLYVKNIN 227
                N ++ NG EI           + A  ++     S      A+     +++V ++ 
Sbjct: 144 -----NALMKNGMEIPGFVHKKLKLNWSAQSVNNGSGASVANGAVANQQTNNSIFVGDLA 198

Query: 228 SETTDEQFQELFA-KFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEALNDSELN 285
              T+ Q  +LF  K+   V A +  D   G  KG+GFV ++   D  +A+  +    LN
Sbjct: 199 PSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVEMQGCFLN 258

Query: 286 GEKLYVGRA----------QKKNERM------HVLKKQYEAYR----------------L 313
           G  + +G A             N+RM      + L +Q  +                  L
Sbjct: 259 GRAIKIGIAGGNNNNNSNSNYNNQRMANDNISNGLGQQSRSLNGQLPQQFVNATPQQPVL 318

Query: 314 EKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPE 373
                     +FV  L   V +++L   F P+GTI   K+        KG GFV +    
Sbjct: 319 NHFTDPNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIP-----AGKGCGFVQYVERS 373

Query: 374 EATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQ 416
            A  AIT+     +A     V ++  +  +++ L Q+   R++
Sbjct: 374 SAETAITKMQGFPIANS--RVRLSWGRSAKKTALIQKALLRSR 414

>Scas_316.1
          Length = 483

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 74/163 (45%), Gaps = 27/163 (16%)

Query: 162 NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEE----TKAH 217
           N K +GFGFV F  E   KEA+       L G  + V     R++R ++  E     K  
Sbjct: 1   NKKFRGFGFVSFAVEDDTKEALKQARKAKLKGHLLRV-DIAKRRDRSNKPGEGDKPEKKT 59

Query: 218 YTNLYVKNINSETTDE----------------------QFQELFAKFGPIVSASLEKDAD 255
            T+   ++ N E  +E                      Q +++F++FG +V AS+ K  D
Sbjct: 60  RTDTIARDENEEVDEESLLKGKPKLIIRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKRD 119

Query: 256 GKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKN 298
           GKL GF FV  +K  +   A+E   D +++G  + V  A +KN
Sbjct: 120 GKLCGFAFVTMKKLSNCTIALENTKDLKIDGRSVAVDFAVQKN 162

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 72/161 (44%), Gaps = 17/161 (10%)

Query: 257 KLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRA---------------QKKNERM 301
           K +GFGFV++   +D  +A++    ++L G  L V  A               +KK    
Sbjct: 3   KFRGFGFVSFAVEDDTKEALKQARKAKLKGHLLRVDIAKRRDRSNKPGEGDKPEKKTRTD 62

Query: 302 HVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDD-EKLEEEFAPYGTITSAKVMRTENGK 360
            + + + E    E + K +   L ++N+  S  D  +L++ F+ +GT+  A + +  +GK
Sbjct: 63  TIARDENEEVDEESLLKGKP-KLIIRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKRDGK 121

Query: 361 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKD 401
             GF FV        T A+       + G+ + V  A +K+
Sbjct: 122 LCGFAFVTMKKLSNCTIALENTKDLKIDGRSVAVDFAVQKN 162

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 60/150 (40%), Gaps = 31/150 (20%)

Query: 80  GYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGN------------ 127
           G+ +V+F   +  ++A++Q     +KG L R+  ++R     K G G+            
Sbjct: 6   GFGFVSFAVEDDTKEALKQARKAKLKGHLLRVDIAKRRDRSNKPGEGDKPEKKTRTDTIA 65

Query: 128 ------------------IFIKNLHPDI-DNKALYDTFSVFGDILSSKIATDENGKSKGF 168
                             + I+N+     D   L   FS FG ++ + I    +GK  GF
Sbjct: 66  RDENEEVDEESLLKGKPKLIIRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKRDGKLCGF 125

Query: 169 GFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
            FV  ++      A++    + ++G+ + V
Sbjct: 126 AFVTMKKLSNCTIALENTKDLKIDGRSVAV 155

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%)

Query: 358 NGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKD 401
           N K +GFGFV F+  ++  +A+ +  +  + G  L V IA+R+D
Sbjct: 1   NKKFRGFGFVSFAVEDDTKEALKQARKAKLKGHLLRVDIAKRRD 44

 Score = 33.5 bits (75), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 16/112 (14%)

Query: 118 PSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEE 176
           P   KK   +IF++N+  D   ++L   FS FG +  +    D   G +KG  FV F + 
Sbjct: 234 PKQNKKEDFSIFVRNVPYDATEESLAAHFSKFGQVKYALPVIDRTTGLAKGTAFVAFRDH 293

Query: 177 GAAKEAID----ALNGMLLNGQEIY-----------VAPHLSRKERDSQLEE 213
              K  ID    A +  LL G ++            ++P L R+  + Q E+
Sbjct: 294 MTYKYCIDNAPAAGSTSLLIGDDVLPEYVYEGRVLSISPTLDRENANRQAEK 345

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 205 KERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGF 263
           ++RD + ++ K    +++V+N+  + T+E     F+KFG +  A    D   G  KG  F
Sbjct: 228 RKRDERPKQNKKEDFSIFVRNVPYDATEESLAAHFSKFGQVKYALPVIDRTTGLAKGTAF 287

Query: 264 VNYEKH 269
           V +  H
Sbjct: 288 VAFRDH 293

>Kwal_27.12337
          Length = 209

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 81/176 (46%), Gaps = 17/176 (9%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKL-KGFGFVNYEKHEDAVKAVEAL 279
           +YV N++ + T E   ELF +  P+      KD   +  +GF FV +   +D   A + L
Sbjct: 12  VYVGNVDPKVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYATKCL 71

Query: 280 NDSELNGEKLY--VGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEK 337
           N    N  +LY    + +K N   H    Q         A   G  LFVKN+D+ VD   
Sbjct: 72  N----NSLRLYDRTLKVRKANGAGHAPANQ--------NALDVGAKLFVKNIDELVDATA 119

Query: 338 LEEEFAPYGTITSA-KVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392
           L   F+ +G +  A ++   + G  K   +V ++T E + KA+ + N Q+V  K +
Sbjct: 120 LTRIFSKFGPLAKAPEIFYLKQGVLKC-AYVSYTTFEHSDKALAKLNNQMVMNKCI 174

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 61/125 (48%), Gaps = 22/125 (17%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +YVG+++P V+   LY++F  I  V+ IR  +D I +T  G+A+V F + +    A + L
Sbjct: 12  VYVGNVDPKVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYATKCL 71

Query: 100 NYTPIKGRLCRIMWSQRDPSLRK-KGSGN-------------IFIKNLHPDIDNKALYDT 145
           N +        +    R   +RK  G+G+             +F+KN+   +D  AL   
Sbjct: 72  NNS--------LRLYDRTLKVRKANGAGHAPANQNALDVGAKLFVKNIDELVDATALTRI 123

Query: 146 FSVFG 150
           FS FG
Sbjct: 124 FSKFG 128

>YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with
           similarity to Rlf6p, contains three RNA recognition
           motif (RRM) domains [1290 bp, 429 aa]
          Length = 429

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 114/297 (38%), Gaps = 46/297 (15%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTS--LGYAYVNFNDHEAGRKAIE 97
           ++VG+L    +   L + FS IG V    V  D IT      G   V F + +   +AI 
Sbjct: 138 IFVGNLTYDSTPEDLTEFFSQIGKV----VRADIITSRGHHRGMGTVEFTNSDDVDRAIR 193

Query: 98  QLNYTPIKGRLCRIMWSQRDP---------------SLR-KKGSGNIFIKNLHPDIDNKA 141
           Q +      R  +I   Q +P                LR  + +  + +KNL   ++ +A
Sbjct: 194 QYDGAFFMDR--KIFVRQDNPPPSNNIKERKALDRGELRHNRKTHEVIVKNLPASVNWQA 251

Query: 142 LYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPH 201
           L D F   G++  + +  D +G S G G V F +      AI+  NG  + G  + V   
Sbjct: 252 LKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKYNGYSIEGNVLDVKSK 311

Query: 202 LSRKER-----------DSQLEETKAHYTN-----------LYVKNINSETTDEQFQELF 239
            S               DS + E    +T            +Y  N+   T      +LF
Sbjct: 312 ESVHNHSDGDDVDIPMDDSPVNEEARKFTENVVGGGERNRLIYCSNLPFSTAKSDLYDLF 371

Query: 240 AKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQK 296
              G + +A L  D+ G   G   V Y+  +DA   +E LN+    G  L +  A++
Sbjct: 372 ETIGKVNNAELRYDSKGAPTGIAVVEYDNVDDADVCIERLNNYNYGGCDLDISYAKR 428

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 53/117 (45%), Gaps = 10/117 (8%)

Query: 303 VLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSK 362
           +L ++ ++   EK+ +    ++FV NL      E L E F+  G +  A ++ T  G  +
Sbjct: 117 LLARELDSTYEEKVNRNYSNSIFVGNLTYDSTPEDLTEFFSQIGKVVRADII-TSRGHHR 175

Query: 363 GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVA---------IAQRKDVRRSQLAQQ 410
           G G V F+  ++  +AI + +      + ++V          I +RK + R +L   
Sbjct: 176 GMGTVEFTNSDDVDRAIRQYDGAFFMDRKIFVRQDNPPPSNNIKERKALDRGELRHN 232

>YGR250C (YGR250C) [2197] chr7 complement(991180..993525) Protein
           with three RNA recognition motif (RRM) domains, has
           similarity to human 64K polyadenylation factor [2346 bp,
           781 aa]
          Length = 781

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 90/222 (40%), Gaps = 53/222 (23%)

Query: 126 GNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDEN-GKSKGFGFVHFEEEGAAKEAID 184
           GNIF+  +   +    L   FS +G ILS K+  D+  G+  G+GF+ +     A   I 
Sbjct: 195 GNIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIK 254

Query: 185 ALNGMLLNGQEIYVAPHLSRKERDS-QLEETKA-----HYTNLYVKNI---NSETTDEQF 235
            LNG  +NG  +++  H+ RKER+    +  K      ++  L++ N+   N E  +   
Sbjct: 255 ELNGRTVNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNLPYHNPEKVETLI 314

Query: 236 ----------QELFAKF---------------------------GPIVSASLEKDADGK- 257
                     +EL  KF                           G + S     + +G  
Sbjct: 315 TPKEVIEVIKKELSKKFPDFDIISYYFPKRSNTRSSSSVSFNEEGSVESNKSSNNTNGNA 374

Query: 258 -----LKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRA 294
                LKG+GF+    HE A+ A+E  N    +G +L V +A
Sbjct: 375 QDEDMLKGYGFIKLINHEQALAAIETFNGFMWHGNRLVVNKA 416

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 91/452 (20%), Positives = 169/452 (37%), Gaps = 100/452 (22%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++VG +  S+S   L  +FS  G + S+++  D       GY ++++         I++L
Sbjct: 197 IFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKEL 256

Query: 100 NYTPIKGRLC------------RIMWSQRDPSLRKKGSGNIFIKNL-------------- 133
           N   + G               RI W     +        +FI NL              
Sbjct: 257 NGRTVNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNLPYHNPEKVETLITP 316

Query: 134 --------------HPDIDNKALY------------DTFSVFGDILSSKIATDENGKS-- 165
                          PD D  + Y             +F+  G + S+K + + NG +  
Sbjct: 317 KEVIEVIKKELSKKFPDFDIISYYFPKRSNTRSSSSVSFNEEGSVESNKSSNNTNGNAQD 376

Query: 166 ----KGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETK----AH 217
               KG+GF+       A  AI+  NG + +G  + V   +  K  ++     +    ++
Sbjct: 377 EDMLKGYGFIKLINHEQALAAIETFNGFMWHGNRLVVNKAVQHKVYNNHNSHDRHPSISN 436

Query: 218 YTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVE 277
           + ++ V    +    +     + ++    + +   +    ++ F         D+V++  
Sbjct: 437 HNDMEVLEFANNPMYDYNNYTYDRYYFNNNKNGNSNDTSNVRYF---------DSVRSTP 487

Query: 278 ALNDSEL---NGEKLYVGRAQKKNERMHVLKKQYE----AYRLE-KMAKYQGVNLFVKNL 329
                +L     E    GR Q+    M      Y+    +Y L   M+  Q  NL+VK++
Sbjct: 488 VAEKMDLFYPQRESFSEGRGQRVPRFMGNKFDMYQYPSTSYSLPIPMSNQQESNLYVKHI 547

Query: 330 DDSVDDEKLEEEFAPYGTITSAKVM----------------RTEN----GKSKGFGFVCF 369
             S  DE L + +  +G I S KV+                 ++N    G S+G+GFV F
Sbjct: 548 PLSWTDEDLYDFYKSFGEIISVKVITVGGSKNKYRQQSNDSSSDNDLPVGSSRGYGFVSF 607

Query: 370 STPEEATKAITEKN-QQIVAGKPLYVAIAQRK 400
            +P +A KAI   +  Q+   + L V+ AQ++
Sbjct: 608 ESPLDAAKAILNTDGYQVSKDQVLSVSFAQKR 639

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 3/86 (3%)

Query: 220 NLYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEA 278
           N++V  I    +  +   LF+K+GPI+S  L  D   G+  G+GF++Y     A   ++ 
Sbjct: 196 NIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKE 255

Query: 279 LNDSELNGEKLYVGR--AQKKNERMH 302
           LN   +NG  L++     +K+ ER+H
Sbjct: 256 LNGRTVNGSTLFINYHVERKERERIH 281

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 323 NLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTEN-GKSKGFGFVCFSTPEEATKAITE 381
           N+FV  +  S+   +L   F+ YG I S K++  +  G+  G+GF+ +    +A+  I E
Sbjct: 196 NIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKE 255

Query: 382 KNQQIVAGKPLYVAI-AQRKDVRR 404
            N + V G  L++    +RK+  R
Sbjct: 256 LNGRTVNGSTLFINYHVERKERER 279

>AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH]
           complement(617434..618879) [1446 bp, 481 aa]
          Length = 481

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 46/76 (60%), Gaps = 1/76 (1%)

Query: 40  LYVGDLEPSVSEAHLYDIF-SPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQ 98
           L+VGDL P+ +EAHL  +F +   SV ++RV  D IT  S  + +V F D +  R+A+ +
Sbjct: 164 LFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEKERRRALAE 223

Query: 99  LNYTPIKGRLCRIMWS 114
           +N    +GR  R+ ++
Sbjct: 224 MNGVWCQGRQLRVAYA 239

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 87/215 (40%), Gaps = 56/215 (26%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCR-------DAITKTSL------------- 79
           L++GDL+PS  EA +  ++  +G    +++ R          T ++L             
Sbjct: 24  LWMGDLDPSFDEATIQHVWLTVGHQVQVKLIRAKKNLLIPCSTSSTLSASHVDEERIQIN 83

Query: 80  ---------------GYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKK- 123
                          GY +V F + +  +  + QLN TP+   +     +  +P+ ++  
Sbjct: 84  GVSFIDPNTTQLHHAGYCFVQFANLQEAQAGL-QLNATPLPNVVSPTTRNPTNPTGKRNF 142

Query: 124 ----GSG-------------NIFIKNLHPDIDNKALYDTFSV-FGDILSSKIATDE-NGK 164
                SG             ++F+ +L P      L   F   F  + + ++ TD   G 
Sbjct: 143 RLNWASGATLQSDIPATPEFSLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITGA 202

Query: 165 SKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVA 199
           S+ FGFV F +E   + A+  +NG+   G+++ VA
Sbjct: 203 SRCFGFVRFADEKERRRALAEMNGVWCQGRQLRVA 237

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDAL 186
            +FI  L   I    L+  F  FG+ILS K+        +G GFV FE    A+ AI  +
Sbjct: 327 TVFIGGLSNMISEGQLHALFMPFGNILSVKVP-----PGRGCGFVRFENRMDAEAAIQGM 381

Query: 187 NGMLLNGQEIYVA 199
            G ++ G  I ++
Sbjct: 382 QGFIVGGNAIRLS 394

 Score = 35.8 bits (81), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 35/76 (46%), Gaps = 6/76 (7%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +++G L   +SE  L+ +F P G++ S++V          G  +V F +      AI+ +
Sbjct: 328 VFIGGLSNMISEGQLHALFMPFGNILSVKV------PPGRGCGFVRFENRMDAEAAIQGM 381

Query: 100 NYTPIKGRLCRIMWSQ 115
               + G   R+ W +
Sbjct: 382 QGFIVGGNAIRLSWGR 397

>CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 380

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 75/153 (49%), Gaps = 18/153 (11%)

Query: 257 KLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEA----YR 312
           K KGF +V++ K ++ V+A   L++S+LNG  L +  +           K YE       
Sbjct: 165 KNKGFCYVDF-KTQEQVEAAIKLSESQLNGRNLLIKNS-----------KSYEGRPDKTD 212

Query: 313 LEKMAKYQGVN-LFVKNLDDSVDDEKLEEEFAPYGTITSAKVMR-TENGKSKGFGFVCFS 370
           L  M+K      LFV NL     DE L + F   G I   ++    ++GK KGF FV F 
Sbjct: 213 LVSMSKNPPSRILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFK 272

Query: 371 TPEEATKAITEKNQQIVAGKPLYVAIAQRKDVR 403
             E AT A+ +K+ + +AG+PL +   + +  R
Sbjct: 273 NEEGATNALKDKSCRKIAGRPLRMEFGEDRSKR 305

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 56/115 (48%), Gaps = 12/115 (10%)

Query: 80  GYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQR---DP------SLRKKGSGNI-F 129
           G+ YV+F   E    AI +L+ + + GR   I  S+     P      S+ K     I F
Sbjct: 168 GFCYVDFKTQEQVEAAI-KLSESQLNGRNLLIKNSKSYEGRPDKTDLVSMSKNPPSRILF 226

Query: 130 IKNLHPDIDNKALYDTFSVFGDILSSKIAT-DENGKSKGFGFVHFEEEGAAKEAI 183
           + NL  D  ++ L   F   G+I+  ++AT  ++GK KGF FV F+ E  A  A+
Sbjct: 227 VGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNAL 281

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 36/76 (47%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+VG+L    ++  L   F   G +  IR+     +    G+A+V+F + E    A++  
Sbjct: 225 LFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNALKDK 284

Query: 100 NYTPIKGRLCRIMWSQ 115
           +   I GR  R+ + +
Sbjct: 285 SCRKIAGRPLRMEFGE 300

>KLLA0C14388g complement(1251548..1252159) similar to sp|Q99181
           Saccharomyces cerevisiae YOR319w HSH49 essential yeast
           splicing factor, start by similarity
          Length = 203

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 90/192 (46%), Gaps = 25/192 (13%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDA----DGKLKGFGFVNYEKHEDAVKAV 276
           +YV N++S        ELF + GPI      K+     D +   + F+ +    D V  V
Sbjct: 5   VYVGNLDSRVNKSLLYELFVQAGPISYIKFPKEKQDEDDSQHSKYAFIKFV--NDDVDYV 62

Query: 277 EALNDSE--LNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVD 334
             L D+   L G+ L V R+ K+ E        ++           G  LFVKNLD+S+D
Sbjct: 63  CKLFDNRVSLYGKPLKVRRSNKQPETT-----DFDV----------GAKLFVKNLDESID 107

Query: 335 DEKLEEEFAPYGTIT-SAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLY 393
             +L   F  +G +    +V   +NG  +   +V F+T + + +A+ + N+  +A K +Y
Sbjct: 108 VPQLSNIFKIFGKLLRKPEVFYLQNGTLRC-AYVWFTTFKHSDEALQQLNETNLANKLIY 166

Query: 394 VAIAQRKDVRRS 405
           +  A + D++++
Sbjct: 167 IDYAYKDDMQKT 178

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 76/164 (46%), Gaps = 6/164 (3%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCR---DAITKTSLGYAYVNFNDHEAGRKAI 96
           +YVG+L+  V+++ LY++F   G +S I+  +   D        YA++ F + +      
Sbjct: 5   VYVGNLDSRVNKSLLYELFVQAGPISYIKFPKEKQDEDDSQHSKYAFIKFVNDDVDYVCK 64

Query: 97  EQLNYTPIKGRLCRIMWSQRDPSLRKKGSG-NIFIKNLHPDIDNKALYDTFSVFGDILSS 155
              N   + G+  ++  S + P       G  +F+KNL   ID   L + F +FG +L  
Sbjct: 65  LFDNRVSLYGKPLKVRRSNKQPETTDFDVGAKLFVKNLDESIDVPQLSNIFKIFGKLLRK 124

Query: 156 -KIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
            ++   +NG  +   +V F     + EA+  LN   L  + IY+
Sbjct: 125 PEVFYLQNGTLRC-AYVWFTTFKHSDEALQQLNETNLANKLIYI 167

>Scas_157.1
          Length = 232

 Score = 57.0 bits (136), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 80/166 (48%), Gaps = 8/166 (4%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIG-SVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQ 98
           LY+GDL+P+  E  +  I+  +G S   +++  ++    + GY +V F   E G  A+ +
Sbjct: 49  LYMGDLDPNWDENVIRQIWRDLGESNVHVKMMWNSNLGVNQGYCFVEFPSMEHGNNALLK 108

Query: 99  LNYTPIKG---RLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTF-SVFGDILS 154
            N   I G   R  ++ W+    +    G  ++F+ +L P++    L++ F   +     
Sbjct: 109 -NGIVIPGFPQRRLKLNWASAGANGNNSGF-SVFVGDLSPNVTEAQLFELFIGRYPSTCH 166

Query: 155 SKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVA 199
           +K+  D+  G SK +GFV F      +  +  + G+ LNG+ I V 
Sbjct: 167 AKVVHDQLTGVSKCYGFVKFNSATDQQRVLVEMQGVFLNGRSIKVG 212

 Score = 36.2 bits (82), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 75/179 (41%), Gaps = 21/179 (11%)

Query: 124 GSGNIFIKNLHPDIDNKALYDTFSVFGDI-LSSKIATDEN-GKSKGFGFVHFE--EEGAA 179
           GS  +++ +L P+ D   +   +   G+  +  K+  + N G ++G+ FV F   E G  
Sbjct: 45  GSSQLYMGDLDPNWDENVIRQIWRDLGESNVHVKMMWNSNLGVNQGYCFVEFPSMEHGN- 103

Query: 180 KEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTN----LYVKNINSETTDEQF 235
                  N +L NG    V P   ++          A+  N    ++V +++   T+ Q 
Sbjct: 104 -------NALLKNG---IVIPGFPQRRLKLNWASAGANGNNSGFSVFVGDLSPNVTEAQL 153

Query: 236 QELF-AKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVG 292
            ELF  ++     A +  D   G  K +GFV +    D  + +  +    LNG  + VG
Sbjct: 154 FELFIGRYPSTCHAKVVHDQLTGVSKCYGFVKFNSATDQQRVLVEMQGVFLNGRSIKVG 212

>Kwal_14.1851
          Length = 535

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query: 40  LYVGDLEPSVSEAHLYDIFSP-IGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQ 98
           L+VGDL P+ +EAHL  +F     SV ++RV  D IT  S  + +V F D +  R+A+ +
Sbjct: 176 LFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERRRALVE 235

Query: 99  LNYTPIKGRLCRIMWS 114
           +N    +GR  R+ ++
Sbjct: 236 MNGVWCQGRNLRVAYA 251

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 75/365 (20%), Positives = 132/365 (36%), Gaps = 60/365 (16%)

Query: 80  GYAYVNFNDHEAGRKAIEQLNYTPIKGRLC---------------RIMWSQRDPSLRKKG 124
           GY +V F      + A+  LN +P+    C               R+ W+     L    
Sbjct: 111 GYCFVEFESLADAQWALT-LNSSPLPDITCGNGHVSTNPSGLRNFRLNWASGATLLSAIP 169

Query: 125 SG---NIFIKNLHPDIDNKALYDTFSV-FGDILSSKIATDE-NGKSKGFGFVHFEEEGAA 179
           S    ++F+ +L P      L   F   F  + + ++ TD   G S+ FGFV F +E   
Sbjct: 170 STPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQER 229

Query: 180 KEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEET--KAHYTNLYVKN-----------I 226
           + A+  +NG+   G+ + VA    R     QL +   ++   + +++N           +
Sbjct: 230 RRALVEMNGVWCQGRNLRVAYATPRNNVMWQLTQNSHQSQQNDQFLQNDQLPHFQHRSQV 289

Query: 227 NSETTD-----------EQFQELFAKFG--PIVSASLEKDADGKLKGFGFVNYEKHEDAV 273
            S                Q Q     FG  P   +  +  A      F   NY+  +   
Sbjct: 290 QSHHQHHPRHHLNLSQIHQHQHASLGFGSEPAAPSQYQTSA----PAFHPNNYQMTQSNY 345

Query: 274 KAVEAL---NDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLD 330
                L    +S +N   +    +   ++ +     Q  A R           +F+  L 
Sbjct: 346 SQAPLLMKTANSLVNNNLINFPASDVSSDHVPAFMAQPTAPR-SAFTNPNNTTVFIGGLT 404

Query: 331 DSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGK 390
             + + +L   F+P+G I + K+        KG GFV ++   +A  AI      IV G 
Sbjct: 405 SQISERQLHSLFSPFGAIINVKI-----PPGKGCGFVKYAYRIDAEAAIQGMQGFIVGGN 459

Query: 391 PLYVA 395
           P+ ++
Sbjct: 460 PIRLS 464

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 42/94 (44%), Gaps = 7/94 (7%)

Query: 214 TKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAV 273
           T  + T +++  + S+ ++ Q   LF+ FG I++  +        KG GFV Y    DA 
Sbjct: 391 TNPNNTTVFIGGLTSQISERQLHSLFSPFGAIINVKIPPG-----KGCGFVKYAYRIDAE 445

Query: 274 KAVEALNDSELNGE--KLYVGRAQKKNERMHVLK 305
            A++ +    + G   +L  GR      R   ++
Sbjct: 446 AAIQGMQGFIVGGNPIRLSWGRTSADTGRHSAMQ 479

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/74 (21%), Positives = 34/74 (45%), Gaps = 6/74 (8%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +++G L   +SE  L+ +FSP G++ ++++          G  +V +        AI+ +
Sbjct: 398 VFIGGLTSQISERQLHSLFSPFGAIINVKI------PPGKGCGFVKYAYRIDAEAAIQGM 451

Query: 100 NYTPIKGRLCRIMW 113
               + G   R+ W
Sbjct: 452 QGFIVGGNPIRLSW 465

>Kwal_0.250
          Length = 216

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 90/215 (41%), Gaps = 34/215 (15%)

Query: 84  VNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDP-SLRKKGSG-------------NIF 129
           V F++ E   KAI++ +     GR   +   +  P S+R + SG              IF
Sbjct: 4   VEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERFHPGYEIF 63

Query: 130 IKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDA---- 185
           I NL      ++L D F   G+   + +  D NG+SKGFG V FE    A+ A+D     
Sbjct: 64  IANLPYSTSWQSLKDLFKACGNPTRADVKLDRNGRSKGFGTVIFETIDEARTALDKFQHF 123

Query: 186 -LNGMLLNGQEIY-------------VAPHLSRKERDSQLEETKAHYTNLYVKNINSETT 231
            L G +L  +  Y             V+  ++ +  ++  E  K++   +YV N+   T 
Sbjct: 124 DLEGRILELKRGYGPWEEEPSPVSADVSTTIAPQTENASGEGHKSN--TIYVDNLPYATA 181

Query: 232 DEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNY 266
                +LF   G +  A L+ D   K  G   V+Y
Sbjct: 182 QSDLYDLFETIGVVERAELKYDRKVKPTGAAIVSY 216

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 54/118 (45%), Gaps = 2/118 (1%)

Query: 262 GFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQG 321
           G V +   E   KA++  +     G +L+V   +     M   +   +   LE+   + G
Sbjct: 2   GTVEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERF--HPG 59

Query: 322 VNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAI 379
             +F+ NL  S   + L++ F   G  T A V    NG+SKGFG V F T +EA  A+
Sbjct: 60  YEIFIANLPYSTSWQSLKDLFKACGNPTRADVKLDRNGRSKGFGTVIFETIDEARTAL 117

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 61/135 (45%), Gaps = 10/135 (7%)

Query: 169 GFVHFEEEGAAKEAIDALNGMLLNGQEIYV----APHLSRKERDS-----QLEETKAHYT 219
           G V F       +AI   +G    G+E++V     P  S +  +S      LE     Y 
Sbjct: 2   GTVEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERFHPGY- 60

Query: 220 NLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEAL 279
            +++ N+   T+ +  ++LF   G    A ++ D +G+ KGFG V +E  ++A  A++  
Sbjct: 61  EIFIANLPYSTSWQSLKDLFKACGNPTRADVKLDRNGRSKGFGTVIFETIDEARTALDKF 120

Query: 280 NDSELNGEKLYVGRA 294
              +L G  L + R 
Sbjct: 121 QHFDLEGRILELKRG 135

>Kwal_33.14463
          Length = 393

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/160 (31%), Positives = 75/160 (46%), Gaps = 27/160 (16%)

Query: 257 KLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV-------GRAQKKNERMHVLKKQYE 309
           K KGF  +N+ K ++ + AV AL++S LNG  L +       GR  K +           
Sbjct: 177 KNKGFAHMNF-KTQEQMNAVVALSESHLNGRNLLIKDSSSFDGRPDKND----------- 224

Query: 310 AYRLEKMAKYQGVN-LFVKNLDDSVDDEKLEEEFAPYGTITSAKVMR-TENGKSKGFGFV 367
              L  M+K      LFV NL     DE L++ F   G I   ++    + GK KGF FV
Sbjct: 225 ---LISMSKNPPSRILFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFV 281

Query: 368 CFSTPEEATKAITEKNQQIVAGKPLYVAIAQ---RKDVRR 404
            F   E  T A+ +K  + +AG+PL +   +   ++ VRR
Sbjct: 282 DFKDEEGPTNALKDKTCRKIAGRPLRMEFGEDRSKRQVRR 321

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 78/152 (51%), Gaps = 7/152 (4%)

Query: 164 KSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLS---RKERDSQLEETKAHYTN 220
           K+KGF  ++F+ +     A+ AL+   LNG+ + +    S   R +++  +  +K   + 
Sbjct: 177 KNKGFAHMNFKTQEQM-NAVVALSESHLNGRNLLIKDSSSFDGRPDKNDLISMSKNPPSR 235

Query: 221 -LYVKNINSETTDEQFQELFAKFGPIVSASLEKDAD-GKLKGFGFVNYEKHEDAVKAVEA 278
            L+V N++ +TTDE  ++ F   G IV   +    D GK KGF FV+++  E    A++ 
Sbjct: 236 ILFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKD 295

Query: 279 LNDSELNGEKLYVGRAQKKNERMHVLKKQYEA 310
               ++ G  L +   + +++R  V ++  EA
Sbjct: 296 KTCRKIAGRPLRMEFGEDRSKR-QVRRRAPEA 326

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 54/115 (46%), Gaps = 12/115 (10%)

Query: 80  GYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQR---DP------SLRKKGSGNI-F 129
           G+A++NF   E    A+  L+ + + GR   I  S      P      S+ K     I F
Sbjct: 180 GFAHMNFKTQEQ-MNAVVALSESHLNGRNLLIKDSSSFDGRPDKNDLISMSKNPPSRILF 238

Query: 130 IKNLHPDIDNKALYDTFSVFGDILSSKIAT-DENGKSKGFGFVHFEEEGAAKEAI 183
           + NL  D  ++ L   F   GDI+  ++AT  + GK KGF FV F++E     A+
Sbjct: 239 VGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNAL 293

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 45/106 (42%), Gaps = 18/106 (16%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+VG+L    ++  L   F   G +  IR+     T    G+A+V+F D E    A++  
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKDK 296

Query: 100 NYTPIKGRLCRIMW------------------SQRDPSLRKKGSGN 127
               I GR  R+ +                  S+ +PSLR++ S N
Sbjct: 297 TCRKIAGRPLRMEFGEDRSKRQVRRRAPEAPVSRPEPSLREEHSSN 342

>Sklu_905.1 YMR268C, Contig c905 196-1743
          Length = 515

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 98/201 (48%), Gaps = 25/201 (12%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSA----SLEKDADGKLKGFGFVNYEKHEDAVKAV 276
           L+V N    +T E  + LF+++G  V +    SL+ D++ +   F ++++   ++A  A+
Sbjct: 185 LWVTNFAPNSTVETLKALFSQYGGSVLSVRLPSLKFDSNRR---FAYIDFASSDEANTAM 241

Query: 277 EALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLD-DSVDD 335
             LN++  +G   Y+   +K N   H   K+ +A  LEK        +F++ LD   V  
Sbjct: 242 SKLNNTSHDG---YILVVKKSNP--HEKSKRTDAATLEKR------EIFIRKLDFYKVSL 290

Query: 336 EKLEEEFAPYGTITSAKVMRTE-----NGKSKGFGFVCFSTPEEATKAITEKNQQIVAGK 390
            KL +    YG +    +  +E     N ++ GF FV ++  E A KA+ E N  +  G+
Sbjct: 291 SKLTKLVEKYGPVERVSMPNSEDSVNSNKQNDGFAFVTYTNEESAQKAL-ELNMSVFEGR 349

Query: 391 PLYVAIAQRKDVRRSQLAQQI 411
            L V+IA RK     Q  ++I
Sbjct: 350 VLAVSIADRKPYLERQEVKRI 370

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 81/182 (44%), Gaps = 15/182 (8%)

Query: 126 GNIFIKNLHPDIDNKALYDTFSVFG-DILSSKIATDENGKSKGFGFVHFEEEGAAKEAID 184
             +++ N  P+   + L   FS +G  +LS ++ + +   ++ F ++ F     A  A+ 
Sbjct: 183 ATLWVTNFAPNSTVETLKALFSQYGGSVLSVRLPSLKFDSNRRFAYIDFASSDEANTAMS 242

Query: 185 ALNGMLLNGQEIYVA---PHLSRKERDSQLEETKAHYTNLYVKNIN-SETTDEQFQELFA 240
            LN    +G  + V    PH   K  D+   E +     ++++ ++  + +  +  +L  
Sbjct: 243 KLNNTSHDGYILVVKKSNPHEKSKRTDAATLEKR----EIFIRKLDFYKVSLSKLTKLVE 298

Query: 241 KFGPIVSASLEKDADG-----KLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQ 295
           K+GP+   S+    D      +  GF FV Y   E A KA+E LN S   G  L V  A 
Sbjct: 299 KYGPVERVSMPNSEDSVNSNKQNDGFAFVTYTNEESAQKALE-LNMSVFEGRVLAVSIAD 357

Query: 296 KK 297
           +K
Sbjct: 358 RK 359

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 58/123 (47%), Gaps = 9/123 (7%)

Query: 80  GYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDN 139
           G+A+V + + E+ +KA+E LN +  +GR+  +  + R P L ++    I +    P  D 
Sbjct: 323 GFAFVTYTNEESAQKALE-LNMSVFEGRVLAVSIADRKPYLERQEVKRI-LNTKKPQNDM 380

Query: 140 KALYD-TFSVFGDILSSKIATDENGKSKGFGFVHF--EEEGAA----KEAIDALNGMLLN 192
            ++Y  T  V  D L + I    + K +    ++   + EGA      E I A   M L+
Sbjct: 381 ISMYPFTDKVSKDQLRALITEKASLKDEDIKAIYLVADHEGAVIQLESERIAAKVTMALH 440

Query: 193 GQE 195
           G E
Sbjct: 441 GIE 443

>KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 589

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 83/170 (48%), Gaps = 12/170 (7%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVS-SIRVCRDAITKTS-----LGYAYVNFNDHEAGR 93
           LY+GDL P  +E  +  I+S +G  +  +++ + +    S      GY +V F +  A  
Sbjct: 58  LYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPNQMAAS 117

Query: 94  KAIEQLNY-TPIKGRLC-RIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTF-SVFG 150
            A+ +     P+      ++ W+    +   + +  +F+ +L P++    L++ F S + 
Sbjct: 118 NALMKSGLRVPMDSNYALKLNWASFATAPGSEFT--LFVGDLAPNVTEAQLFELFISRYS 175

Query: 151 DILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVA 199
             L++KI  D+  G SKG+GFV F  E   + A+  + G  LNG+ I V 
Sbjct: 176 STLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVG 225

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 79/183 (43%), Gaps = 15/183 (8%)

Query: 123 KGSGNIFIKNLHPDIDNKALYDTFSVFGD-------ILSSKIATDENGKSKGFGFVHFEE 175
           + S  +++ +L+PD     +   +S+ G+       I SS         + G+ FV F  
Sbjct: 53  QNSTQLYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPN 112

Query: 176 EGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQF 235
           + AA       N ++ +G  + +  + + K   +           L+V ++    T+ Q 
Sbjct: 113 QMAAS------NALMKSGLRVPMDSNYALKLNWASFATAPGSEFTLFVGDLAPNVTEAQL 166

Query: 236 QELF-AKFGPIVSASLEKDA-DGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGR 293
            ELF +++   ++A +  D   G  KG+GFV +    +  +A+  +  + LNG  + VG 
Sbjct: 167 FELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVGT 226

Query: 294 AQK 296
             K
Sbjct: 227 TSK 229

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 85/190 (44%), Gaps = 25/190 (13%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFG-PIVSASLEKDADGKLK------GFGFVNYEKHED 271
           T LY+ ++N + T+   + +++  G P V   L K ++          G+ FV +    +
Sbjct: 56  TQLYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFP---N 112

Query: 272 AVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDD 331
            + A  AL  S L          +   +  + LK  + ++     +++    LFV +L  
Sbjct: 113 QMAASNALMKSGL----------RVPMDSNYALKLNWASFATAPGSEF---TLFVGDLAP 159

Query: 332 SVDDEKLEEEF-APYGTITSAKVMRTE-NGKSKGFGFVCFSTPEEATKAITEKNQQIVAG 389
           +V + +L E F + Y +  +AK++  +  G SKG+GFV F    E  +A+ E     + G
Sbjct: 160 NVTEAQLFELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNG 219

Query: 390 KPLYVAIAQR 399
           + + V    +
Sbjct: 220 RAIRVGTTSK 229

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/74 (21%), Positives = 31/74 (41%), Gaps = 6/74 (8%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +++G L   ++E  L   F P G +  +++          G  +V + D  +   AI ++
Sbjct: 318 VFIGGLSTLITEDELRSYFQPFGQIVYVKI------PVGKGCGFVQYVDRISAETAISKM 371

Query: 100 NYTPIKGRLCRIMW 113
              PI     R+ W
Sbjct: 372 QGFPIGNSRIRLSW 385

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 5/69 (7%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALN 187
           +FI  L   I    L   F  FG I+  KI        KG GFV + +  +A+ AI  + 
Sbjct: 318 VFIGGLSTLITEDELRSYFQPFGQIVYVKIPVG-----KGCGFVQYVDRISAETAISKMQ 372

Query: 188 GMLLNGQEI 196
           G  +    I
Sbjct: 373 GFPIGNSRI 381

>Scas_705.22
          Length = 869

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 81/175 (46%), Gaps = 12/175 (6%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGK------SKGFGFVHFEEEGAAK 180
           +IFIKNL+    +  L   F  F   + +++ T  + K      S GFGF  F  +  A 
Sbjct: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701

Query: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEET----KAHYTNLYVKNINSETTDEQFQ 236
             I AL+G +++G  I +   LS ++  S    +    K     + VKN+  E T +   
Sbjct: 702 AVISALDGTVIDGHRIQL--KLSHRQGSSNTTSSAKGKKIKSGKIIVKNLPFEATRKDVF 759

Query: 237 ELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291
           ELF  FG + S  + K  D   +GF FV +   ++A  A++ L    L G +L +
Sbjct: 760 ELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 814

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 53/97 (54%), Gaps = 3/97 (3%)

Query: 309 EAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFV 367
           E   +EK++K     LF++N+  +  ++   + F P+G +    V + T  GKSKGF ++
Sbjct: 316 EDIAMEKISKTG--RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYI 373

Query: 368 CFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRR 404
            F  P+EA +A  E ++QI  G+ L++  A  K   R
Sbjct: 374 LFKDPKEAVQAYIELDKQIFQGRLLHILPADAKKSHR 410

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 55/129 (42%), Gaps = 8/129 (6%)

Query: 78  SLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIK------ 131
           S+G+ +  F   E     I  L+ T I G   ++  S R  S     S            
Sbjct: 686 SMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTSSAKGKKIKSGKII 745

Query: 132 --NLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGM 189
             NL  +   K +++ F+ FG + S ++    +  ++GF FV F     A+ A+D L G+
Sbjct: 746 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGV 805

Query: 190 LLNGQEIYV 198
            L G+ + +
Sbjct: 806 HLLGRRLVM 814

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 82/182 (45%), Gaps = 14/182 (7%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLE-----KDADGKLK-GFGFVNYEKHEDA 272
            ++++KN+N  TT  +  + F  F   V A ++     K AD  L  GFGF  +   E A
Sbjct: 641 VSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQA 700

Query: 273 VKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDS 332
              + AL+ + ++G ++ +  + ++                 K  K +   + VKNL   
Sbjct: 701 NAVISALDGTVIDGHRIQLKLSHRQG--------SSNTTSSAKGKKIKSGKIIVKNLPFE 752

Query: 333 VDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392
              + + E F  +G + S +V +  +  ++GF FV F  P+EA  A+ +     + G+ L
Sbjct: 753 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812

Query: 393 YV 394
            +
Sbjct: 813 VM 814

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 37/73 (50%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++ ++  + +E     +F P G +  + V  D  T  S G+AY+ F D +   +A  +L
Sbjct: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388

Query: 100 NYTPIKGRLCRIM 112
           +    +GRL  I+
Sbjct: 389 DKQIFQGRLLHIL 401

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 125 SGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAI 183
           +G +F++N+            F  FG++    +A D   GKSKGF ++ F++   A +A 
Sbjct: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385

Query: 184 DALNGMLLNGQEIYVAPHLSRK 205
             L+  +  G+ +++ P  ++K
Sbjct: 386 IELDKQIFQGRLLHILPADAKK 407

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 6/102 (5%)

Query: 305 KKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGK---- 360
           K   E +  E +A    V++F+KNL+ +    +L + F  +     A+V    + K    
Sbjct: 624 KTSNEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADK 683

Query: 361 --SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 400
             S GFGF  F T E+A   I+  +  ++ G  + + ++ R+
Sbjct: 684 TLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQ 725

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 11/88 (12%)

Query: 219 TNLYVKNINSETTDEQFQELFAKF-----------GPIVSASLEKDADGKLKGFGFVNYE 267
           + + VK + S  TD+  ++ F K              I    + ++ +G+ + F F+ Y 
Sbjct: 2   SRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYH 61

Query: 268 KHEDAVKAVEALNDSELNGEKLYVGRAQ 295
             EDA  AV   N S +N  KL V  A+
Sbjct: 62  NEEDAFDAVNYFNGSYINTAKLEVSMAK 89

 Score = 32.7 bits (73), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 11/86 (12%)

Query: 324 LFVKNLDDSVDDEKLEEEFA----------PYGT-ITSAKVMRTENGKSKGFGFVCFSTP 372
           + VK L   + D+ L++ F           P  + IT  K++R   G+S+ F F+ +   
Sbjct: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63

Query: 373 EEATKAITEKNQQIVAGKPLYVAIAQ 398
           E+A  A+   N   +    L V++A+
Sbjct: 64  EDAFDAVNYFNGSYINTAKLEVSMAK 89

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 54  LYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGR 107
           ++++F+  G + S+RV +    K++ G+A+V F   +    A++QL    + GR
Sbjct: 758 VFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGR 810

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%)

Query: 152 ILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVA 199
           I   KI  +  G+S+ F F+ +  E  A +A++  NG  +N  ++ V+
Sbjct: 39  ITDVKILRNREGESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVS 86

>KLLA0D05016g complement(431592..432380) similar to sp|P25555
           Saccharomyces cerevisiae YCL011c GBP2 potential
           telomere-associated protein, start by similarity
          Length = 262

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 76/198 (38%), Gaps = 30/198 (15%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALN 187
           +F+  L   ++ + L D F   GD+L + + TD +GKS+GFG V+   +    +AI    
Sbjct: 64  VFVAQLPFSVNWQELKDMFKPCGDVLHADVVTDRDGKSRGFGTVYMATKEQQNDAIRHWT 123

Query: 188 GMLLNGQEIYV------------------APHLSRKERDSQLEETKAHYTNL-------- 221
           G    G+ + V                   P   R E  + L+        L        
Sbjct: 124 GTEYKGRVLDVKEGKGTSTRTAATGADTYIPRQPRNEPPATLKPKPLDIDPLAITTGGDR 183

Query: 222 ----YVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVE 277
               + +N+ S TT+    +LF    P++   L  + +G      +  +E  EDA   + 
Sbjct: 184 NSVIFCENMPSSTTESDLYDLFGSVAPVIITKLLLNPEGHFTRNSYCQFETPEDADICIS 243

Query: 278 ALNDSELNGEKLYVGRAQ 295
            L+       +L V  A+
Sbjct: 244 KLDKYSYGDHELKVTYAR 261

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 54/119 (45%)

Query: 261 FGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQ 320
            G V +    D   A+   + + LNG  ++V +       +             K A  +
Sbjct: 1   MGTVEFNNSTDVDTAIRDCDGAFLNGRAIFVRQDNPPPAEISRTGNNNGPPPPPKRAHDE 60

Query: 321 GVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAI 379
           G  +FV  L  SV+ ++L++ F P G +  A V+   +GKS+GFG V  +T E+   AI
Sbjct: 61  GFEVFVAQLPFSVNWQELKDMFKPCGDVLHADVVTDRDGKSRGFGTVYMATKEQQNDAI 119

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/264 (21%), Positives = 100/264 (37%), Gaps = 36/264 (13%)

Query: 168 FGFVHFEEEGAAKEAIDALNGMLLNGQEIYV------APHLSRKERDSQLEET--KAHYT 219
            G V F        AI   +G  LNG+ I+V         +SR   ++       +AH  
Sbjct: 1   MGTVEFNNSTDVDTAIRDCDGAFLNGRAIFVRQDNPPPAEISRTGNNNGPPPPPKRAHDE 60

Query: 220 N--LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVE 277
              ++V  +      ++ +++F   G ++ A +  D DGK +GFG V     E    A+ 
Sbjct: 61  GFEVFVAQLPFSVNWQELKDMFKPCGDVLHADVVTDRDGKSRGFGTVYMATKEQQNDAIR 120

Query: 278 ALNDSELNGEKL-------------------YVGRAQKKNERMHVLKKQYEAYRLEKMAK 318
               +E  G  L                   Y+ R Q +NE    LK +     ++ +A 
Sbjct: 121 HWTGTEYKGRVLDVKEGKGTSTRTAATGADTYIPR-QPRNEPPATLKPK--PLDIDPLAI 177

Query: 319 YQGVN----LFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEE 374
             G +    +F +N+  S  +  L + F     +   K++    G      +  F TPE+
Sbjct: 178 TTGGDRNSVIFCENMPSSTTESDLYDLFGSVAPVIITKLLLNPEGHFTRNSYCQFETPED 237

Query: 375 ATKAITEKNQQIVAGKPLYVAIAQ 398
           A   I++ ++       L V  A+
Sbjct: 238 ADICISKLDKYSYGDHELKVTYAR 261

>Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement
          Length = 396

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 85/171 (49%), Gaps = 30/171 (17%)

Query: 255 DGKL---KGFGFVNYEKHEDAVKAVEALNDSELNGEKL-------YVGRAQKKNERMHVL 304
           DGK    KGF ++++ K+++ + AV  L++S+LNG  +       Y GR  K +      
Sbjct: 166 DGKKIRNKGFAYMDF-KNKEQMNAVIGLSESQLNGRNMLIKNSSSYEGRPDKND------ 218

Query: 305 KKQYEAYRLEKMAKYQGVN-LFVKNLDDSVDDEKLEEEFAPYGTITSAKVMR-TENGKSK 362
                   L  M+K      LFV NL     DE L + F   G I   ++    ++GK K
Sbjct: 219 --------LIAMSKNPPSRILFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCK 270

Query: 363 GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ---RKDVRRSQLAQQ 410
           GF F+ F   +  T+A+T+K+ + +AG+PL +   +   ++ V+R + + Q
Sbjct: 271 GFAFIDFKDEKGPTEALTDKSCRKIAGRPLRMEFGEDRSKRQVKRRENSSQ 321

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 71/157 (45%), Gaps = 22/157 (14%)

Query: 80  GYAYVNFNDHEAGRKAI----EQLN--------YTPIKGRLCR---IMWSQRDPSLRKKG 124
           G+AY++F + E     I     QLN         +  +GR  +   I  S+  PS     
Sbjct: 174 GFAYMDFKNKEQMNAVIGLSESQLNGRNMLIKNSSSYEGRPDKNDLIAMSKNPPSRI--- 230

Query: 125 SGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT-DENGKSKGFGFVHFEEEGAAKEAI 183
              +F+ NL  D  ++ L   F   G+I+  ++AT  ++GK KGF F+ F++E    EA+
Sbjct: 231 ---LFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEAL 287

Query: 184 DALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTN 220
              +   + G+ + +     R +R  +  E  + Y N
Sbjct: 288 TDKSCRKIAGRPLRMEFGEDRSKRQVKRRENSSQYDN 324

 Score = 32.7 bits (73), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 36/76 (47%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+VG+L    ++  L   F   G +  +R+     +    G+A+++F D +   +A+   
Sbjct: 231 LFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEALTDK 290

Query: 100 NYTPIKGRLCRIMWSQ 115
           +   I GR  R+ + +
Sbjct: 291 SCRKIAGRPLRMEFGE 306

>CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces
           cerevisiae YBR212w Negative growth regulatory protein,
           hypothetical start
          Length = 802

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query: 40  LYVGDLEPSVSEAHLYDIF-SPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQ 98
           L+VGDL P+ +EA L  +F +   SV ++RV  D IT  S  + +V F + E  R+A+ +
Sbjct: 236 LFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALIE 295

Query: 99  LNYTPIKGRLCRIMWS 114
           +N    +GR  R+ ++
Sbjct: 296 MNGVHFQGRTLRVAYA 311

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 66/166 (39%), Gaps = 21/166 (12%)

Query: 80  GYAYVNFNDHEAGRKAIEQLNYTPIKG---------------RLCRIMWSQ---RDPSLR 121
           GY +V F   +  ++ +  LN TP+                 R  R+ W+       S+ 
Sbjct: 171 GYCFVEFESQKDAQEGLA-LNSTPLPNFVSTTTGQDINPTGQRTFRLNWASGATLQSSIP 229

Query: 122 KKGSGNIFIKNLHPDIDNKALYDTFSV-FGDILSSKIATDE-NGKSKGFGFVHFEEEGAA 179
                ++F+ +L P      L   F   F  + + ++ TD   G S+ FGFV F  E   
Sbjct: 230 TTPEYSLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEER 289

Query: 180 KEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKN 225
           + A+  +NG+   G+ + VA    R       +    H  ++ V+N
Sbjct: 290 RRALIEMNGVHFQGRTLRVAYATPRSTTVMHTQGNNPHDHHVDVRN 335

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 32/64 (50%), Gaps = 5/64 (7%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALN 187
           +F+  L P +  + L   F  FG+ILS KI        K  GFV FE +  A+ AI  L 
Sbjct: 469 VFVGGLGPTVQEQQLRKIFQPFGNILSIKIP-----PGKNCGFVKFEHKIDAEAAIQGLQ 523

Query: 188 GMLL 191
           G +L
Sbjct: 524 GFVL 527

 Score = 32.7 bits (73), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 79/177 (44%), Gaps = 27/177 (15%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEA 278
           T ++V  +     ++Q +++F  FG I+S  +        K  GFV +E   DA  A++ 
Sbjct: 467 TTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPG-----KNCGFVKFEHKIDAEAAIQG 521

Query: 279 LNDSEL--NGEKLYVGRAQKKNERMHVLKKQYEAY---RLEKMAKYQGVNLFVKNLDDSV 333
           L    L  N  +L  GR       ++ L  QY +    R E   +YQ  +  + N  +++
Sbjct: 522 LQGFVLVENPIRLSWGRNHVAKNMINKLPPQYVSSGNQRQELRPQYQDPSTMLAN--NNI 579

Query: 334 DDEKL---EEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIV 387
           +++      E+F P    +  +++    GK+  F     +T  ++   +TE +QQ +
Sbjct: 580 NNQAYTYQHEQFYP----SQQQIIY---GKTNDF-----ATKPDSLPLLTEVHQQGI 624

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRV 69
           ++VG L P+V E  L  IF P G++ SI++
Sbjct: 469 VFVGGLGPTVQEQQLRKIFQPFGNILSIKI 498

>CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces
           cerevisiae YOR319w essential yeast splicing factor,
           hypothetical start
          Length = 211

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (49%), Gaps = 14/165 (8%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +YVG+++  V++  LY++F+ +G V  ++  +D I++   G+A++ F         +  +
Sbjct: 8   IYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLNVM 67

Query: 100 -NYTPIKGRLCRIMWS----QRDPSLRKKG-------SGNIFIKNLHPDIDNKALYDTFS 147
            N   +  ++ +I  S    Q+D + +K            +F+K++   ++ + L   FS
Sbjct: 68  NNNVKLYQKVLKIRRSNQAVQKDDANKKHELDASLLPVAKVFVKDIADTVEVRHLTQLFS 127

Query: 148 VFGDILSS-KIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLL 191
            FG +  + ++ T  NG+ +   F++F+    A  AI  LNG  +
Sbjct: 128 KFGPLAKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFI 171

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 91/188 (48%), Gaps = 9/188 (4%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEAL 279
           +YV NI+++ T E   ELF + G +      KD    + +GF F+ +    DA   +  +
Sbjct: 8   IYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLNVM 67

Query: 280 NDS-ELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKL 338
           N++ +L  + L + R+ +  ++    KK      L  +AK     +FVK++ D+V+   L
Sbjct: 68  NNNVKLYQKVLKIRRSNQAVQKDDANKKHELDASLLPVAK-----VFVKDIADTVEVRHL 122

Query: 339 EEEFAPYGTIT-SAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIA 397
            + F+ +G +  + +V    NG+ +   F+ F   + A  AI   N Q +  K   +  A
Sbjct: 123 TQLFSKFGPLAKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFIMNKKASLEYA 181

Query: 398 QRKDVRRS 405
            +++ R++
Sbjct: 182 FKENGRKN 189

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 96/206 (46%), Gaps = 11/206 (5%)

Query: 126 GNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKS-KGFGFVHFEEEGAAKEAID 184
             I++ N+   +  + LY+ F+  G +   K   D+  +  +GF F+ F     A   ++
Sbjct: 6   ATIYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLN 65

Query: 185 ALNGMLLNGQEIYV------APHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQEL 238
            +N  +   Q++        A       +  +L+ +      ++VK+I          +L
Sbjct: 66  VMNNNVKLYQKVLKIRRSNQAVQKDDANKKHELDASLLPVAKVFVKDIADTVEVRHLTQL 125

Query: 239 FAKFGPIV-SASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKK 297
           F+KFGP+  +  +   ++G+++   F+ ++ +++A  A++ LN   +  +K  +  A K+
Sbjct: 126 FSKFGPLAKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFIMNKKASLEYAFKE 184

Query: 298 NERMHVLKKQYEAYR-LEKMAKYQGV 322
           N R + L+   EA R L K A+  G+
Sbjct: 185 NGRKN-LRYGTEADRILNKEARKNGI 209

>ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH]
           (140625..141752) [1128 bp, 375 aa]
          Length = 375

 Score = 54.7 bits (130), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 86/191 (45%), Gaps = 25/191 (13%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADG---------------KLKGFGFVN 265
           +++ N+  +TT E+ +         + A    DAD                K KGF +V+
Sbjct: 107 VWIGNMAFDTTQEELRRFVVSKTAGMEAGEVTDADIVRVNMPLAKNDGKQIKNKGFAYVD 166

Query: 266 YEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVN-L 324
           +      + AV  L++++LNG  L +  A+  + R            L  M+K      L
Sbjct: 167 FATSAQ-MDAVIGLSEAQLNGRNLLIKNAKSYDGR-------PAKNDLISMSKNPPSRIL 218

Query: 325 FVKNLDDSVDDEKLEEEFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKN 383
           FV NL     DE L++ F   G I   ++    ++GK KGF FV F     AT A+T+++
Sbjct: 219 FVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDRS 278

Query: 384 QQIVAGKPLYV 394
            + +AG+PL +
Sbjct: 279 CRAIAGRPLRM 289

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIAT-DENGKSKGFGFVHFEEEGAAKEAIDAL 186
           +F+ NL  D  ++ L   F   G+I+  ++AT  ++GK KGF FV F +E  A  A+   
Sbjct: 218 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDR 277

Query: 187 NGMLLNGQEIYV 198
           +   + G+ + +
Sbjct: 278 SCRAIAGRPLRM 289

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 34/76 (44%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+VG+L    ++  L   F   G +  IR+     +    G+A+V+F D      A+   
Sbjct: 218 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDR 277

Query: 100 NYTPIKGRLCRIMWSQ 115
           +   I GR  R+ + +
Sbjct: 278 SCRAIAGRPLRMEYGE 293

>YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated
           protein, essential for meiotic recombination, suppressor
           of mitochondrial splicing defects, has 3 RNA recognition
           (RRM) domains [1572 bp, 523 aa]
          Length = 523

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 102/219 (46%), Gaps = 28/219 (12%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVS-SIRVCRDAI----TKTSLG------YAYVNF-- 86
           LY+GDL+P+  +  +  I++ +G  + ++R+  +      +++S+G      Y +V+F  
Sbjct: 56  LYMGDLDPTWDKNTVRQIWASLGEANINVRMMWNNTLNNGSRSSMGPKNNQGYCFVDFPS 115

Query: 87  NDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPS--------LRKKGSGNIFIKNLHPDID 138
           + H A       +       +  ++ W+    S        ++   + +IF+ +L P++ 
Sbjct: 116 STHAANALLKNGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGNNCSIFVGDLAPNVT 175

Query: 139 NKALYDTF-SVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEI 196
              L++ F + +     +KI  D+  G SKG+GFV F      + A+  + G+ LNG+ I
Sbjct: 176 ESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGVFLNGRAI 235

Query: 197 YVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQF 235
            V P   +++  S   +     ++L     N+E  D +F
Sbjct: 236 KVGPTSGQQQHVSGNNDYNRSSSSL-----NNENVDSRF 269

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 2/76 (2%)

Query: 322 VNLFVKNLDDSVDDEKLEEEFAP-YGTITSAKVMRTE-NGKSKGFGFVCFSTPEEATKAI 379
            ++FV +L  +V + +L E F   Y + + AK++  +  G SKG+GFV F+  +E   A+
Sbjct: 163 CSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLAL 222

Query: 380 TEKNQQIVAGKPLYVA 395
           +E     + G+ + V 
Sbjct: 223 SEMQGVFLNGRAIKVG 238

 Score = 33.1 bits (74), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 52/253 (20%), Positives = 90/253 (35%), Gaps = 56/253 (22%)

Query: 164 KSKGFGFVHFEEEGAAKEAIDALNGMLL-----NGQEIYVAPHLSRKERDSQLEETKAHY 218
            ++G+ FV F     A  A+   NGML+        ++  A        +S       + 
Sbjct: 104 NNQGYCFVDFPSSTHAANAL-LKNGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGNN 162

Query: 219 TNLYVKNINSETTDEQFQELFA-KFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAV 276
            +++V ++    T+ Q  ELF  ++     A +  D   G  KG+GFV +   ++   A+
Sbjct: 163 CSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLAL 222

Query: 277 EALNDSELNGEKLYVG------------------RAQKKNE------------------- 299
             +    LNG  + VG                   +   NE                   
Sbjct: 223 SEMQGVFLNGRAIKVGPTSGQQQHVSGNNDYNRSSSSLNNENVDSRFLSKGQSFLSNGNN 282

Query: 300 -----RMHVLKKQYEAYRLEKMAKYQGVN---LFVKNLDDSVDDEKLEEEFAPYGTITSA 351
                R H+ +  Y   +   +  +   N   +F+  L   V +++L   F P+GTI   
Sbjct: 283 NMGFKRNHMSQFIYPVQQQPSLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYV 342

Query: 352 KVMRTENGKSKGF 364
           K+     GK  GF
Sbjct: 343 KI---PVGKCCGF 352

>KLLA0C08019g complement(704199..705104) some similarities with
           sp|Q00916 Saccharomyces cerevisiae YIL061c SNP1 U1 small
           nuclear ribonucleoprotein singleton, hypothetical start
          Length = 301

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 40/59 (67%)

Query: 323 NLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITE 381
            LFV  L  +VD+ +L++ F  YG I S +++R ++GKS+G+GFV F++ E++ +   E
Sbjct: 116 TLFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFRE 174

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDAL 186
            +F+  LH  +D   L  +F  +GDI S +I  D++GKS+G+GFV F     +K+    L
Sbjct: 116 TLFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFREL 175

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%)

Query: 218 YTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVE 277
           Y  L+V  ++    + + Q+ F K+G I S  + +D DGK +G+GFV +  +ED+ +   
Sbjct: 114 YRTLFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFR 173

Query: 278 AL 279
            L
Sbjct: 174 EL 175

>Scas_376.1
          Length = 404

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 103/217 (47%), Gaps = 37/217 (17%)

Query: 221 LYVKNINSETTDEQFQELFA------KFGPIVSASLEK------DADGKL---KGFGFVN 265
           +++ N+  +TT E+  +LF       + G +    + +        DGK    KGF +++
Sbjct: 129 VWIGNLTFDTTKEELIKLFTAKTRENEVGKVTEEDIVRVHMPLAHNDGKKIKNKGFCYMD 188

Query: 266 YEKHEDAVKAVEALNDSELNGE-------KLYVGRAQKKNERMHVLKKQYEAYRLEKMAK 318
           ++ +E  ++++  L++S+LNG        K Y GR  K N+ + + K      R+     
Sbjct: 189 FKTNE-QMESIIKLSESQLNGRNMLIKDSKSYEGRPDK-NDLVSLSKNP--PSRI----- 239

Query: 319 YQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATK 377
                LFV NL     DE L++ F   G I   ++    ++GK KGF F+ F + E AT 
Sbjct: 240 -----LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATN 294

Query: 378 AITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQAR 414
           A+ +K  + +A +P+ +   + +  R+ +    ++ R
Sbjct: 295 ALKDKTCRKIAARPIRMEYGEDRSKRQVKRRDPVEPR 331

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 77/169 (45%), Gaps = 26/169 (15%)

Query: 40  LYVGDLEPSVSEAHLYDIFSP------IGSVSSIRVCR--------DAITKTSLGYAYVN 85
           +++G+L    ++  L  +F+       +G V+   + R        D     + G+ Y++
Sbjct: 129 VWIGNLTFDTTKEELIKLFTAKTRENEVGKVTEEDIVRVHMPLAHNDGKKIKNKGFCYMD 188

Query: 86  FNDHEAGRKAIEQLNYTPIKGRLCRIMWSQR---DP------SLRKKGSGNI-FIKNLHP 135
           F  +E   ++I +L+ + + GR   I  S+     P      SL K     I F+ NL  
Sbjct: 189 FKTNEQ-MESIIKLSESQLNGRNMLIKDSKSYEGRPDKNDLVSLSKNPPSRILFVGNLSF 247

Query: 136 DIDNKALYDTFSVFGDILSSKIAT-DENGKSKGFGFVHFEEEGAAKEAI 183
           D  ++ L   F   G+I+  ++AT  ++GK KGF F+ F  E  A  A+
Sbjct: 248 DTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNAL 296

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 33/76 (43%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+VG+L    ++  L   F   G +  IR+     +    G+A+++F   E    A++  
Sbjct: 240 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALKDK 299

Query: 100 NYTPIKGRLCRIMWSQ 115
               I  R  R+ + +
Sbjct: 300 TCRKIAARPIRMEYGE 315

>ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH]
           (1024792..1025754) [963 bp, 320 aa]
          Length = 320

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 45/85 (52%), Gaps = 7/85 (8%)

Query: 314 EKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPE 373
           E+  +Y    L VK     V++ +L+E F+PYG +   K+M        GF FV F  PE
Sbjct: 29  EQEGEYSTTRLHVKPFPPDVEEHELDEIFSPYGALKEVKLM-------SGFAFVEFEKPE 81

Query: 374 EATKAITEKNQQIVAGKPLYVAIAQ 398
            A +AI + N ++ A  PL V+ ++
Sbjct: 82  SAEQAIKDVNGKMFADMPLTVSYSR 106

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 68/159 (42%), Gaps = 15/159 (9%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+V    P V E  L +IFSP G++  +++          G+A+V F   E+  +AI+ +
Sbjct: 39  LHVKPFPPDVEEHELDEIFSPYGALKEVKLMS--------GFAFVEFEKPESAEQAIKDV 90

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT 159
           N          + +S R P  R +    I I+NL   I  + L D      + L +   +
Sbjct: 91  NGKMFADMPLTVSYS-RMPMPRFR----IKIRNLPEGIAWQELKDLARE--NNLETTFLS 143

Query: 160 DENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
            +     G G + F  E   +EA++ LN     G  + V
Sbjct: 144 VDTSNFDGTGALEFSSEEILEEALEKLNNYEFRGNVLAV 182

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 72/166 (43%), Gaps = 20/166 (12%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALN 187
           + +K   PD++   L + FS +G +   K+ +       GF FV FE+  +A++AI  +N
Sbjct: 39  LHVKPFPPDVEEHELDEIFSPYGALKEVKLMS-------GFAFVEFEKPESAEQAIKDVN 91

Query: 188 GMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVS 247
           G +     + V+   SR                + ++N+      ++ ++L A+   + +
Sbjct: 92  GKMFADMPLTVS--YSR---------MPMPRFRIKIRNLPEGIAWQELKDL-ARENNLET 139

Query: 248 ASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGR 293
             L  D      G G + +   E   +A+E LN+ E  G  L V R
Sbjct: 140 TFLSVDTS-NFDGTGALEFSSEEILEEALEKLNNYEFRGNVLAVER 184

 Score = 35.8 bits (81), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 38/85 (44%), Gaps = 7/85 (8%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEA 278
           T L+VK    +  + +  E+F+ +G +    L       + GF FV +EK E A +A++ 
Sbjct: 37  TRLHVKPFPPDVEEHELDEIFSPYGALKEVKL-------MSGFAFVEFEKPESAEQAIKD 89

Query: 279 LNDSELNGEKLYVGRAQKKNERMHV 303
           +N        L V  ++    R  +
Sbjct: 90  VNGKMFADMPLTVSYSRMPMPRFRI 114

>KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces
           cerevisiae YMR268c PRP24 pre-mRNA splicing factor
           singleton, start by similarity
          Length = 432

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/263 (21%), Positives = 117/263 (44%), Gaps = 19/263 (7%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           + V +L P+ +   +   F   GS+  I V       + L  A + F+ ++    A+ + 
Sbjct: 39  VLVKNLPPNYNHHKVRRYFKTCGSILQIDVTDSTDGDSKL--ARIEFSSYDQALTAVSRT 96

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGD--ILSSKI 157
                   L +I + Q   ++ +     I++ N  P  D   L +  S + D  ILS ++
Sbjct: 97  --------LKKIGFHQ--ITVEQLTDSTIWVTNFPPGYDASKLRNLLSQYIDSPILSIRL 146

Query: 158 ATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAH 217
            +      + F +V       AK+A + LNG+ +N  ++ VA   +  ER  + +   + 
Sbjct: 147 PSLAFNSRRRFAYVDLVSPEVAKKATNRLNGIEINNYKL-VAKISNVNERTERTDNAISD 205

Query: 218 YTNLYVKNINSETTDEQFQELFAKFGPIVSASL---EKDADGKLKGFGFVNYEKHEDAVK 274
              + VKN+  + T +   ++F +FG    A +   ++   G+   + F+ ++    A  
Sbjct: 206 GREIIVKNLPDDITIDDLIKMFNEFGDTEKARIVTGDETNPGRHSRYAFITFKNKASADN 265

Query: 275 AVEALNDSELNGEKLYVGRAQKK 297
           A+ +LN + +NG+ L+V +  +K
Sbjct: 266 AL-SLNGAVMNGKPLHVSKVMRK 287

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 90/185 (48%), Gaps = 20/185 (10%)

Query: 40  LYVGDLEPSVSEAHLYDIFSP-IGS-VSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIE 97
           ++V +  P    + L ++ S  I S + SIR+   A   +   +AYV+    E  +KA  
Sbjct: 115 IWVTNFPPGYDASKLRNLLSQYIDSPILSIRLPSLAFN-SRRRFAYVDLVSPEVAKKATN 173

Query: 98  QLNYTPIKGRLCRIMWSQRDPSLRKKGSGN-------IFIKNLHPDIDNKALYDTFSVFG 150
           +LN   I     +++    + + R + + N       I +KNL  DI    L   F+ FG
Sbjct: 174 RLNGIEINN--YKLVAKISNVNERTERTDNAISDGREIIVKNLPDDITIDDLIKMFNEFG 231

Query: 151 DILSSKIAT-DEN--GKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKER 207
           D   ++I T DE   G+   + F+ F+ + +A  A+ +LNG ++NG+ +    H+S+  R
Sbjct: 232 DTEKARIVTGDETNPGRHSRYAFITFKNKASADNAL-SLNGAVMNGKPL----HVSKVMR 286

Query: 208 DSQLE 212
            + LE
Sbjct: 287 KAYLE 291

>Kwal_27.10364
          Length = 443

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 85/186 (45%), Gaps = 18/186 (9%)

Query: 125 SGNIFIKNLHPDIDNKALYDTFSVFG-DILSSKIATDENGKSKGFGFVHFEEEGAAKEAI 183
           +  +++ N  P      L   FS FG  +LS +  +      + F +V       AK  +
Sbjct: 116 NSTLWVTNYPPLFGELELQKLFSQFGGTVLSIRFPSLRYDSHRRFAYVDMASSEEAKLIV 175

Query: 184 DALNGMLLNGQEIYVA---PHLSRKERDSQLEETKAHYTNLYVKNINS-ETTDEQFQELF 239
           D L+G +++  E+ +    P  + K  DS + E +     +Y+KN++    ++E   + F
Sbjct: 176 DRLHGFVVDNHELIIKLSNPLKAEKRTDSDVLERR----QVYLKNLDYFRVSEEIISKSF 231

Query: 240 AKFGPIVSASLEKDADGKLK--------GFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291
           +K+G I   SL    +  L         GFGFV + +   A  +++ L+ SEL G K+ V
Sbjct: 232 SKYGHIERISLPHKEEPGLSGAEKRLNDGFGFVTFSESTSAASSLQ-LDGSELEGRKISV 290

Query: 292 GRAQKK 297
             A +K
Sbjct: 291 TLADRK 296

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 101/227 (44%), Gaps = 38/227 (16%)

Query: 208 DSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSA----SLEKDADGKLKGFGF 263
           D ++   ++  + L+V N      + + Q+LF++FG  V +    SL  D+  +   F +
Sbjct: 106 DQEIIVEQSQNSTLWVTNYPPLFGELELQKLFSQFGGTVLSIRFPSLRYDSHRR---FAY 162

Query: 264 VNYEKHEDAVKAVEALNDSELNGEKLYVG-----RAQKKNERMHVLKKQYEAYRLEKMAK 318
           V+    E+A   V+ L+   ++  +L +      +A+K+ +   + ++Q           
Sbjct: 163 VDMASSEEAKLIVDRLHGFVVDNHELIIKLSNPLKAEKRTDSDVLERRQ----------- 211

Query: 319 YQGVNLFVKNLDD-SVDDEKLEEEFAPYGTITSAKVMRTE----NGKSK----GFGFVCF 369
                +++KNLD   V +E + + F+ YG I    +   E    +G  K    GFGFV F
Sbjct: 212 -----VYLKNLDYFRVSEEIISKSFSKYGHIERISLPHKEEPGLSGAEKRLNDGFGFVTF 266

Query: 370 STPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQ 416
           S    A  ++     ++  G+ + V +A RK     Q  +++  R +
Sbjct: 267 SESTSAASSLQLDGSEL-EGRKISVTLADRKAYIERQAVKRLLHRKR 312

>Kwal_55.20972
          Length = 135

 Score = 49.3 bits (116), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 2/95 (2%)

Query: 123 KGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKE 181
           K    IF+  LH D+    +   FS +G  +  K+  D E+G+SKGF ++ +E++ +   
Sbjct: 31  KDQAYIFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVL 90

Query: 182 AIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKA 216
           A+D LNG+ + G+ I V  H     RD   +  +A
Sbjct: 91  AVDNLNGVKIAGRSIRV-DHTMFTPRDDDYDYARA 124

 Score = 46.2 bits (108), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 3/81 (3%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++VG L   ++E  +  IFS  G    +++ RD  +  S G+AY+ + D  +   A++ L
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNL 95

Query: 100 NYTPIKGRLCRI---MWSQRD 117
           N   I GR  R+   M++ RD
Sbjct: 96  NGVKIAGRSIRVDHTMFTPRD 116

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDAD-GKLKGFGFVNYEKHEDAVKAVEAL 279
           ++V  ++ + T+     +F+++G  V   L +D + G+ KGF ++ YE     V AV+ L
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNL 95

Query: 280 NDSELNGEKLYV 291
           N  ++ G  + V
Sbjct: 96  NGVKIAGRSIRV 107

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 324 LFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRT-ENGKSKGFGFVCFSTPEEATKAITEK 382
           +FV  L   + +  +   F+ YG     K++R  E+G+SKGF ++ +        A+   
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNL 95

Query: 383 NQQIVAGKPLYV 394
           N   +AG+ + V
Sbjct: 96  NGVKIAGRSIRV 107

>YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           and a glutamine-rich region [2019 bp, 672 aa]
          Length = 672

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 46/76 (60%), Gaps = 1/76 (1%)

Query: 40  LYVGDLEPSVSEAHLYDIF-SPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQ 98
           L+VGDL P+ +EA L  +F +   SV ++RV  D +T +S  + +V F D +  R+A+ +
Sbjct: 194 LFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDERRRALIE 253

Query: 99  LNYTPIKGRLCRIMWS 114
           ++    +GR  R+ ++
Sbjct: 254 MSGKWFQGRALRVAYA 269

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 7/94 (7%)

Query: 209 SQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEK 268
           S    T    T ++V  +  +TT+ Q + LF  FGPI++  +        K  GFV +EK
Sbjct: 350 SNTYNTDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNG-----KNCGFVKFEK 404

Query: 269 HEDAVKAVEALNDSELNGE--KLYVGRAQKKNER 300
             DA  +++ L    + G   +L  GR    N +
Sbjct: 405 RIDAEASIQGLQGFIVGGSPIRLSWGRPSSSNAK 438

 Score = 37.0 bits (84), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 5/72 (6%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALN 187
           +F+  L P      L   F  FG IL+ +I    NGK+   GFV FE+   A+ +I  L 
Sbjct: 362 VFVGGLVPKTTEFQLRSLFKPFGPILNVRIP---NGKN--CGFVKFEKRIDAEASIQGLQ 416

Query: 188 GMLLNGQEIYVA 199
           G ++ G  I ++
Sbjct: 417 GFIVGGSPIRLS 428

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 34/86 (39%), Gaps = 6/86 (6%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++VG L P  +E  L  +F P G + ++R+             +V F        +I+ L
Sbjct: 362 VFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGK------NCGFVKFEKRIDAEASIQGL 415

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGS 125
               + G   R+ W +   S  K  S
Sbjct: 416 QGFIVGGSPIRLSWGRPSSSNAKTNS 441

>KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 391

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 85/179 (47%), Gaps = 24/179 (13%)

Query: 246 VSASLEKDADGKL--KGFGFVNYEKHEDAVKAVEALNDSELNGEKL-------YVGRAQK 296
           ++  L K+ + KL  KGF ++++ K E  ++AV  L++S LNG  L       Y GR  K
Sbjct: 156 INMPLTKNDNKKLRNKGFAYIDF-KTEKQMEAVVGLSESALNGRNLLIKNAGSYEGRPDK 214

Query: 297 KNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRT 356
            +    V   +    R+          LFV NL     ++ L + F   G I   ++   
Sbjct: 215 ND---LVAASKNPPSRI----------LFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATF 261

Query: 357 EN-GKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQAR 414
           E+ GK KGF F+ F     AT A+ +K+ + +A +P+ +   + +  R+ +   ++ AR
Sbjct: 262 EDTGKCKGFAFIDFKDETGATNALKDKSCRKIASRPIRMEYGEDRSKRQVRRRPELDAR 320

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 56/120 (46%), Gaps = 22/120 (18%)

Query: 80  GYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRI---------------MWSQRDPSLRKKG 124
           G+AY++F   E   +A+  L+ + + GR   I               + + ++P  R   
Sbjct: 172 GFAYIDFK-TEKQMEAVVGLSESALNGRNLLIKNAGSYEGRPDKNDLVAASKNPPSRI-- 228

Query: 125 SGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT-DENGKSKGFGFVHFEEEGAAKEAI 183
              +F+ NL  D     L   F   G+I+  ++AT ++ GK KGF F+ F++E  A  A+
Sbjct: 229 ---LFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDFKDETGATNAL 285

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 34/76 (44%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+VG+L    +E  L   F   G +  IR+     T    G+A+++F D      A++  
Sbjct: 229 LFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDFKDETGATNALKDK 288

Query: 100 NYTPIKGRLCRIMWSQ 115
           +   I  R  R+ + +
Sbjct: 289 SCRKIASRPIRMEYGE 304

>YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleolar
           protein with similarity to Nsr1p, has two RNA
           recognition (RRM) domains [1212 bp, 403 aa]
          Length = 403

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 80/168 (47%), Gaps = 24/168 (14%)

Query: 257 KLKGFGFVNYEKHEDAVKAVEALNDSELNGEKL-------YVGRAQKKNERMHVLKKQYE 309
           K KGF ++ + K+ + +KAV  L++S LNG  +       Y GR  K +           
Sbjct: 181 KNKGFCYMFF-KNVEQMKAVLELSESHLNGRNMLIKDSENYSGRPDKDD----------- 228

Query: 310 AYRLEKMAKYQGVN-LFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTEN-GKSKGFGFV 367
              L  M+K      LFV NL   V D+ L + F   G I   ++   E+ GK KGF F+
Sbjct: 229 ---LVAMSKNPPSRILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFI 285

Query: 368 CFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARN 415
            F   E +T  + +K+ + +AG+PL +   + +  R+ +   +  +RN
Sbjct: 286 DFKNEEGSTNELKDKSCRKIAGRPLRMEYGEDRSKRQVRKKVENVSRN 333

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIAT-DENGKSKGFGFVHFE-EEGAAKEAID 184
           +F+ NL  D+ +  L   F   GDI+  ++AT +++GK KGF F+ F+ EEG+  E  D
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNELKD 299

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 72/142 (50%), Gaps = 6/142 (4%)

Query: 164 KSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAP---HLSRKERDSQLEETKAHYTN 220
           K+KGF ++ F+     K A+  L+   LNG+ + +     +  R ++D  +  +K   + 
Sbjct: 181 KNKGFCYMFFKNVEQMK-AVLELSESHLNGRNMLIKDSENYSGRPDKDDLVAMSKNPPSR 239

Query: 221 -LYVKNINSETTDEQFQELFAKFGPIVSASLEKDAD-GKLKGFGFVNYEKHEDAVKAVEA 278
            L+V N++ + TD+  ++ F   G IV   +    D GK KGF F++++  E +   ++ 
Sbjct: 240 ILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNELKD 299

Query: 279 LNDSELNGEKLYVGRAQKKNER 300
            +  ++ G  L +   + +++R
Sbjct: 300 KSCRKIAGRPLRMEYGEDRSKR 321

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 49/108 (45%), Gaps = 4/108 (3%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+VG+L   V++  L   F   G +  IR+     +    G+A+++F + E     ++  
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNELKDK 300

Query: 100 NYTPIKGRLCRIMWSQRDPSLR--KKGSGNIFIKNLHP-DIDNKALYD 144
           +   I GR  R+ + + D S R  +K   N+   N    DI N   YD
Sbjct: 301 SCRKIAGRPLRMEYGE-DRSKRQVRKKVENVSRNNSSSFDISNNKGYD 347

>KLLA0C05522g 494240..495862 some similarities with sp|P32831
           Saccharomyces cerevisiae YBR212w NGR1
           glucose-repressible RNA-binding protein, hypothetical
           start
          Length = 540

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 55/100 (55%), Gaps = 3/100 (3%)

Query: 40  LYVGDLEPSVSEAHLYDIF-SPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQ 98
           L+VGDL P  +EA L  +F +   SV ++RV  D IT  S  + +V F +    R A+ +
Sbjct: 161 LFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETERRNALIE 220

Query: 99  LNYTPIKGRLCRIMWSQ-RDPSLRKKGSGNIFIKNLHPDI 137
           +N    +GR  R+ ++  R+   ++  SGN+  + LH +I
Sbjct: 221 MNGVQFQGRQLRVAYATPRNNVAQQHLSGNLG-QQLHSNI 259

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 84/214 (39%), Gaps = 55/214 (25%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRD------AITKTSL-------------- 79
           L++GDL+P   E  +  I+  +G    +++ +        I  TS+              
Sbjct: 22  LWMGDLDPGFDELIIASIWQSLGKSVKVKLIKSKTNALVPINSTSIPNNASSNALEINGV 81

Query: 80  -------------GYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQR--DPSLRK-- 122
                        GY +V F   E  ++A+  LN TPI    C    S+R  D   RK  
Sbjct: 82  SFIDPNKTNLHHAGYCFVEFESFEDAQQALT-LNATPIPNISCNTTASKRTNDDGKRKFR 140

Query: 123 ----KGSG-----------NIFIKNLHPDIDNKALYDTFSV-FGDILSSKIATDE-NGKS 165
                G+            ++F+ +L P      L   F   +  + + ++ TD   G S
Sbjct: 141 LNWANGATLHSTILPTPEFSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGAS 200

Query: 166 KGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVA 199
           + FGFV F  E   + A+  +NG+   G+++ VA
Sbjct: 201 RCFGFVRFANETERRNALIEMNGVQFQGRQLRVA 234

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 5/75 (6%)

Query: 125 SGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAID 184
           S  +F+  L+P+I+   L++ F  FG I   KI        K  GFV + E   A+ AI+
Sbjct: 444 STTVFVGGLNPNINELQLFELFKPFGTITDVKIP-----PGKQCGFVKYNERLEAEAAIN 498

Query: 185 ALNGMLLNGQEIYVA 199
            L G ++ G  I ++
Sbjct: 499 GLQGFIIMGSPIRLS 513

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 36/74 (48%), Gaps = 6/74 (8%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++VG L P+++E  L+++F P G+++ +++             +V +N+      AI  L
Sbjct: 447 VFVGGLNPNINELQLFELFKPFGTITDVKI------PPGKQCGFVKYNERLEAEAAINGL 500

Query: 100 NYTPIKGRLCRIMW 113
               I G   R+ W
Sbjct: 501 QGFIIMGSPIRLSW 514

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 5/79 (6%)

Query: 317 AKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEAT 376
           A      +FV  L+ ++++ +L E F P+GTIT  K+        K  GFV ++   EA 
Sbjct: 440 AGVSSTTVFVGGLNPNINELQLFELFKPFGTITDVKI-----PPGKQCGFVKYNERLEAE 494

Query: 377 KAITEKNQQIVAGKPLYVA 395
            AI      I+ G P+ ++
Sbjct: 495 AAINGLQGFIIMGSPIRLS 513

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 32/77 (41%), Gaps = 7/77 (9%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEA 278
           T ++V  +N    + Q  ELF  FG I    +        K  GFV Y +  +A  A+  
Sbjct: 445 TTVFVGGLNPNINELQLFELFKPFGTITDVKIPPG-----KQCGFVKYNERLEAEAAING 499

Query: 279 LNDSELNGE--KLYVGR 293
           L    + G   +L  GR
Sbjct: 500 LQGFIIMGSPIRLSWGR 516

>Sklu_1790.3 YOL041C, Contig c1790 1701-3122
          Length = 473

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 2/83 (2%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +++G+L+    E +L+  FSP G V  IR+ RD+ T    G+AYV F D ++  KA+  L
Sbjct: 309 VFIGNLDFEELEENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKAL-LL 367

Query: 100 NYTPIKGRLCRIMWSQRDPSLRK 122
           N   I G   R +   R  ++RK
Sbjct: 368 NEKKINGN-GRKLRVSRCKNMRK 389

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 53/98 (54%), Gaps = 7/98 (7%)

Query: 323 NLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITE 381
           ++F+ NLD    +E L + F+P G +   +++R ++    KGF +V F   +   KA+  
Sbjct: 308 SVFIGNLDFEELEENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKALL- 366

Query: 382 KNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRY 419
            N++ + G    + +++ K++R+SQ AQ     N  RY
Sbjct: 367 LNEKKINGNGRKLRVSRCKNMRKSQPAQ-----NSSRY 399

>Scas_88.1
          Length = 256

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 342 FAPYGTITSAKV-MRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 400
           F+PYG +    V + T  G+SKGF ++ F  PE A  A  E ++QI  G+ L++  A+ K
Sbjct: 19  FSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIELDKQIFQGRLLHILPAEAK 78

Query: 401 DVRR 404
              R
Sbjct: 79  KSHR 82

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%)

Query: 57  IFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQR 116
           +FSP G +  + V  D  T  S G+AY+ F + E    A  +L+    +GRL  I+ ++ 
Sbjct: 18  LFSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIELDKQIFQGRLLHILPAEA 77

Query: 117 DPSLR 121
             S R
Sbjct: 78  KKSHR 82

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 99/239 (41%), Gaps = 47/239 (19%)

Query: 128 IFIKNLHPD-IDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDA 185
           +F+  +H   ID   L   FS +G++    +A D   G+SKGF ++ F+    A +A   
Sbjct: 3   LFVHFIHCKGIDFXQL---FSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIE 59

Query: 186 LNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLY-VKNINSETTDEQFQELFAKFGP 244
           L+  +  G+ +++ P           E  K+H  + + +KN+  +   E           
Sbjct: 60  LDKQIFQGRLLHILPA----------EAKKSHRLDEFDLKNLPLKKQRE----------- 98

Query: 245 IVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEA----LNDSELNGEKLYVGRAQKKNER 300
                L++ A+   + F + +   ++DAV +  A    +  SEL          ++    
Sbjct: 99  -----LKRKANASQQTFSWNSLYMNQDAVLSSVASKLGMEKSELIDPTNSGSAVKQALAE 153

Query: 301 MHVL---KKQYEA--YRLEKMAKYQG------VNLFVKNLDDSVDDEKLEEEFAPYGTI 348
            HV+   +K +E+    L K  +Y+         + VKN       E+L E F P+G +
Sbjct: 154 AHVIGDVRKFFESRGVDLTKFVEYKSPSERDECVMLVKNFPFGTTKEELAELFLPFGKL 212

>Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement
          Length = 188

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +Y G L   ++E  +  IFS  G    I++ RD  T+ S G+ Y+ + D  +   A++ L
Sbjct: 36  IYFGSLNKELTEGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNL 95

Query: 100 NYTPIKGRLCRI 111
           N   I GR  ++
Sbjct: 96  NGATIAGRTIKV 107

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 49/101 (48%), Gaps = 8/101 (7%)

Query: 202 LSRKERDSQLEETKAHYTN-------LYVKNINSETTDEQFQELFAKFGPIVSASLEKDA 254
           LS KE +  +   KA +         +Y  ++N E T+     +F+++G  V   L +D 
Sbjct: 10  LSEKELECGILSAKASWHKEYEEQAYIYFGSLNKELTEGDILTIFSQYGIPVDIKLVRDK 69

Query: 255 DGK-LKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRA 294
           + +  KGFG++ YE     V AV+ LN + + G  + V  A
Sbjct: 70  ETRESKGFGYLKYEDQRSTVLAVDNLNGATIAGRTIKVDHA 110

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDAL 186
           I+  +L+ ++    +   FS +G  +  K+  D E  +SKGFG++ +E++ +   A+D L
Sbjct: 36  IYFGSLNKELTEGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNL 95

Query: 187 NGMLLNGQEIYV 198
           NG  + G+ I V
Sbjct: 96  NGATIAGRTIKV 107

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 342 FAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
           F+ YG     K++R  E  +SKGFG++ +        A+   N   +AG+ + V
Sbjct: 54  FSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNLNGATIAGRTIKV 107

>KLLA0B10472g complement(914512..915108) similar to sgd|S0006099
           Saccharomyces cerevisiae YPL178w SAE1 small subunit of
           the nuclear cap-binding protein complex CBC, start by
           similarity
          Length = 198

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 54/95 (56%), Gaps = 9/95 (9%)

Query: 203 SRKERDSQLEETKAHY--TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLK- 259
           +R++ DS L++ +       +YV N++  T++EQ  ELF+K G I    +  D   + K 
Sbjct: 29  ARRDPDSGLQQLRKSMKSCTVYVGNLSFYTSEEQIYELFSKCGTIKKIIMGLD---RFKF 85

Query: 260 ---GFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291
              GF F+ ++K EDA+ +++ L D++L+   + +
Sbjct: 86  TPCGFCFIIFDKMEDALNSIKYLGDTKLDDRHITI 120

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 46/106 (43%), Gaps = 4/106 (3%)

Query: 2   ADITDKTAEQLENLNIQDDQKQAATGXXXXXXXXXXXXLYVGDLEPSVSEAHLYDIFSPI 61
            D  DK +  L    I+  ++   +G            +YVG+L    SE  +Y++FS  
Sbjct: 15  CDRLDKPSRYL----IRKARRDPDSGLQQLRKSMKSCTVYVGNLSFYTSEEQIYELFSKC 70

Query: 62  GSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGR 107
           G++  I +  D    T  G+ ++ F+  E    +I+ L  T +  R
Sbjct: 71  GTIKKIIMGLDRFKFTPCGFCFIIFDKMEDALNSIKYLGDTKLDDR 116

>CAGL0F08217g complement(814508..816544) similar to sp|P53316
           Saccharomyces cerevisiae YGR250c, hypothetical start
          Length = 678

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 7/88 (7%)

Query: 126 GNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDA 185
           GN+FI  +  ++    L +TF  FG I S KI  D   K+ G GF+ F     A E I  
Sbjct: 139 GNLFIGGIPKNMSLNTLMETFDKFGTISSLKILFD--NKNVGIGFLSFMLGSEAAECIRC 196

Query: 186 LNGMLL---NGQE--IYVAPHLSRKERD 208
           +NG  +   NG E  +++  H+ RKER+
Sbjct: 197 MNGTKIRSDNGDEGTLFINYHIERKERE 224

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 72/138 (52%), Gaps = 22/138 (15%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT--------------DEN---GKSKGFG 169
           NI++K++  D  +K L++ +  FG+I+S KI T              DE+   G S+G+G
Sbjct: 441 NIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGISRGYG 500

Query: 170 FVHFEEEGAAKEAIDALNGMLLNG--QEIYVAPHLSRKERDSQ--LEETKAHYTNLYVKN 225
           FV+F     A  AI + +G  L G  Q++ V+ +  +K++D Q  L+E+ ++ ++  + N
Sbjct: 501 FVYFANPLDAAYAILSTDGYYLEGAIQKLSVS-YAQKKKKDGQSLLDESLSNESSDQIDN 559

Query: 226 INSETTDEQFQELFAKFG 243
                  E+     AKFG
Sbjct: 560 SEKTNEKEKRNHSSAKFG 577

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 73/340 (21%), Positives = 128/340 (37%), Gaps = 76/340 (22%)

Query: 87  NDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALY--D 144
           N H  G+    +LN            WS  + S     +  +FI NL  DI N+  +  D
Sbjct: 248 NTHHRGKHNSPELN-----------SWSTNNSSDDLTINNCVFIGNLPTDIQNEGEFIDD 296

Query: 145 TFSVFGDI--LSSKIATDEN-GKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPH 201
               F  +  +S     D +  + KG+GF+  +    A+  I  ++         +   H
Sbjct: 297 LTEAFPSVTVISYYFPYDHSLNQYKGYGFIKLQNNDQARRIIHEISTDCFE----FCGNH 352

Query: 202 LSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGF 261
           +   +  ++  +T +H+T LY K   +ET  +       +  P           G +  F
Sbjct: 353 IIANKASNKDNKTTSHFT-LYTKT--TETNPKTRNNYLEQTSPYA---------GGINTF 400

Query: 262 GFVNYEKHEDAVKAVEALNDSELNGEKLY--VGRAQKKNERMHVLKKQYEAYRLEKMAKY 319
                           ++N+    G  LY  + R       ++ L    E          
Sbjct: 401 P--------------PSMNNYTF-GYDLYPPIKRGSHNLPYIYGLPVPLEGQ-------- 437

Query: 320 QGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVM---------RTEN--------GKSK 362
           Q  N++VK++     D+ L   + P+G I S K++         ++ N        G S+
Sbjct: 438 QESNIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGISR 497

Query: 363 GFGFVCFSTPEEATKAITEKNQQIVAG--KPLYVAIAQRK 400
           G+GFV F+ P +A  AI   +   + G  + L V+ AQ+K
Sbjct: 498 GYGFVYFANPLDAAYAILSTDGYYLEGAIQKLSVSYAQKK 537

 Score = 36.2 bits (82), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 308 YEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFV 367
           Y +  L   A     NLF+  +  ++    L E F  +GTI+S K++   + K+ G GF+
Sbjct: 125 YWSISLNTHALTHPGNLFIGGIPKNMSLNTLMETFDKFGTISSLKILF--DNKNVGIGFL 182

Query: 368 CFSTPEEATKAI 379
            F    EA + I
Sbjct: 183 SFMLGSEAAECI 194

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 216 AHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKA 275
            H  NL++  I    +     E F KFG I  +SL+   D K  G GF+++    +A + 
Sbjct: 136 THPGNLFIGGIPKNMSLNTLMETFDKFGTI--SSLKILFDNKNVGIGFLSFMLGSEAAEC 193

Query: 276 VEALNDSEL---NGEK--LYVGRAQKKNER 300
           +  +N +++   NG++  L++    ++ ER
Sbjct: 194 IRCMNGTKIRSDNGDEGTLFINYHIERKER 223

>YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein
           important for the synthesis of 25S pre-rRNA [1380 bp,
           459 aa]
          Length = 459

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++VG+L+    E  L+  F P G +  +R+ RD+ T    G+AYV F D ++  KA+  L
Sbjct: 281 IFVGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDLQSVNKAL-LL 339

Query: 100 NYTPIKG 106
           N  P+K 
Sbjct: 340 NEKPMKS 346

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 323 NLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAI 379
           ++FV NLD    +E L + F P G I   +++R ++    KGF +V F   +   KA+
Sbjct: 280 SIFVGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDLQSVNKAL 337

>YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in
           splicing and spliceosome assembly, has a role in sodium
           tolerance [447 bp, 148 aa]
          Length = 148

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 51/95 (53%), Gaps = 3/95 (3%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDAD-GKLKGFGFVNYEKHEDAVKAVEAL 279
           +Y+ N+N E T+     +F+++G  V   L +D + G+ +GF ++ YE     + AV+ L
Sbjct: 33  IYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNL 92

Query: 280 NDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLE 314
           N  ++ G  L +     + +R   L+K YEA + E
Sbjct: 93  NGFKIGGRALKIDHTFYRPKRS--LQKYYEAVKEE 125

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +Y+G+L   ++E  +  +FS  G    + + RD  T  S G+AY+ + D  +   A++ L
Sbjct: 33  IYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNL 92

Query: 100 NYTPIKGRLCRI 111
           N   I GR  +I
Sbjct: 93  NGFKIGGRALKI 104

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 49/89 (55%), Gaps = 1/89 (1%)

Query: 123 KGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDEN-GKSKGFGFVHFEEEGAAKE 181
           K +  I+I NL+ ++    +   FS +G  +   ++ DEN G+S+GF ++ +E++ +   
Sbjct: 28  KDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTIL 87

Query: 182 AIDALNGMLLNGQEIYVAPHLSRKERDSQ 210
           A+D LNG  + G+ + +     R +R  Q
Sbjct: 88  AVDNLNGFKIGGRALKIDHTFYRPKRSLQ 116

>CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces
           cerevisiae YIL061c SNP1 U1 small nuclear
           ribonucleoprotein, hypothetical start
          Length = 299

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 3/75 (4%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEA---I 183
            +F+  L  D D   L   F+ +G+I+  ++  D+  KS+G+ FV F+E  +A+     I
Sbjct: 116 TVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLFKETDSARVCTRDI 175

Query: 184 DALNGMLLNGQEIYV 198
               G+ +NG+   V
Sbjct: 176 GVHRGIQINGRRCIV 190

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 46/87 (52%), Gaps = 4/87 (4%)

Query: 208 DSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYE 267
           D+ + +T   Y  ++V  +  +T + Q Q++FAK+G IV   + +D   K +G+ FV ++
Sbjct: 105 DNHMRDTDP-YKTVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLFK 163

Query: 268 KHEDA---VKAVEALNDSELNGEKLYV 291
           + + A    + +      ++NG +  V
Sbjct: 164 ETDSARVCTRDIGVHRGIQINGRRCIV 190

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%)

Query: 323 NLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEA 375
            +FV  L    D+ +L++ FA YG I   +V+R +  KS+G+ FV F   + A
Sbjct: 116 TVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLFKETDSA 168

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 4/73 (5%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++VG L     E  L  +F+  G +  +RV RD   K S GYA+V F + ++ R     +
Sbjct: 117 VFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNK-SRGYAFVLFKETDSARVCTRDI 175

Query: 100 NY---TPIKGRLC 109
                  I GR C
Sbjct: 176 GVHRGIQINGRRC 188

>Sklu_2182.3 YDR432W, Contig c2182 3920-5035
          Length = 371

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 72/159 (45%), Gaps = 15/159 (9%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+V      V E+ L +IFSP G +  +++          G+A+V F + E+  KAI+++
Sbjct: 77  LFVRPFPFDVQESELNEIFSPFGPMKEVKILN--------GFAFVEFEESESAAKAIDEV 128

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT 159
           N      +   +++S+  P   +     + ++NL   +  + L D      + L +  ++
Sbjct: 129 NGKTFANQPLEVVYSKLPPQRFR-----MILRNLPEGVAWQELKDL--ARENNLETTFSS 181

Query: 160 DENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
               +  G G + F  E   +EA++ LN +   G  I V
Sbjct: 182 VNTREFDGTGALEFPTEEILEEALEKLNNIEFRGAVISV 220

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 7/75 (9%)

Query: 324 LFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKN 383
           LFV+     V + +L E F+P+G +   K++        GF FV F   E A KAI E N
Sbjct: 77  LFVRPFPFDVQESELNEIFSPFGPMKEVKIL-------NGFAFVEFEESESAAKAIDEVN 129

Query: 384 QQIVAGKPLYVAIAQ 398
            +  A +PL V  ++
Sbjct: 130 GKTFANQPLEVVYSK 144

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 43/88 (48%), Gaps = 7/88 (7%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEA 278
           T L+V+    +  + +  E+F+ FGP+    +       L GF FV +E+ E A KA++ 
Sbjct: 75  TRLFVRPFPFDVQESELNEIFSPFGPMKEVKI-------LNGFAFVEFEESESAAKAIDE 127

Query: 279 LNDSELNGEKLYVGRAQKKNERMHVLKK 306
           +N      + L V  ++   +R  ++ +
Sbjct: 128 VNGKTFANQPLEVVYSKLPPQRFRMILR 155

>CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces
           cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
           processing factor CF I, hypothetical start
          Length = 280

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 47/88 (53%), Gaps = 1/88 (1%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +Y+G +    +E  + D+ S +G V S+++  D+ T  S GYA+V + D E+   A+  L
Sbjct: 18  VYLGSIPYDQTEEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNL 77

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGN 127
           N   +  RL +  +S  +  +  +G GN
Sbjct: 78  NGYQLGSRLLKCGYS-SNSDITDQGVGN 104

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDAD-GKLKGFGFVNYEKHEDAVKAVEAL 279
           +Y+ +I  + T+EQ  +L +  GP+VS  +  D+  GK KG+ FV Y+  E +  AV  L
Sbjct: 18  VYLGSIPYDQTEEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNL 77

Query: 280 NDSELNGEKLYVG 292
           N  +L    L  G
Sbjct: 78  NGYQLGSRLLKCG 90

 Score = 35.8 bits (81), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDAL 186
           +++ ++  D   + + D  S  G ++S K+  D + GKSKG+ FV +++  ++  A+  L
Sbjct: 18  VYLGSIPYDQTEEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNL 77

Query: 187 NG 188
           NG
Sbjct: 78  NG 79

 Score = 29.6 bits (65), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 335 DEKLEEEFAPYGTITSAKVM-RTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLY 393
           +E++ +  +  G + S K+M  ++ GKSKG+ FV +   E +  A+   N   +  + L 
Sbjct: 29  EEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNLNGYQLGSRLLK 88

Query: 394 VAIAQRKDV 402
              +   D+
Sbjct: 89  CGYSSNSDI 97

>Sklu_2353.5 YIL061C, Contig c2353 10817-11575
          Length = 252

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +++G L   V+E  L   FS  G +  +RV RD  T  S GYA++ F D    R A +++
Sbjct: 59  VFIGRLPYEVTEVELQKHFSRFGEIEKVRVVRDKSTSKSRGYAFIVFRDETGSRAACKEI 118

 Score = 37.0 bits (84), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDEN-GKSKGFGFVHFEEEGAAKEA---I 183
           +FI  L  ++    L   FS FG+I   ++  D++  KS+G+ F+ F +E  ++ A   I
Sbjct: 59  VFIGRLPYEVTEVELQKHFSRFGEIEKVRVVRDKSTSKSRGYAFIVFRDETGSRAACKEI 118

Query: 184 DALNGMLLNGQEIYV 198
               G+ + G+ + V
Sbjct: 119 GVHRGLDIQGRSVIV 133

>KLLA0D13420g complement(1157491..1157991) some similarities with
           sp|P40565 Saccharomyces cerevisiae YIR005w IST3
           singleton, hypothetical start
          Length = 166

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 66/147 (44%), Gaps = 16/147 (10%)

Query: 109 CRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDEN-GKSKG 167
           C I+  +       K    I    +H ++    +   FS +G  +  K+  D+  GKSKG
Sbjct: 17  CGILKPESSWHHEYKDQAYINFGGMHLELTEADILTIFSQYGCPVDIKLVRDQTTGKSKG 76

Query: 168 FGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNIN 227
           FGF+ +E++ +   A+D LNG  + G+ I V     R   D      +A Y         
Sbjct: 77  FGFLKYEDQRSTILAVDNLNGAKVCGRLIRVDHAFYRPRSD------EAEY--------- 121

Query: 228 SETTDEQFQELFAKFGPIVSASLEKDA 254
            E   ++ ++ FAK G + S  +++++
Sbjct: 122 EEAVRQELEKDFAKTGDVPSEPMKQES 148

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 226 INSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEALNDSEL 284
           ++ E T+     +F+++G  V   L +D   GK KGFGF+ YE     + AV+ LN +++
Sbjct: 41  MHLELTEADILTIFSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKV 100

Query: 285 NGEKLYVGRA 294
            G  + V  A
Sbjct: 101 CGRLIRVDHA 110

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 342 FAPYGTITSAKVMRTEN-GKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
           F+ YG     K++R +  GKSKGFGF+ +        A+   N   V G+ + V
Sbjct: 54  FSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLIRV 107

>YMR268C (PRP24) [4222] chr13 complement(802887..804221) Pre-mRNA
           splicing factor, responsible for reannealing U4 and U6
           snRNAs to recycle snRNPs for subsequent splicing
           reactions, has 3 RNA recognition (RRM) domains [1335 bp,
           444 aa]
          Length = 444

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 85/182 (46%), Gaps = 18/182 (9%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVS-SIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQ 98
           L++ +  PS ++ ++ D+   I  V+ SIR+       TS  +AY++    E  R  +E+
Sbjct: 119 LWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFN-TSRRFAYIDVTSKEDARYCVEK 177

Query: 99  LN------YTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPD-IDNKALYDTFSVFGD 151
           LN      YT +      +  S+R  S   +G   I I+NL  + +D   L ++F  FG 
Sbjct: 178 LNGLKIEGYTLVTKVSNPLEKSKRTDSATLEGR-EIMIRNLSTELLDENLLRESFEGFGS 236

Query: 152 ILSSKIAT--DENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVA-----PHLSR 204
           I    I     E+  +    F+ FE + +A+ A+  +N  LL  +EI V+     P L R
Sbjct: 237 IEKINIPAGQKEHSFNNCCAFMVFENKDSAERALQ-MNRSLLGNREISVSLADKKPFLER 295

Query: 205 KE 206
            E
Sbjct: 296 NE 297

>CAGL0J01914g complement(189309..189818) similar to sp|P40565
           Saccharomyces cerevisiae YIR005w IST3, hypothetical
           start
          Length = 169

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 69/152 (45%), Gaps = 21/152 (13%)

Query: 94  KAIEQLNYTPIKGRLCR--IMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGD 151
           KAI+++N   ++  + +    W Q       K    IFI  L+  +    L   FS +G 
Sbjct: 5   KAIQRINEKELEAGILKPEHSWHQE-----YKDQAYIFIGGLNRQLTEGDLLTIFSQYGV 59

Query: 152 ILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQ 210
            +   +  D E  +SKGF F+ +E++ +   A+D LNG+ + G++I V  H+    RD  
Sbjct: 60  PVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNLNGITVAGRQIKV-DHIFFTPRDDI 118

Query: 211 LEETKA------------HYTNLYVKNINSET 230
            E T+A            H  +L   NI  ET
Sbjct: 119 PEYTEAVREFLSKDKIDIHKDHLSTDNIQKET 150

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 3/81 (3%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +++G L   ++E  L  IFS  G    + + RD  T  S G+A++ + D  +   A++ L
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNL 95

Query: 100 NYTPIKGRLCR---IMWSQRD 117
           N   + GR  +   I ++ RD
Sbjct: 96  NGITVAGRQIKVDHIFFTPRD 116

 Score = 35.8 bits (81), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADG-KLKGFGFVNYEKHEDAVKAVEAL 279
           +++  +N + T+     +F+++G  V   L +D +  + KGF F+ YE     + AV+ L
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNL 95

Query: 280 NDSELNGEKLYV 291
           N   + G ++ V
Sbjct: 96  NGITVAGRQIKV 107

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 52/123 (42%), Gaps = 20/123 (16%)

Query: 273 VKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDS 332
           +KA++ +N+ EL                  +LK ++  ++  K   Y    +F+  L+  
Sbjct: 4   IKAIQRINEKELEA---------------GILKPEHSWHQEYKDQAY----IFIGGLNRQ 44

Query: 333 VDDEKLEEEFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKP 391
           + +  L   F+ YG      ++R  E  +SKGF F+ +        A+   N   VAG+ 
Sbjct: 45  LTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNLNGITVAGRQ 104

Query: 392 LYV 394
           + V
Sbjct: 105 IKV 107

>CAGL0H04763g 454589..455740 highly similar to sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3, hypothetical
           start
          Length = 383

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 71/159 (44%), Gaps = 15/159 (9%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+V      V E+ L +IF P G++  +++          G+A+V F + E+  KAIE++
Sbjct: 107 LFVRPFPLDVQESELNEIFGPFGAMKEVKILN--------GFAFVEFEEAESASKAIEEV 158

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT 159
           N      +   +M+S+  P  R +    I +KNL      + L D      + L +  ++
Sbjct: 159 NGKTFANQPLEVMFSKM-PVKRFR----ITLKNLPEGCSWQELKDL--ARENNLETTFSS 211

Query: 160 DENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
             +    G G + F  E    +A++ LN +   G  I V
Sbjct: 212 VNSRDFDGTGALEFPTEEIMNDALEKLNNIEFRGSVISV 250

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 7/75 (9%)

Query: 324 LFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKN 383
           LFV+     V + +L E F P+G +   K++        GF FV F   E A+KAI E N
Sbjct: 107 LFVRPFPLDVQESELNEIFGPFGAMKEVKIL-------NGFAFVEFEEAESASKAIEEVN 159

Query: 384 QQIVAGKPLYVAIAQ 398
            +  A +PL V  ++
Sbjct: 160 GKTFANQPLEVMFSK 174

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 7/95 (7%)

Query: 212 EETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHED 271
           +E +   T L+V+    +  + +  E+F  FG +    +       L GF FV +E+ E 
Sbjct: 98  QEGELSNTRLFVRPFPLDVQESELNEIFGPFGAMKEVKI-------LNGFAFVEFEEAES 150

Query: 272 AVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKK 306
           A KA+E +N      + L V  ++   +R  +  K
Sbjct: 151 ASKAIEEVNGKTFANQPLEVMFSKMPVKRFRITLK 185

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 66/166 (39%), Gaps = 24/166 (14%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALN 187
           +F++    D+    L + F  FG +   KI         GF FV FEE  +A +AI+ +N
Sbjct: 107 LFVRPFPLDVQESELNEIFGPFGAMKEVKILN-------GFAFVEFEEAESASKAIEEVN 159

Query: 188 GMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAK--FGPI 245
           G     Q + V              +       + +KN+    + ++ ++L  +      
Sbjct: 160 GKTFANQPLEV-----------MFSKMPVKRFRITLKNLPEGCSWQELKDLARENNLETT 208

Query: 246 VSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291
            S+   +D DG     G + +   E    A+E LN+ E  G  + V
Sbjct: 209 FSSVNSRDFDGT----GALEFPTEEIMNDALEKLNNIEFRGSVISV 250

>KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4
           Ashbya gossypii Yib1, hypothetical start
          Length = 345

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 54/96 (56%), Gaps = 8/96 (8%)

Query: 201 HLSRKER-DSQLE-ETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSAS-LEKDADGK 257
           H SR ER + Q+E ++++    ++V NI +E T E  +E F   G +V  + L     G 
Sbjct: 87  HQSRAERLEKQIELDSRS----IFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGA 142

Query: 258 LKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGR 293
            KG+ ++ +E  +   KA+E L DSEL+GE + V +
Sbjct: 143 PKGYAYIEFESSDSIPKALE-LKDSELHGETINVAK 177

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 307 QYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTE-NGKSKGFG 365
           Q  A RLEK  +    ++FV N+      E LEE F   G +    ++  +  G  KG+ 
Sbjct: 88  QSRAERLEKQIELDSRSIFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPKGYA 147

Query: 366 FVCFSTPEEATKAITEKNQQIVAGKPLYVA 395
           ++ F + +   KA+  K+ ++  G+ + VA
Sbjct: 148 YIEFESSDSIPKALELKDSEL-HGETINVA 176

 Score = 32.3 bits (72), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 29/58 (50%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIE 97
           ++VG++    +   L + F   G V  + +  + +T    GYAY+ F   ++  KA+E
Sbjct: 105 IFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPKGYAYIEFESSDSIPKALE 162

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 125 SGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAI 183
           S +IF+ N+  +   + L + F   G+++   I  ++  G  KG+ ++ FE   +  +A+
Sbjct: 102 SRSIFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPKGYAYIEFESSDSIPKAL 161

Query: 184 DALNGMLLNGQEIYVA 199
           + L    L+G+ I VA
Sbjct: 162 E-LKDSELHGETINVA 176

>Scas_621.16
          Length = 314

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 53/111 (47%), Gaps = 4/111 (3%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +Y+G +    +E  + D+ + +G V ++++  D  T  S GYA++ F D E    AI  L
Sbjct: 46  VYLGSIPYDQTEEQILDLCNNVGPVINLKMMFDPQTGKSKGYAFIEFKDLETSASAIRNL 105

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFG 150
           N   +  R  +  +S  +  +    SGN+   N+   +DN   Y+  S  G
Sbjct: 106 NGYQLGSRFLKCGYSSNN-DISASSSGNVHEGNI---LDNDGSYENNSKMG 152

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 46/101 (45%), Gaps = 1/101 (0%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDA-DGKLKGFGFVNYEKHEDAVKAVEAL 279
           +Y+ +I  + T+EQ  +L    GP+++  +  D   GK KG+ F+ ++  E +  A+  L
Sbjct: 46  VYLGSIPYDQTEEQILDLCNNVGPVINLKMMFDPQTGKSKGYAFIEFKDLETSASAIRNL 105

Query: 280 NDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQ 320
           N  +L    L  G +   +         +E   L+    Y+
Sbjct: 106 NGYQLGSRFLKCGYSSNNDISASSSGNVHEGNILDNDGSYE 146

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDAL 186
           +++ ++  D   + + D  +  G +++ K+  D + GKSKG+ F+ F++   +  AI  L
Sbjct: 46  VYLGSIPYDQTEEQILDLCNNVGPVINLKMMFDPQTGKSKGYAFIEFKDLETSASAIRNL 105

Query: 187 NG 188
           NG
Sbjct: 106 NG 107

>KLLA0F07799g complement(734889..736463) similar to sp|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, start by
           similarity
          Length = 524

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++VG+L+    E  L+  F P G +  +R+ RD+ T    G+AYV F D ++  KA+   
Sbjct: 361 VFVGNLDFEEVEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKALLLH 420

Query: 100 NYTPIKGRLCRIMWSQRDPSLRK 122
                +G+  R +   R  ++RK
Sbjct: 421 EKKIHEGKKARKLRISRCKNMRK 443

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 54/101 (53%), Gaps = 2/101 (1%)

Query: 323 NLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITE 381
           ++FV NLD    +E L + F P G I   +++R ++    KGF +V F   +  +KA+  
Sbjct: 360 SVFVGNLDFEEVEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKALLL 419

Query: 382 KNQQIVAGKPLY-VAIAQRKDVRRSQLAQQIQARNQMRYQQ 421
             ++I  GK    + I++ K++R++Q  Q     N++  QQ
Sbjct: 420 HEKKIHEGKKARKLRISRCKNMRKAQGNQSSLQNNKLNDQQ 460

>Scas_701.3
          Length = 321

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 3/73 (4%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +++G L    +E  L  +F   G +  IR+ RD +T  S GYA++ F D  + + A +++
Sbjct: 108 IFIGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKEI 167

Query: 100 NY---TPIKGRLC 109
                  IKGR C
Sbjct: 168 GVHRGIDIKGRTC 180

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 14/93 (15%)

Query: 173 FEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTD 232
           FEE    KE I  +N  + N       PH      D  +++T   Y  +++  +  +TT+
Sbjct: 73  FEE--VEKERISKMNESIRNWD-----PH-----NDPNIKDTDP-YRTIFIGRLPYDTTE 119

Query: 233 EQFQELFAKFGPIVSASLEKDA-DGKLKGFGFV 264
            + Q+LF KFG I    + +D    K KG+ F+
Sbjct: 120 LELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFI 152

>KLLA0B00979g 77439..78467 some similarities with sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3 nucleolar protein
           singleton, hypothetical start
          Length = 342

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 70/160 (43%), Gaps = 17/160 (10%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+V    P V++A + +IF P G++  I++          G+A+V F + E+  +AI+ +
Sbjct: 54  LFVKPFPPDVTDAEMKEIFEPFGALKEIKILN--------GFAFVEFEEAESASQAIQNV 105

Query: 100 NYTPIKGRLCRIMWSQR-DPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIA 158
                      +++S++  P  R      + I+NL      + L D      + L +  +
Sbjct: 106 AGKMFADYPLEVVFSKKLKPRFR------VIIRNLPEGCAWQELKDL--ARDNQLETTFS 157

Query: 159 TDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
           +       G G + F  E   +EAI+ LN +   G  + V
Sbjct: 158 SVNTRDFDGTGALEFPTEEILQEAIEKLNNIEFRGSVLAV 197

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 7/88 (7%)

Query: 312 RLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFST 371
           R++   +     LFVK     V D +++E F P+G +   K++        GF FV F  
Sbjct: 42  RVDDDEELSDTRLFVKPFPPDVTDAEMKEIFEPFGALKEIKIL-------NGFAFVEFEE 94

Query: 372 PEEATKAITEKNQQIVAGKPLYVAIAQR 399
            E A++AI     ++ A  PL V  +++
Sbjct: 95  AESASQAIQNVAGKMFADYPLEVVFSKK 122

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 48/102 (47%), Gaps = 12/102 (11%)

Query: 203 SRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFG 262
           +R + D +L +T+     L+VK    + TD + +E+F  FG +    +       L GF 
Sbjct: 41  NRVDDDEELSDTR-----LFVKPFPPDVTDAEMKEIFEPFGALKEIKI-------LNGFA 88

Query: 263 FVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVL 304
           FV +E+ E A +A++ +         L V  ++K   R  V+
Sbjct: 89  FVEFEEAESASQAIQNVAGKMFADYPLEVVFSKKLKPRFRVI 130

>Kwal_26.7179
          Length = 456

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 42/76 (55%), Gaps = 4/76 (5%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAI--- 96
           ++VG+L+   +E +L+  F   G +  +R+ RD+ T    G+AYV F D +   KA+   
Sbjct: 295 VFVGNLDFEETEENLWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQTVNKALLLD 354

Query: 97  -EQLNYTPIKGRLCRI 111
            ++LN T  K R+ R 
Sbjct: 355 GQKLNGTGRKLRVTRC 370

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 61/130 (46%), Gaps = 12/130 (9%)

Query: 169 GFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINS 228
            +V + ++ A K A + LNG L     + V       + D++         +++V N++ 
Sbjct: 251 AYVVYADKAAVKIACEQLNGTLFQNHHLRVDSVTHPTQHDNK--------RSVFVGNLDF 302

Query: 229 ETTDEQFQELFAKFGPIVSASLEKDADGKL-KGFGFVNYEKHEDAVKAVEALNDSELN-- 285
           E T+E   + F K G I    L +D+   + KGF +V +   +   KA+  L+  +LN  
Sbjct: 303 EETEENLWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQTVNKAL-LLDGQKLNGT 361

Query: 286 GEKLYVGRAQ 295
           G KL V R +
Sbjct: 362 GRKLRVTRCK 371

 Score = 37.4 bits (85), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 54/113 (47%), Gaps = 4/113 (3%)

Query: 82  AYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKA 141
           AYV + D  A + A EQLN T  +    R+  S   P+ +     ++F+ NL  +   + 
Sbjct: 251 AYVVYADKAAVKIACEQLNGTLFQNHHLRVD-SVTHPT-QHDNKRSVFVGNLDFEETEEN 308

Query: 142 LYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNG 193
           L+  F   GDI   ++  D +    KGF +V F +     +A+  L+G  LNG
Sbjct: 309 LWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQTVNKAL-LLDGQKLNG 360

>ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH]
           complement(569855..569857,569915..570874) [963 bp, 320
           aa]
          Length = 320

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++VG L   V E  L   F   G +  +R+ RD IT    GYA+V F D E  +KA  ++
Sbjct: 109 IFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYREI 168

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEA--- 182
            IF+  LH D+D   L   F  FG+I   +I  D+   K +G+ FV F +   +K+A   
Sbjct: 108 TIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYRE 167

Query: 183 IDALNGMLLNGQEIYV 198
           I    G+++ G+   V
Sbjct: 168 IGVHRGLMIRGRSAIV 183

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 323 NLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTE-NGKSKGFGFVCFSTPEEATKAITE 381
            +FV  L   VD+ +L++ F  +G I   +++R +   K +G+ FV F  PE + KA  E
Sbjct: 108 TIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYRE 167

>CAGL0F01023g complement(108155..109345) similar to tr|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, hypothetical
           start
          Length = 396

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++VG+L+    E  L+  F   GS+  +R+ RD  T    G+AYV FN+ ++  KA+  L
Sbjct: 230 VFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQFNELQSVSKAL-LL 288

Query: 100 NYTPI 104
           N  P+
Sbjct: 289 NEKPM 293

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 47/86 (54%), Gaps = 10/86 (11%)

Query: 323 NLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRT-ENGKSKGFGFVCFSTPEEATKAITE 381
           ++FV NLD   D+E L + F   G+I   +++R  +    KGF +V F+  +  +KA+  
Sbjct: 229 SVFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQFNELQSVSKAL-- 286

Query: 382 KNQQIVAGKPLYVAIAQRKDVRRSQL 407
               ++  KP+   I+Q + +++ +L
Sbjct: 287 ----LLNEKPM---ISQNEHLKKRKL 305

>AGL038C [4273] [Homologous to ScYHL024W (RIM4) - SH]
           (639306..641444) [2139 bp, 712 aa]
          Length = 712

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 68/324 (20%), Positives = 127/324 (39%), Gaps = 69/324 (21%)

Query: 117 DP-SLRKKGSGNIFIKNLHPDIDNKALY----DTFSVFGDILSSKIATDENGKSKGFGFV 171
           DP + R + S  +F+ +L   + +  L     + F  +G++   K+  D + +   + FV
Sbjct: 151 DPKTWRGRPSSCVFVASLAASLTDDDLCVSVTEAFKKYGELSMVKVLRDPSNRP--YAFV 208

Query: 172 HFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINS--- 228
            +  +  AK A+    G LLNG+ I             + E+ K + T L++   N    
Sbjct: 209 QYTNDNDAKRALKQAQGTLLNGRTI-------------RCEKAKVNRT-LFISTRNRKAP 254

Query: 229 ETTDEQFQELFAKFGPIVSASLEKDADGKLKGF-------GFVNYEKHEDAVKAVEALND 281
           E T ++  +L + FG +      ++   K   +        FV +   +DA++A   L  
Sbjct: 255 EVTSDEIIQLCSSFGELEQLVASREYAFKKNYYPIDRSSAWFVQFAYRDDAIRAFINLKP 314

Query: 282 SELNGEKLYVGRAQKKN--ERMHVLKKQYEAYRLEKMAKYQGV----------------- 322
               G    V  AQ     +R+++L+K     R  K    +                   
Sbjct: 315 ----GYDWTVEWAQNIEVPKRLNLLRKT--KVRGTKSGNSESEEDEEEYEDEDEDEDDED 368

Query: 323 ------------NLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFS 370
                       ++FV  LD SV  EKL + F+ +G +    ++  +N  +K F F+ + 
Sbjct: 369 EDDSRDILIDKKSIFVSQLDPSVTKEKLTQRFSKHGKVEDVNLIFKDN-NTKVFAFIKYE 427

Query: 371 TPEEATKAITEKNQQIVAGKPLYV 394
           T E    A+  +N      + ++V
Sbjct: 428 TEEATATALERENHASFLNRTMHV 451

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 66/299 (22%), Positives = 115/299 (38%), Gaps = 74/299 (24%)

Query: 44  DLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTP 103
           DL  SV+EA     F   G +S ++V RD   +    YA+V + +    ++A++Q   T 
Sbjct: 176 DLCVSVTEA-----FKKYGELSMVKVLRDPSNRP---YAFVQYTNDNDAKRALKQAQGTL 227

Query: 104 IKGRLCRIMWSQRDPSLRKKGSGNIFIKNLH---PDIDNKALYDTFSVFGDILSSKIATD 160
           + GR  R          + K +  +FI   +   P++ +  +    S FG+ L   +A+ 
Sbjct: 228 LNGRTIRCE--------KAKVNRTLFISTRNRKAPEVTSDEIIQLCSSFGE-LEQLVASR 278

Query: 161 ENGKSKGF--------GFVHFEEEGAAKEAIDALNGMLLNGQEIYV--APHLSRKERDSQ 210
           E    K +         FV F     A  A   +N  L  G +  V  A ++   +R + 
Sbjct: 279 EYAFKKNYYPIDRSSAWFVQFAYRDDAIRAF--IN--LKPGYDWTVEWAQNIEVPKRLNL 334

Query: 211 LEETKAHYT-------------------------------------NLYVKNINSETTDE 233
           L +TK   T                                     +++V  ++   T E
Sbjct: 335 LRKTKVRGTKSGNSESEEDEEEYEDEDEDEDDEDEDDSRDILIDKKSIFVSQLDPSVTKE 394

Query: 234 QFQELFAKFGPIVSASLE-KDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291
           +  + F+K G +   +L  KD + K+  F F+ YE  E    A+E  N +      ++V
Sbjct: 395 KLTQRFSKHGKVEDVNLIFKDNNTKV--FAFIKYETEEATATALERENHASFLNRTMHV 451

>YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein with
           possible role in protein translation, has one RNA
           recognition (RRM) domain [753 bp, 250 aa]
          Length = 250

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 2/76 (2%)

Query: 125 SGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDEN-GKSKGFGFVHFEEEGAAKEAI 183
           S +IF+ N+ PD+  + + D F   G I    +  D N G  KG+G++ FE     ++A+
Sbjct: 63  SRSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAYREKAL 122

Query: 184 DALNGMLLNGQEIYVA 199
             LNG  L G++I V+
Sbjct: 123 -QLNGGELKGKKIAVS 137

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++VG++ P V+   + D F   G +  I +  D  T T  GY Y+ F +  A R+   QL
Sbjct: 66  IFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEF-ESPAYREKALQL 124

Query: 100 NYTPIKGR 107
           N   +KG+
Sbjct: 125 NGGELKGK 132

 Score = 36.2 bits (82), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 5/76 (6%)

Query: 305 KKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTEN-GKSKG 363
           K++  A++LE  ++    ++FV N+   V  E++E+ F   G I    ++   N G  KG
Sbjct: 51  KEEKHAHQLEADSR----SIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKG 106

Query: 364 FGFVCFSTPEEATKAI 379
           +G++ F +P    KA+
Sbjct: 107 YGYIEFESPAYREKAL 122

>Scas_709.2*
          Length = 171

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 72/154 (46%), Gaps = 12/154 (7%)

Query: 94  KAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDIL 153
           K+I+Q+N   ++     I+ +++    + K    I+I  L  ++    +   FS +G  +
Sbjct: 5   KSIQQINERELQ---SGILTTEQSWHYQYKDQAYIYIGGLDKELTEGDIISVFSQYGVPV 61

Query: 154 SSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLE 212
              +  D + G+SKGF F+ +E++ +   AID LNG+ +    I V  H   + RD Q +
Sbjct: 62  DLLLVNDNQTGESKGFAFLKYEDQRSTVLAIDNLNGVKVGSNTIQV-DHTFYEPRDEQWD 120

Query: 213 -------ETKAHYTNLYVKNINSETTDEQFQELF 239
                  E +  +    + N+ SET     +E F
Sbjct: 121 YRETMKNELEKDFVVRGIPNLPSETPSGSSKEAF 154

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 32/61 (52%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +Y+G L+  ++E  +  +FS  G    + +  D  T  S G+A++ + D  +   AI+ L
Sbjct: 36  IYIGGLDKELTEGDIISVFSQYGVPVDLLLVNDNQTGESKGFAFLKYEDQRSTVLAIDNL 95

Query: 100 N 100
           N
Sbjct: 96  N 96

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEAL 279
           +Y+  ++ E T+     +F+++G  V   L  D   G+ KGF F+ YE     V A++ L
Sbjct: 36  IYIGGLDKELTEGDIISVFSQYGVPVDLLLVNDNQTGESKGFAFLKYEDQRSTVLAIDNL 95

Query: 280 N 280
           N
Sbjct: 96  N 96

>ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH]
           complement(734486..735007) [522 bp, 173 aa]
          Length = 173

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 41/86 (47%), Gaps = 6/86 (6%)

Query: 212 EETKAHY-----TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDAD-GKLKGFGFVN 265
           EE   HY       ++   +N E T+     +F++FG      L +D + G+ +GFGF+ 
Sbjct: 22  EEASWHYQYKDQAYIHFSGLNVELTEGDILTVFSQFGVPTDLKLVRDRETGESRGFGFLK 81

Query: 266 YEKHEDAVKAVEALNDSELNGEKLYV 291
           YE     V AV+ LN   L G  L V
Sbjct: 82  YEDQRSTVLAVDNLNGVNLCGRVLKV 107

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (51%), Gaps = 2/87 (2%)

Query: 123 KGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKE 181
           K    I    L+ ++    +   FS FG     K+  D E G+S+GFGF+ +E++ +   
Sbjct: 31  KDQAYIHFSGLNVELTEGDILTVFSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVL 90

Query: 182 AIDALNGMLLNGQEIYVAPHLSRKERD 208
           A+D LNG+ L G+ + V  H   + RD
Sbjct: 91  AVDNLNGVNLCGRVLKV-DHCFYEPRD 116

 Score = 32.0 bits (71), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 342 FAPYGTITSAKVMRT-ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
           F+ +G  T  K++R  E G+S+GFGF+ +        A+   N   + G+ L V
Sbjct: 54  FSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNGVNLCGRVLKV 107

>Kwal_47.18572
          Length = 363

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 39/82 (47%), Gaps = 7/82 (8%)

Query: 322 VNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITE 381
             LFV+     V D +L E F P+G +   K++        GF FV F   + A +AI E
Sbjct: 82  TRLFVRPFPFDVQDSELNEIFGPFGPMKEVKIL-------NGFAFVEFEEADSAARAIEE 134

Query: 382 KNQQIVAGKPLYVAIAQRKDVR 403
            N +  A +PL V  ++ +  R
Sbjct: 135 VNGKTFANQPLEVVYSKVQPPR 156

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 46/101 (45%), Gaps = 9/101 (8%)

Query: 203 SRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFG 262
           +R+    +L + +   T L+V+    +  D +  E+F  FGP+    +       L GF 
Sbjct: 66  ARQPPSQRLMDGELSTTRLFVRPFPFDVQDSELNEIFGPFGPMKEVKI-------LNGFA 118

Query: 263 FVNYEKHEDAVKAVEALNDSELNGEKLYV--GRAQKKNERM 301
           FV +E+ + A +A+E +N      + L V   + Q    RM
Sbjct: 119 FVEFEEADSAARAIEEVNGKTFANQPLEVVYSKVQPPRYRM 159

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/157 (20%), Positives = 69/157 (43%), Gaps = 15/157 (9%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+V      V ++ L +IF P G +  +++          G+A+V F + ++  +AIE++
Sbjct: 84  LFVRPFPFDVQDSELNEIFGPFGPMKEVKILN--------GFAFVEFEEADSAARAIEEV 135

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT 159
           N      +   +++S+  P   +     + ++NL   +  + L D      + L +  ++
Sbjct: 136 NGKTFANQPLEVVYSKVQPPRYR-----MILRNLPDGVAWQELKDL--ARENNLETTFSS 188

Query: 160 DENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEI 196
               +  G G + F  E   ++A+  LN +   G  I
Sbjct: 189 VNTREFDGTGALEFPSEEILEDALQKLNNIEFRGSVI 225

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 7/71 (9%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALN 187
           +F++    D+ +  L + F  FG +   KI         GF FV FEE  +A  AI+ +N
Sbjct: 84  LFVRPFPFDVQDSELNEIFGPFGPMKEVKIL-------NGFAFVEFEEADSAARAIEEVN 136

Query: 188 GMLLNGQEIYV 198
           G     Q + V
Sbjct: 137 GKTFANQPLEV 147

>Scas_643.16
          Length = 448

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 50/103 (48%), Gaps = 13/103 (12%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKA--IE 97
           ++VG+L+    E +L++ F   G +  +R+ RD  T    G+AYV F + E+  KA  + 
Sbjct: 277 IFVGNLDFEEDEENLWNHFKSCGEIEYVRIIRDPKTNMGKGFAYVQFKELESVNKALLLN 336

Query: 98  QLNYTPI--------KGRLCRIMWSQRDPSLRKKGSGNIFIKN 132
           +   T I        KGR  R+    R  ++RK  +    IKN
Sbjct: 337 EKQMTKIKTDKDNKKKGRKLRVT---RCKNMRKSNNTVSNIKN 376

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 1/65 (1%)

Query: 324 LFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRT-ENGKSKGFGFVCFSTPEEATKAITEK 382
           +FV NLD   D+E L   F   G I   +++R  +    KGF +V F   E   KA+   
Sbjct: 277 IFVGNLDFEEDEENLWNHFKSCGEIEYVRIIRDPKTNMGKGFAYVQFKELESVNKALLLN 336

Query: 383 NQQIV 387
            +Q+ 
Sbjct: 337 EKQMT 341

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 39/71 (54%), Gaps = 9/71 (12%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDAL 186
           IF+ NL  + D + L++ F   G+I   +I  D +    KGF +V F+E       ++++
Sbjct: 277 IFVGNLDFEEDEENLWNHFKSCGEIEYVRIIRDPKTNMGKGFAYVQFKE-------LESV 329

Query: 187 N-GMLLNGQEI 196
           N  +LLN +++
Sbjct: 330 NKALLLNEKQM 340

>AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073)
           [933 bp, 310 aa]
          Length = 310

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDAL 186
           +F+  L+P      L   F+ FG + S +I  D ++G+S G+GFV F  + A + A   +
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 187 NGMLLNGQEIYV 198
           +G L++ + ++V
Sbjct: 292 DGALIDDRRVHV 303

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+V  L P    A L  +F+  G V+S+ + RD  +  SLGY +V F       KA  +L
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEF-----ATKAACEL 286

Query: 100 NYTPIKGRL 108
            YT + G L
Sbjct: 287 AYTKMDGAL 295

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 324 LFVKNLDDSVDDEKLEEEFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEK 382
           LFV  L+       L   FA +G + S +++R  ++G+S G+GFV F+T      A T+ 
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 383 NQQIVAGKPLYVAIAQ 398
           +  ++  + ++V  +Q
Sbjct: 292 DGALIDDRRVHVDFSQ 307

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 13/84 (15%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDAD-GKLKGFGFVNYEKHEDAVKAVEAL 279
           L+V  +N  T       +FA+FG + S  + +D D G+  G+GFV +     A KA   L
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEF-----ATKAACEL 286

Query: 280 NDSELNGEKLYVGRAQKKNERMHV 303
             ++++G       A   + R+HV
Sbjct: 287 AYTKMDG-------ALIDDRRVHV 303

>YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1
           snRNA-associated protein with RNA recognition (RRM)
           domain, homologous to human 70 kDa U1 snRNP protein [903
           bp, 300 aa]
          Length = 300

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 3/73 (4%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +++G L   + E  L   F   G +  IR+ +D IT+ S GYA++ F D  + + A +++
Sbjct: 109 IFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEI 168

Query: 100 NY---TPIKGRLC 109
                  IK R+C
Sbjct: 169 GVHRGIQIKDRIC 181

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAI 183
           IFI  L  D+D   L   F  FG+I   +I  D+   KSKG+ F+ F++  ++K A 
Sbjct: 109 IFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAF 165

>Kwal_26.7522
          Length = 262

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +Y+G +    +E  + D+ S +G V ++++  D  T  S GYA+V + D EA   A+  L
Sbjct: 14  VYLGSIPYDQTEEQILDLCSNVGPVVNLKMMFDPQTGKSKGYAFVEYKDLEASASAVRNL 73

Query: 100 NYTPIKGRLCRI 111
           N   +  RL + 
Sbjct: 74  NGYQLGNRLLKC 85

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 220 NLYVKNINSETTDEQFQELFAKFGPIVSASLEKDAD-GKLKGFGFVNYEKHEDAVKAVEA 278
            +Y+ +I  + T+EQ  +L +  GP+V+  +  D   GK KG+ FV Y+  E +  AV  
Sbjct: 13  TVYLGSIPYDQTEEQILDLCSNVGPVVNLKMMFDPQTGKSKGYAFVEYKDLEASASAVRN 72

Query: 279 LNDSELNGEKL 289
           LN  +L    L
Sbjct: 73  LNGYQLGNRLL 83

 Score = 35.4 bits (80), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 125 SGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAI 183
           S  +++ ++  D   + + D  S  G +++ K+  D + GKSKG+ FV +++  A+  A+
Sbjct: 11  SRTVYLGSIPYDQTEEQILDLCSNVGPVVNLKMMFDPQTGKSKGYAFVEYKDLEASASAV 70

Query: 184 DALNG 188
             LNG
Sbjct: 71  RNLNG 75

>Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement
          Length = 257

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +Y+G +    +E  + D+ S +G V+++++  D  T  S GYA+V + D EA   A+  L
Sbjct: 15  VYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLEASNSAVRNL 74

Query: 100 N 100
           N
Sbjct: 75  N 75

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDA-DGKLKGFGFVNYEKHEDAVKAVEAL 279
           +Y+ +I  + T+EQ  +L +  GP+ +  +  D   GK KG+ FV Y+  E +  AV  L
Sbjct: 15  VYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLEASNSAVRNL 74

Query: 280 NDSELNGEKLYVG 292
           N  +L    L  G
Sbjct: 75  NGYQLGNRFLKCG 87

 Score = 33.9 bits (76), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDAL 186
           +++ ++  D   + + D  S  G + + K+  D + GKSKG+ FV +++  A+  A+  L
Sbjct: 15  VYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLEASNSAVRNL 74

Query: 187 NG 188
           NG
Sbjct: 75  NG 76

>Scas_717.41
          Length = 379

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 42/86 (48%), Gaps = 8/86 (9%)

Query: 322 VNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITE 381
             LFV+     V + +L E F P+G +   K++        GF FV F   + A KAI E
Sbjct: 83  TRLFVRPFPFDVQEAELNEIFTPFGPMKEVKIL-------NGFAFVEFEEADSAAKAIEE 135

Query: 382 KNQQIVAGKPLYVAIAQRKDVRRSQL 407
            N +  A +PL V +  +  V+R +L
Sbjct: 136 VNGKTFANQPLEV-VYSKLPVKRYRL 160

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 7/73 (9%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEA 278
           T L+V+    +  + +  E+F  FGP+    +       L GF FV +E+ + A KA+E 
Sbjct: 83  TRLFVRPFPFDVQEAELNEIFTPFGPMKEVKI-------LNGFAFVEFEEADSAAKAIEE 135

Query: 279 LNDSELNGEKLYV 291
           +N      + L V
Sbjct: 136 VNGKTFANQPLEV 148

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 66/166 (39%), Gaps = 20/166 (12%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALN 187
           +F++    D+    L + F+ FG +   KI         GF FV FEE  +A +AI+ +N
Sbjct: 85  LFVRPFPFDVQEAELNEIFTPFGPMKEVKILN-------GFAFVEFEEADSAAKAIEEVN 137

Query: 188 GMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVS 247
           G     Q + V              +       L ++N+    + ++ ++L  +     +
Sbjct: 138 GKTFANQPLEVV-----------YSKLPVKRYRLTLRNLPEGCSWQELKDLAREHSLETT 186

Query: 248 ASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGR 293
            S     D    G G + +   E    A+E LN+ E  G  + V R
Sbjct: 187 FSSVNTRD--FDGTGALEFANEETLDTALEKLNNIEFRGSVITVER 230

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 68/159 (42%), Gaps = 15/159 (9%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+V      V EA L +IF+P G +  +++          G+A+V F + ++  KAIE++
Sbjct: 85  LFVRPFPFDVQEAELNEIFTPFGPMKEVKILN--------GFAFVEFEEADSAAKAIEEV 136

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT 159
           N      +   +++S+  P  R +    + ++NL      + L D        L +  ++
Sbjct: 137 NGKTFANQPLEVVYSKL-PVKRYR----LTLRNLPEGCSWQELKDLAREHS--LETTFSS 189

Query: 160 DENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
                  G G + F  E     A++ LN +   G  I V
Sbjct: 190 VNTRDFDGTGALEFANEETLDTALEKLNNIEFRGSVITV 228

>Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement
          Length = 309

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 58/126 (46%), Gaps = 19/126 (15%)

Query: 128 IFIKNLHPDIDNKAL------YDTFSVFGDILSSKIATDENGKSK--GFGFVHFEEEGAA 179
           ++I NL  D     L      Y+  SV   I S  I    N + +  G  +  FE    A
Sbjct: 24  VYISNLSFDTTEDELTGYLLEYNVLSVL--IPSQTIRGFRNSRVRPLGIAYADFESADKA 81

Query: 180 KEAIDALNGMLLNGQEIYVAPH-------LSRKERDSQLEETKAHYTNLYVKNINSETTD 232
           KEAI+ALNG + N + + + P+       +SRK   +  EE++  ++ L VK   S +  
Sbjct: 82  KEAIEALNGKVFNNRTLRLKPYVAYSPAVVSRKPSKANKEESR--FSKLKVKKSTSVSPV 139

Query: 233 EQFQEL 238
            + QEL
Sbjct: 140 SEEQEL 145

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 7/78 (8%)

Query: 40  LYVGDLEPSVSEAHL------YDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93
           +Y+ +L    +E  L      Y++ S +    +IR  R++  +  LG AY +F   +  +
Sbjct: 24  VYISNLSFDTTEDELTGYLLEYNVLSVLIPSQTIRGFRNSRVR-PLGIAYADFESADKAK 82

Query: 94  KAIEQLNYTPIKGRLCRI 111
           +AIE LN      R  R+
Sbjct: 83  EAIEALNGKVFNNRTLRL 100

>YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved in
           18S and 25S rRNA processing, export of RNA from the
           nucleus, import of proteins into the nucleus, associated
           with U1 snRNP, has 2 RNA recognition (RRM) domains [1245
           bp, 414 aa]
          Length = 414

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 70/159 (44%), Gaps = 15/159 (9%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L+V      V E+ L +IF P G +  +++          G+A+V F + E+  KAIE++
Sbjct: 127 LFVRPFPLDVQESELNEIFGPFGPMKEVKILN--------GFAFVEFEEAESAAKAIEEV 178

Query: 100 NYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIAT 159
           +      +   +++S+  P+ R +    I +KNL      + L D      + L +  ++
Sbjct: 179 HGKSFANQPLEVVYSKL-PAKRYR----ITMKNLPEGCSWQDLKDL--ARENSLETTFSS 231

Query: 160 DENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198
                  G G + F  E    EA++ LN +   G  I V
Sbjct: 232 VNTRDFDGTGALEFPSEEILVEALERLNNIEFRGSVITV 270

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 7/77 (9%)

Query: 322 VNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITE 381
             LFV+     V + +L E F P+G +   K++        GF FV F   E A KAI E
Sbjct: 125 TRLFVRPFPLDVQESELNEIFGPFGPMKEVKIL-------NGFAFVEFEEAESAAKAIEE 177

Query: 382 KNQQIVAGKPLYVAIAQ 398
            + +  A +PL V  ++
Sbjct: 178 VHGKSFANQPLEVVYSK 194

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 41/88 (46%), Gaps = 7/88 (7%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEA 278
           T L+V+    +  + +  E+F  FGP+    +       L GF FV +E+ E A KA+E 
Sbjct: 125 TRLFVRPFPLDVQESELNEIFGPFGPMKEVKI-------LNGFAFVEFEEAESAAKAIEE 177

Query: 279 LNDSELNGEKLYVGRAQKKNERMHVLKK 306
           ++      + L V  ++   +R  +  K
Sbjct: 178 VHGKSFANQPLEVVYSKLPAKRYRITMK 205

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 69/168 (41%), Gaps = 24/168 (14%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALN 187
           +F++    D+    L + F  FG +   KI         GF FV FEE  +A +AI+ ++
Sbjct: 127 LFVRPFPLDVQESELNEIFGPFGPMKEVKILN-------GFAFVEFEEAESAAKAIEEVH 179

Query: 188 GMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAK--FGPI 245
           G     Q + V              +  A    + +KN+    + +  ++L  +      
Sbjct: 180 GKSFANQPLEVV-----------YSKLPAKRYRITMKNLPEGCSWQDLKDLARENSLETT 228

Query: 246 VSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGR 293
            S+   +D DG     G + +   E  V+A+E LN+ E  G  + V R
Sbjct: 229 FSSVNTRDFDGT----GALEFPSEEILVEALERLNNIEFRGSVITVER 272

>Scas_530.4
          Length = 684

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 65/334 (19%), Positives = 128/334 (38%), Gaps = 65/334 (19%)

Query: 117 DPSLRKKGSGNIFI----KNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVH 172
           +P+ R + S  +F+     NLH D    ++ D F  FG+I+  K+  D+   ++ + FV 
Sbjct: 132 EPTFRGRPSSCVFVASLASNLHDDELCLSVTDYFKKFGEIIRVKVLRDQ--ANRPYAFVQ 189

Query: 173 FEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTD 232
           +  +  A  A+   +G +LNG+ +             + E  + + T L++ + NS    
Sbjct: 190 YTNDNDANVALKEAHGSILNGRRL-------------RCERARVNRT-LFITH-NSPIEL 234

Query: 233 EQFQELFAKFGPIVSASLEKDADGKLK---------GFGFVNYEKHEDAVKAVEAL---- 279
            +   +  KFG +     ++D +  ++            F  +   +DA++A   L    
Sbjct: 235 FEVHAICRKFGELDQLVPKRDDNPFMRRCSYPISNSSSWFAQFTFRDDAIRAFANLKTDS 294

Query: 280 --------------------NDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKY 319
                                DS ++ E +    +Q+                  +    
Sbjct: 295 NWAVQWAQNIRVPKFFNLLNKDSPMDKENITNFNSQEDGADTDPTHDNNLNNDNMQPVTI 354

Query: 320 QGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKG-FGFVCFSTPEEATKA 378
              ++FV  L +   +E L+  F+ +G I    ++     K K  F F+ + T   A  A
Sbjct: 355 DKKSIFVGQLPEETTEEVLKIHFSKHGKILDLNLIH----KPKNVFAFIQYETENAAAIA 410

Query: 379 ITEKNQQIVAGKPLYV------AIAQRKDVRRSQ 406
           +  +N  I   K ++V       I  R++ +RSQ
Sbjct: 411 LETENHSIFISKTIHVQYKEIGGIHGRRNSKRSQ 444

>AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH]
           complement(345624..346280) [657 bp, 218 aa]
          Length = 218

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 56/99 (56%), Gaps = 11/99 (11%)

Query: 201 HLSRKERDSQ--LEETKAHYTN--LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADG 256
           +L RK R +   LEE +   T+  +YV N++  T++EQ  ELF+K G I    +  D   
Sbjct: 24  YLKRKARKTPGGLEELRKSMTSATIYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLD--- 80

Query: 257 KLK----GFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291
           + K    GF F+ Y+  ++A+ A++ L+ ++L+  ++ +
Sbjct: 81  RFKFTPCGFCFIIYQTPQEALAALKYLSKTKLDDREITI 119

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +YVG+L    SE  LY++FS  GS+  I +  D    T  G+ ++ +   +    A++ L
Sbjct: 48  IYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFKFTPCGFCFIIYQTPQEALAALKYL 107

Query: 100 NYTPIKGR 107
           + T +  R
Sbjct: 108 SKTKLDDR 115

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 4/70 (5%)

Query: 313 LEKMAK-YQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGK--SKGFGFVCF 369
           LE++ K      ++V NL     +E+L E F+  G+I    +M  +  K    GF F+ +
Sbjct: 36  LEELRKSMTSATIYVGNLSFYTSEEQLYELFSKCGSIEKI-IMGLDRFKFTPCGFCFIIY 94

Query: 370 STPEEATKAI 379
            TP+EA  A+
Sbjct: 95  QTPQEALAAL 104

>Kwal_33.13496
          Length = 330

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDAL 186
           +FI  L+P    K L   FS FG I   +I  D E G S  +GF+ F  + + + A   +
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKM 308

Query: 187 NGMLLNGQEIYV 198
            G+L++ + I+V
Sbjct: 309 EGVLIDDRRIHV 320

 Score = 36.6 bits (83), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 33/76 (43%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           L++  L P      L  IFS  G++  + + RD  T  SL Y ++ F +  +   A  ++
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKM 308

Query: 100 NYTPIKGRLCRIMWSQ 115
               I  R   + + Q
Sbjct: 309 EGVLIDDRRIHVDFCQ 324

>Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement
          Length = 207

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 55/99 (55%), Gaps = 11/99 (11%)

Query: 201 HLSRKERDSQ--LEETKAHYTN--LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADG 256
           +L RK R +   LE+ +   ++  +YV N++  T++EQ  ELF+K G I    +  D   
Sbjct: 24  YLIRKARKNPHGLEDLRKSMSSATIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLD--- 80

Query: 257 KLK----GFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291
           + K    GF FV Y   ++A+ AV+ L+D++L+   + +
Sbjct: 81  RFKFTPCGFCFVIYNTPKEALSAVKYLSDTKLDDRHISI 119

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 36/68 (52%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +YVG+L    SE  +Y++FS  G++  I +  D    T  G+ +V +N  +    A++ L
Sbjct: 48  IYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFVIYNTPKEALSAVKYL 107

Query: 100 NYTPIKGR 107
           + T +  R
Sbjct: 108 SDTKLDDR 115

>YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component of
           pre-mRNA cleavage and polyadenylation factor I (CFI),
           involved in poly(A) site choice, interacts with Rna14p,
           Pap1p, and Pcf11p, contains one RNA recognition (RRM)
           domain [891 bp, 296 aa]
          Length = 296

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +Y+G +    +E  + D+ S +G V ++++  D  T  S GYA++ F D E+   A+  L
Sbjct: 20  VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNL 79

Query: 100 NYTPIKGRLCRIMWS 114
           N   +  R  +  +S
Sbjct: 80  NGYQLGSRFLKCGYS 94

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDAD-GKLKGFGFVNYEKHEDAVKAVEAL 279
           +Y+ +I  + T+EQ  +L +  GP+++  +  D   G+ KG+ F+ +   E +  AV  L
Sbjct: 20  VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNL 79

Query: 280 NDSELNGEKLYVG 292
           N  +L    L  G
Sbjct: 80  NGYQLGSRFLKCG 92

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDAL 186
           +++ ++  D   + + D  S  G +++ K+  D + G+SKG+ F+ F +  ++  A+  L
Sbjct: 20  VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNL 79

Query: 187 NG 188
           NG
Sbjct: 80  NG 81

>CAGL0H02211g 200049..201194 similar to sp|P49960 Saccharomyces
           cerevisiae YMR268c PRP24 pre-mRNA splicing factor,
           hypothetical start
          Length = 381

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 75/157 (47%), Gaps = 23/157 (14%)

Query: 259 KGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAK 318
           + F +V+    E   KA++ LN  ++NG KL V ++  +N       K+ +A  LE+   
Sbjct: 141 RRFAYVDLPNMESLDKAIQLLNGKDINGYKLVVKKSNPENR-----DKRSDAPVLERRE- 194

Query: 319 YQGVNLFVKNLDDS-VDDEKLEEEFAPYGTITSAKVMRTE----NGKSKGFGFVCFSTPE 373
                + ++NL  + +  + L + F  YG I   ++ + +    +  + G  FV ++ PE
Sbjct: 195 -----IIIRNLPKTMLVKDTLLDIFKKYGAIDDLRIPKKQLEMLSDLNHGCAFVVYTNPE 249

Query: 374 EATKAITEKNQQIVAGKPLYVAIA------QRKDVRR 404
           +A  A+ E N  ++    + V ++      +RK+V R
Sbjct: 250 DAKSAL-EMNNHVIDDIKISVNLSDSHAYLERKEVNR 285

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 69/158 (43%), Gaps = 11/158 (6%)

Query: 144 DTFSVFGD----ILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVA 199
           D  ++F D     L+ ++ +     ++ F +V      +  +AI  LNG  +NG ++ V 
Sbjct: 115 DIRNIFKDHKIVALNVRLPSLRFNSNRRFAYVDLPNMESLDKAIQLLNGKDINGYKLVVK 174

Query: 200 PHLSRKERDSQLEETKAHYTNLYVKNI-NSETTDEQFQELFAKFGPIVSASLEKDADGKL 258
              + + RD + +        + ++N+  +    +   ++F K+G I    + K     L
Sbjct: 175 KS-NPENRDKRSDAPVLERREIIIRNLPKTMLVKDTLLDIFKKYGAIDDLRIPKKQLEML 233

Query: 259 K----GFGFVNYEKHEDAVKAVEALNDSELNGEKLYVG 292
                G  FV Y   EDA  A+E +N+  ++  K+ V 
Sbjct: 234 SDLNHGCAFVVYTNPEDAKSALE-MNNHVIDDIKISVN 270

>YNL286W (CUS2) [4325] chr14 (95221..96078) Suppressor of U2 snRNA
           mutations and homolog of human Tat-SF1 protein, contains
           two RNA recognition motif (RRM) domains [858 bp, 285 aa]
          Length = 285

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 53/113 (46%), Gaps = 17/113 (15%)

Query: 207 RDSQLEETKAHYTN------LYVKNI-NSETTDEQFQELFAKFGPIVS-------ASLEK 252
           ++S L++ +  Y N      +Y+  +   +TT E   E F K+G I +         L  
Sbjct: 27  KESNLQKRELEYNNASKNTSIYISGLPTDKTTKEGLTEQFCKYGMIRTNRDGEPLCKLYV 86

Query: 253 DADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQ---KKNERMH 302
           +  G  KG   + Y K E    A+E +N+S   G+++ V RAQ   K+ + MH
Sbjct: 87  NDKGAFKGDALITYSKEESVTLAIEMMNESIFLGKQIRVERAQFQNKEGDNMH 139

>ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH]
           complement(854587..855867) [1281 bp, 426 aa]
          Length = 426

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++VG+L+   SE  L+  F   G +  +R+ RD  T    G+AYV F D  +  KA+  L
Sbjct: 261 VFVGNLDFEESEESLWKHFMSCGPIEYVRIVRDPKTNVGKGFAYVQFADLVSVNKAL-LL 319

Query: 100 NYTPI---KGRLCRI 111
           N   +   KGR  R+
Sbjct: 320 NDKKMAVGKGRKLRV 334

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 49/100 (49%), Gaps = 1/100 (1%)

Query: 323 NLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRT-ENGKSKGFGFVCFSTPEEATKAITE 381
           ++FV NLD    +E L + F   G I   +++R  +    KGF +V F+      KA+  
Sbjct: 260 SVFVGNLDFEESEESLWKHFMSCGPIEYVRIVRDPKTNVGKGFAYVQFADLVSVNKALLL 319

Query: 382 KNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRYQQ 421
            ++++  GK   + + + +++++ Q      A  ++  QQ
Sbjct: 320 NDKKMAVGKGRKLRVTRCRNMQKVQRQSNTAALPKLTDQQ 359

>Kwal_27.11096
          Length = 201

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 7/70 (10%)

Query: 220 NLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLK----GFGFVNYEKHEDAVKA 275
            +YV N++  T++EQ  ELF+K G I    +  D   + K    GF FV Y   E+A+ A
Sbjct: 47  TIYVGNLSFYTSEEQIYELFSKSGVIKRIIMGLD---RFKFTPCGFCFVIYNTPEEALNA 103

Query: 276 VEALNDSELN 285
           V+ L+D++L+
Sbjct: 104 VKYLSDTKLD 113

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +YVG+L    SE  +Y++FS  G +  I +  D    T  G+ +V +N  E    A++ L
Sbjct: 48  IYVGNLSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGFCFVIYNTPEEALNAVKYL 107

Query: 100 NYTPIKGR 107
           + T +  R
Sbjct: 108 SDTKLDDR 115

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 320 QGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSK--GFGFVCFSTPEEATK 377
           +   ++V NL     +E++ E F+  G I    +M  +  K    GF FV ++TPEEA  
Sbjct: 44  RSATIYVGNLSFYTSEEQIYELFSKSGVIKRI-IMGLDRFKFTPCGFCFVIYNTPEEALN 102

Query: 378 AI 379
           A+
Sbjct: 103 AV 104

>Sklu_1192.1 YNL286W, Contig c1192 480-1322 reverse complement
          Length = 280

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 98/234 (41%), Gaps = 36/234 (15%)

Query: 194 QEIYVAPHLSRKERDS-QLEETKAHYTNLYVKNINSETT--DEQFQELFAKFGPI----- 245
           Q+  V     R+ER S QL   +   + ++V N++ E T  DE   E F KFG I     
Sbjct: 17  QDELVKRKKEREERLSKQLTMKRKQNSAIFVSNLSVENTKRDELISE-FNKFGMIRRDLS 75

Query: 246 ---VSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRA--QKKN-- 298
                  L  D+ G  KG   + Y + E    A+  ++  ELNGEK+ V  A   KKN  
Sbjct: 76  TNDYKCKLYFDSTGNFKGEALIVYVRPESVGMAINMMDGFELNGEKITVQEAVFSKKNSK 135

Query: 299 ---------ERMHVLKKQYEAYRL---EKMAKYQG--VNLFVKNL----DDSVDDEKLE- 339
                    +R  +  ++ +A RL   E     QG    + + N+    DD VDDE+++ 
Sbjct: 136 EDELGMPTTKRRKLENEKEQAKRLDDWEDTDSQQGETYTVILGNVLPPYDDPVDDEEIKE 195

Query: 340 -EEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392
            E     G     K++  +  K  G   + F +  +A K     N +   G+ +
Sbjct: 196 IERDVREGCEQIGKIIEFQLDKILGKAVLTFESRADALKCCNVMNGRFFDGRKI 249

>KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces
           cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
           processing factor CF I singleton, hypothetical start
          Length = 258

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +Y+G +    +E  + D+   IG V+++++  D  T  S GYA++ F D      A+  L
Sbjct: 10  VYLGSIPYDQTEQQILDLCQTIGPVTAMKMMFDPTTGKSKGYAFIEFKDLATSASAVRNL 69

Query: 100 N-YT 102
           N YT
Sbjct: 70  NGYT 73

 Score = 36.2 bits (82), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAA 179
           R   S  +++ ++  D   + + D     G + + K+  D   GKSKG+ F+ F++   +
Sbjct: 3   RGNPSRTVYLGSIPYDQTEQQILDLCQTIGPVTAMKMMFDPTTGKSKGYAFIEFKDLATS 62

Query: 180 KEAIDALNGMLLNGQEI 196
             A+  LNG  L  + +
Sbjct: 63  ASAVRNLNGYTLGSRSL 79

>AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH]
           (736609..737409) [801 bp, 266 aa]
          Length = 266

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +Y+G +    +E  + D+ S +G V+ +++  D  T  S GYA++ F D      A+  L
Sbjct: 13  VYLGSIPYDQTEQQILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEFKDLATSSSAVRNL 72

Query: 100 NYTPIKGRLCRIMWS 114
           N   +  R  +  ++
Sbjct: 73  NGYALGNRTLKCGYT 87

 Score = 35.8 bits (81), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 41/82 (50%), Gaps = 5/82 (6%)

Query: 120 LRKKGSG----NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFE 174
           + K G+G     +++ ++  D   + + D  S  G +   K+  D + GKSKG+ F+ F+
Sbjct: 1   MNKSGNGRPSRTVYLGSIPYDQTEQQILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEFK 60

Query: 175 EEGAAKEAIDALNGMLLNGQEI 196
           +   +  A+  LNG  L  + +
Sbjct: 61  DLATSSSAVRNLNGYALGNRTL 82

>ADR399C [2139] [Homologous to ScYOR361C (PRT1) - SH]
           (1420640..1422850) [2211 bp, 736 aa]
          Length = 736

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 53/108 (49%), Gaps = 16/108 (14%)

Query: 140 KALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNG--------MLL 191
           K L   FS  G ++   +  +E G++KG  F+ FE+ GAA+ AI   NG        + +
Sbjct: 57  KVLTKLFSQAGSVVDMDVPVEE-GRTKGHLFIEFEDAGAARRAIKMFNGKKLDVKHRLWV 115

Query: 192 NG---QEIYVAPHLSRKERDSQLEETKA-HYTNLYVKNINSETTDEQF 235
           NG    E Y  P  S + R+  + E +A  Y   ++++   ET  +QF
Sbjct: 116 NGLDDMERYGRPDFSTEYREPVVPEFEATEYPRSWLQD---ETGRDQF 160

>YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of
           nuclear cap-binding protein complex [627 bp, 208 aa]
          Length = 208

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 45/77 (58%), Gaps = 7/77 (9%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLK----GFGFVNYEKHEDAVK 274
           + +YV N++  T++EQ  ELF+K G I    +  D   + K    GF F+ Y   ++A+ 
Sbjct: 46  STIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLD---RFKFTPCGFCFIIYSCPDEALN 102

Query: 275 AVEALNDSELNGEKLYV 291
           A++ L+D++L+ + + +
Sbjct: 103 ALKYLSDTKLDEKTITI 119

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 35/65 (53%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +YVG+L    SE  +Y++FS  G++  I +  D    T  G+ ++ ++  +    A++ L
Sbjct: 48  IYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNALKYL 107

Query: 100 NYTPI 104
           + T +
Sbjct: 108 SDTKL 112

>Scas_714.59
          Length = 233

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 322 VNLFVKNLDDSVDDEKLEEEFA-PYGTITSAKVMRT-ENGKSKGFGFVCFSTPEEATKAI 379
             L +  L+++ D+  L EE   P+  I    V+R  E G+SKG  FV FS+ + A KA+
Sbjct: 150 CTLKIMQLNENADENNLREELLFPFAPIQKCVVVRNRETGRSKGLAFVTFSSEQMAEKAL 209

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 29/65 (44%)

Query: 56  DIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQ 115
           ++  P   +    V R+  T  S G A+V F+  +   KA+  L+       + R+ WS+
Sbjct: 169 ELLFPFAPIQKCVVVRNRETGRSKGLAFVTFSSEQMAEKALHFLDGRGFMNLILRVEWSK 228

Query: 116 RDPSL 120
             P +
Sbjct: 229 PKPKV 233

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 157 IATDENGKSKGFGFVHFEEEGAAKEAIDALNG 188
           +   E G+SKG  FV F  E  A++A+  L+G
Sbjct: 183 VRNRETGRSKGLAFVTFSSEQMAEKALHFLDG 214

>CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces
           cerevisiae YPL178w SAE1, start by similarity
          Length = 236

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 44/77 (57%), Gaps = 7/77 (9%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLK----GFGFVNYEKHEDAVK 274
           + +YV N++  T++EQ  ELF+K G I    +  D   + K    GF F+ Y   ++A+ 
Sbjct: 46  STIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLD---RFKFTPCGFCFIIYNTPQEALN 102

Query: 275 AVEALNDSELNGEKLYV 291
           AV+ L D++L+ + + +
Sbjct: 103 AVKYLGDTKLDDKSITI 119

 Score = 37.7 bits (86), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (48%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +YVG+L    SE  +Y++FS  G +  I +  D    T  G+ ++ +N  +    A++ L
Sbjct: 48  IYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFIIYNTPQEALNAVKYL 107

Query: 100 NYTPIKGRLCRI 111
             T +  +   I
Sbjct: 108 GDTKLDDKSITI 119

>Kwal_23.5864
          Length = 278

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 4/85 (4%)

Query: 323 NLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENG-KSKGFGFVCFST---PEEATKA 378
            +FV  L  +V + +L++EF  +G I   +V+R +   KS+G+GF+ F        A + 
Sbjct: 102 TVFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACRE 161

Query: 379 ITEKNQQIVAGKPLYVAIAQRKDVR 403
           I       + G+P+ V I + + V+
Sbjct: 162 IGVHRGVEIGGRPVIVDIERGRTVK 186

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++VG L  +V+E  L   F   G +  +RV RD  +  S GY ++ F +    R A  ++
Sbjct: 103 VFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACREI 162

 Score = 37.7 bits (86), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENG-KSKGFGFVHFEEEGAAKEA--- 182
            +F+  L   +    L   F  FG+I   ++  D+   KS+G+GF+ F+EE  A+ A   
Sbjct: 102 TVFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACRE 161

Query: 183 IDALNGMLLNGQEIYV 198
           I    G+ + G+ + V
Sbjct: 162 IGVHRGVEIGGRPVIV 177

>Scas_582.10
          Length = 283

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 7/82 (8%)

Query: 221 LYVKNINSETTDEQFQELFAKFGPI-------VSASLEKDADGKLKGFGFVNYEKHEDAV 273
           +YV NI+  T+      LF+K+G I       ++  + +D  G  KG   V YEK E   
Sbjct: 43  IYVSNISKHTSQLDLITLFSKYGKIRRTREEALNCKMYQDEKGNFKGDALVVYEKPESVQ 102

Query: 274 KAVEALNDSELNGEKLYVGRAQ 295
            A++ ++ +  N   + V RAQ
Sbjct: 103 LAIDMVDGTIFNKSTIKVERAQ 124

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 39/87 (44%), Gaps = 7/87 (8%)

Query: 119 SLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDI-------LSSKIATDENGKSKGFGFV 171
           S   + S  I++ N+        L   FS +G I       L+ K+  DE G  KG   V
Sbjct: 34  SQHSRESSAIYVSNISKHTSQLDLITLFSKYGKIRRTREEALNCKMYQDEKGNFKGDALV 93

Query: 172 HFEEEGAAKEAIDALNGMLLNGQEIYV 198
            +E+  + + AID ++G + N   I V
Sbjct: 94  VYEKPESVQLAIDMVDGTIFNKSTIKV 120

>KLLA0A03531g 320828..323026 similar to sp|P06103 Saccharomyces
           cerevisiae YOR361c PRT1 translation initiation factor
           eIF3 subunit singleton, start by similarity
          Length = 732

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 140 KALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVA 199
           K L   FS  G +L  +I   E+GK+KG  F+  E   AAKEAI   NG  L+ +   + 
Sbjct: 57  KVLTKLFSQAGKVLDMQIPV-EDGKTKGHLFIEMESVSAAKEAIQLFNGKKLDAKHRLLV 115

Query: 200 PHLSRKER 207
             L+  E+
Sbjct: 116 NSLNDMEK 123

>AER285C [2787] [Homologous to ScYMR268C (PRP24) - SH]
           (1162117..1163397) [1281 bp, 426 aa]
          Length = 426

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 64/148 (43%), Gaps = 9/148 (6%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFG-DILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDA 185
            +++ N  P  D + L   F   G   LS ++ +      + F +V      +A  A + 
Sbjct: 109 TLWVTNFPPRYDGRELRRFFEDLGFQCLSVRLPSLRYNAGRRFAYVDLPSPQSADAAANT 168

Query: 186 LNGMLLNGQEIYVAPHLSRKERDSQLEET-KAHYTNLYVKNIN-SETTDEQFQELFAKFG 243
           LNGM L+G  + V   LS  E  +Q  +        + ++ ++  + T E+ Q L   FG
Sbjct: 169 LNGMDLDGYNLVV--KLSDPESRAQRSDAGTIEKREVLIRGLDFIKVTIEKLQGLVEPFG 226

Query: 244 PI---VSASLEKDADGKL-KGFGFVNYE 267
            +   +       ADG+  +GF FV Y+
Sbjct: 227 EVEKLIMPPSSDSADGRHNRGFAFVTYK 254

>Scas_720.2
          Length = 245

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 55/101 (54%), Gaps = 11/101 (10%)

Query: 199 APHLSRKERDSQ--LEETK--AHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDA 254
           + +L RK R +   LEE +       +YV N++  T++EQ  ELF+K G I    +  D 
Sbjct: 23  SAYLLRKARKNPNGLEELRQSLQSATIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLD- 81

Query: 255 DGKLK----GFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291
             + K    GF FV Y   ++A+ A++ L+D++L+ + + +
Sbjct: 82  --RFKFTPCGFCFVIYSNAQEALNALKYLSDTKLDDKHITI 120

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +YVG+L    SE  +Y++FS  G +  I +  D    T  G+ +V +++ +    A++ L
Sbjct: 49  IYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFVIYSNAQEALNALKYL 108

Query: 100 NYTPIKGRLCRI 111
           + T +  +   I
Sbjct: 109 SDTKLDDKHITI 120

>Kwal_55.20903
          Length = 147

 Score = 37.4 bits (85), Expect = 0.010,   Method: Composition-based stats.
 Identities = 29/113 (25%), Positives = 52/113 (46%), Gaps = 3/113 (2%)

Query: 12  LENLNIQDDQKQAATGXXXXXXXXXXXXLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCR 71
           L++ N    Q+ AA G            +++ D+   +S   L D F  +GS+  I +  
Sbjct: 33  LKSSNRSSHQESAAKGENIDQSETDSRSIFLRDIPSDISLPSLEDHFRDMGSICRITMIS 92

Query: 72  DAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRD-PSLRKK 123
               K+  GYAYV F    +  +A+E L+ + ++G   R+   + + P +R K
Sbjct: 93  KQ-RKSGTGYAYVEFATKASAERALE-LDGSILRGHKLRVARKRTNVPRMRVK 143

 Score = 32.0 bits (71), Expect = 0.58,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 44/85 (51%), Gaps = 2/85 (2%)

Query: 323 NLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEK 382
           ++F++++   +    LE+ F   G+I    ++  +     G+ +V F+T   A +A+ E 
Sbjct: 60  SIFLRDIPSDISLPSLEDHFRDMGSICRITMISKQRKSGTGYAYVEFATKASAERAL-EL 118

Query: 383 NQQIVAGKPLYVAIAQRKDVRRSQL 407
           +  I+ G  L VA  +R +V R ++
Sbjct: 119 DGSILRGHKLRVA-RKRTNVPRMRV 142

>Kwal_55.20414
          Length = 284

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 46/93 (49%), Gaps = 8/93 (8%)

Query: 206 ERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLE-------KDADGKL 258
           E  +Q+ E  +    +YV N++  TT+E+  E   ++  +VS  +        +++  + 
Sbjct: 4   EDTTQVSEASSQIKRIYVSNLDFSTTEEELSEFLKEYN-VVSVLIPSQTIRGFRNSTVRP 62

Query: 259 KGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291
            G G+ +++  +DA  A + LN  +L   KL +
Sbjct: 63  LGIGYADFQSAQDAQNAAQNLNGKQLKDRKLKI 95

>YDR429C (TIF35) [1252] chr4 complement(1324465..1325289)
           Translation initiation factor eIF3, p33 subunit,
           contains an RRM (RNA recognition motif) domain [825 bp,
           274 aa]
          Length = 274

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 322 VNLFVKNLDDSVDDEKLEEEFA-PYGTITSAKVMRT-ENGKSKGFGFVCFSTPEEATKAI 379
             L +  ++++ D+  L EE   P+  I    V+R  E GKS+G  FV FS+ E A +A+
Sbjct: 191 CTLKIMQVNENADENSLREELLFPFAPIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQAL 250

 Score = 32.3 bits (72), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 46  EPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIK 105
           E S+ E  L+  F+PI  VS   V R+  T  S G A+V F+  E   +A+  L+     
Sbjct: 204 ENSLREELLFP-FAPIPRVS---VVRNKETGKSRGLAFVTFSSEEVAEQALRFLDGRGYM 259

Query: 106 GRLCRIMWSQ 115
             + R+ WS+
Sbjct: 260 NLILRVEWSK 269

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 155 SKIATDENGKSKGFGFVHFEEEGAAKEAIDALNG 188
           S +   E GKS+G  FV F  E  A++A+  L+G
Sbjct: 222 SVVRNKETGKSRGLAFVTFSSEEVAEQALRFLDG 255

>CAGL0D05236g 499006..500337 weakly similar to sp|P43607
           Saccharomyces cerevisiae YFR032c, hypothetical start
          Length = 443

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 53/108 (49%), Gaps = 9/108 (8%)

Query: 221 LYVKNINSETTDEQFQELFAKFG------PIVSASLEKDADGKLKGFGFVNYEKHEDAVK 274
           +Y+ N++  +++E  +E    F       P  +    +  + +  G  +V++   E+AV+
Sbjct: 6   IYIANVSYSSSEEDLREFLKDFNFSSVLIPCHTVRRFRRNEARSFGIAYVDFTSSEEAVR 65

Query: 275 AVEALNDSELNGEKLYVGRAQKKNERMHVLKKQY--EAYRLEKMAKYQ 320
           AVE LN  E  G  L V R     +    +K+++  +  +L+K AKY+
Sbjct: 66  AVEELNGKEFGGRVLRV-RTHNPYQPPKPIKERFGTKLQQLKKFAKYE 112

 Score = 33.1 bits (74), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 5/77 (6%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAIT-----KTSLGYAYVNFNDHEAGRK 94
           +Y+ ++  S SE  L +        S +  C            S G AYV+F   E   +
Sbjct: 6   IYIANVSYSSSEEDLREFLKDFNFSSVLIPCHTVRRFRRNEARSFGIAYVDFTSSEEAVR 65

Query: 95  AIEQLNYTPIKGRLCRI 111
           A+E+LN     GR+ R+
Sbjct: 66  AVEELNGKEFGGRVLRV 82

>Scas_666.11
          Length = 224

 Score = 37.7 bits (86), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 125 SGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAI 183
           S  +++  L      + L   FS FGD+   ++A ++  G S+ +GF+ F  +  A  A 
Sbjct: 93  SSILYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIEFANKDDANIAQ 152

Query: 184 DALNGMLLNGQEIYV 198
           DA+N  L+ G  + V
Sbjct: 153 DAMNNYLVMGHLLQV 167

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 60/116 (51%), Gaps = 5/116 (4%)

Query: 208 DSQLEETKAHYTN-LYVKNINSETTDEQFQELFAKFGPIVSASLEKDAD-GKLKGFGFVN 265
           DS  ++  A Y++ LYV  +     + +  + F++FG +    L ++   G  + +GF+ 
Sbjct: 82  DSNKKKPLAEYSSILYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIE 141

Query: 266 YEKHEDAVKAVEALNDSELNGEKLYVGRAQK--KNERMHVLKKQ-YEAYRLEKMAK 318
           +   +DA  A +A+N+  + G  L V    K  K E+++  KK+ +   +++K AK
Sbjct: 142 FANKDDANIAQDAMNNYLVMGHLLQVRLLPKGAKIEKLYKYKKRAFTQMKIKKTAK 197

>CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces
           cerevisiae YBL051c, hypothetical start
          Length = 639

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 221 LYVKNINSETTDEQFQELFAKFG-PIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEAL 279
           + +KNI      EQ  ++  + G P+  A      +G  +G  F N+   ED  + +  L
Sbjct: 58  IVIKNIPFAIKKEQLLDIIQEMGLPLPYAFNYHFDNGIFRGLAFANFSTPEDTSRVISDL 117

Query: 280 NDSELNGEKLYV 291
           N  E+NG KL V
Sbjct: 118 NGKEINGRKLKV 129

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 324 LFVKNLDDSVDDEKLEEEFAPYGT-ITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEK 382
           + +KN+  ++  E+L +     G  +  A     +NG  +G  F  FSTPE+ ++ I++ 
Sbjct: 58  IVIKNIPFAIKKEQLLDIIQEMGLPLPYAFNYHFDNGIFRGLAFANFSTPEDTSRVISDL 117

Query: 383 NQQIVAGKPLYV 394
           N + + G+ L V
Sbjct: 118 NGKEINGRKLKV 129

>Scas_500.6
          Length = 621

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFG-PIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVE 277
           T + +KNI      EQ  ++ AK   P+  A      +G  +G  F N+   ++  + +E
Sbjct: 53  TAIVIKNIPFAIKREQLLDIMAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTDETTRVIE 112

Query: 278 ALNDSELNGEKLYV 291
            LN  E+ G KL V
Sbjct: 113 CLNGKEIGGRKLRV 126

>Scas_241.1
          Length = 186

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 42/96 (43%), Gaps = 8/96 (8%)

Query: 115 QRDPSLRKKGSGN---IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFV 171
           Q+ P+L      N   +FI  L   +    L   F  FGDI+  KI T      KG GFV
Sbjct: 12  QQQPTLNHLTDPNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIPT-----GKGCGFV 66

Query: 172 HFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKER 207
            + +  +A+ AI  + G  L    I ++   S K+ 
Sbjct: 67  QYVDRLSAELAISKMQGFPLANSRIRLSWGRSSKQH 102

 Score = 33.5 bits (75), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 33/76 (43%), Gaps = 6/76 (7%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           +++G L   VSE  L   F P G +  +++       T  G  +V + D  +   AI ++
Sbjct: 28  VFIGGLSSLVSEDDLRQYFQPFGDIIYVKI------PTGKGCGFVQYVDRLSAELAISKM 81

Query: 100 NYTPIKGRLCRIMWSQ 115
              P+     R+ W +
Sbjct: 82  QGFPLANSRIRLSWGR 97

>KLLA0E19118g 1694566..1696524 some similarities with sp|Q08925
           Saccharomyces cerevisiae YPL184c, hypothetical start
          Length = 652

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 75/172 (43%), Gaps = 43/172 (25%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR-----K 94
           +Y+G++  +++   L D +   G V  +++  + +       A+V+F D           
Sbjct: 235 VYLGNIPATITYKALLD-YVRTGVVEEVKILSEKMC------AFVSFVDENDALLFHSDA 287

Query: 95  AIEQLNYTPIKGRLCRIMWSQR---DPSLRKK-----GSGNIFIKNLHPDIDN------- 139
            +++LN   I GR  +I W +    DP +R        + N++I  L+ + D+       
Sbjct: 288 ILKRLN---IDGRDIKIGWGKPQPIDPIVRAGIANDGATRNVYIGKLNTNKDSCEKWGAD 344

Query: 140 --------KALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAI 183
                   + LYD  S FG+I S K+  D     +G  FVHF    AA +A+
Sbjct: 345 PKEILVTKEKLYDDLSQFGEIESIKLVED-----RGIAFVHFTSIFAAIKAV 391

>YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein with
           weak similarity to RNA-binding proteins, contains one
           RNA recognition (RRM) domain [2007 bp, 668 aa]
          Length = 668

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 357 ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
           +NG  +G  F  F+TPEE T+ IT  N + ++G+ L V
Sbjct: 121 DNGIFRGLAFANFTTPEETTQVITSLNGKEISGRKLKV 158

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 21/37 (56%)

Query: 255 DGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291
           +G  +G  F N+   E+  + + +LN  E++G KL V
Sbjct: 122 NGIFRGLAFANFTTPEETTQVITSLNGKEISGRKLKV 158

>Scas_570.14
          Length = 113

 Score = 35.0 bits (79), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 7/79 (8%)

Query: 324 LFVKNLDDSVDDEKLEEE----FAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAI 379
           L+V NLD+ ++ ++L       F+ YG +    +      K +G  F+   T +EA  A+
Sbjct: 32  LYVNNLDEKINTKRLRTNLFLLFSIYGEVLKVAI---SAKKQRGQAFITMRTVDEANLAL 88

Query: 380 TEKNQQIVAGKPLYVAIAQ 398
              N +    KPL++  ++
Sbjct: 89  ISLNNEPFFDKPLHIQFSK 107

>Kwal_33.14810
          Length = 574

 Score = 37.0 bits (84), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFG-PIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVE 277
           T + +KNI      EQ  ++ AK   P+  A      +G  +G  F N+   ++  + V 
Sbjct: 31  TAIVIKNIPFAIKKEQLLDVIAKMNLPLPYAFNYHFDNGVFRGLAFANFATTDETTQVVH 90

Query: 278 ALNDSELNGEKLYV 291
            LN  E+ G KL V
Sbjct: 91  MLNGKEIGGRKLRV 104

>Scas_537.5
          Length = 570

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 52/115 (45%), Gaps = 28/115 (24%)

Query: 221 LYVKNINSETTDEQFQELFAKFG--PI--------VSASLEKDADGKLKG---------- 260
           LY+ N+ S+TT  + +  F +FG  PI        +  +   +++  L G          
Sbjct: 220 LYMNNLPSDTTQSELESWFTQFGARPIGFWTAKNTIEETSSINSNWSLNGNPLVDEQDCV 279

Query: 261 FGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERM--HVLKKQYEAYRL 313
            GFV ++ HE+A +A+       LNG  +    A  K  R+  H+++ Q  + R+
Sbjct: 280 AGFVVFQSHEEATEAL------VLNGRSILSNIANTKQPRVVEHIVEIQPSSTRV 328

>Sklu_2060.3 YIR009W, Contig c2060 4599-4931
          Length = 110

 Score = 34.7 bits (78), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 8/79 (10%)

Query: 324 LFVKNLDDSVDDEKLEEE----FAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAI 379
           L+V NL+D +    L E     F+ YG +    +      K +G  FV   T  EA  A+
Sbjct: 30  LYVNNLNDQIRPNTLRENLYLLFSTYGEVIQVSM----TSKERGQAFVLLRTMNEANLAM 85

Query: 380 TEKNQQIVAGKPLYVAIAQ 398
                +   GKPL +  ++
Sbjct: 86  ISLQDEPFFGKPLRIRFSR 104

 Score = 29.3 bits (64), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 8/75 (10%)

Query: 221 LYVKNINSE----TTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAV 276
           LYV N+N +    T  E    LF+ +G ++  S+      K +G  FV      +A  A+
Sbjct: 30  LYVNNLNDQIRPNTLRENLYLLFSTYGEVIQVSM----TSKERGQAFVLLRTMNEANLAM 85

Query: 277 EALNDSELNGEKLYV 291
            +L D    G+ L +
Sbjct: 86  ISLQDEPFFGKPLRI 100

>CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces
           cerevisiae YPL190c NAB3 polyadenylated RNA-binding
           protein, hypothetical start
          Length = 775

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 45/112 (40%), Gaps = 26/112 (23%)

Query: 74  ITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNL 133
           ITK       V +ND+  G   I +++  P K RL                 GN+ +KN 
Sbjct: 298 ITKPMTPEESVRYNDYLKGENKITEMHSIPPKSRLF---------------IGNLPLKN- 341

Query: 134 HPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDA 185
              +  + L+  FS FG IL   I          FGF+ ++   + + AI+ 
Sbjct: 342 ---VSKQDLFRLFSPFGHILQINIKN-------AFGFIQYDNPKSVRAAIEC 383

 Score = 32.7 bits (73), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 324 LFVKNLD-DSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEK 382
           LF+ NL   +V  + L   F+P+G I    +          FGF+ +  P+    AI  +
Sbjct: 332 LFIGNLPLKNVSKQDLFRLFSPFGHILQINI-------KNAFGFIQYDNPKSVRAAIECE 384

Query: 383 NQQIVAGKPLYVAIA 397
           +Q+I  GK L + ++
Sbjct: 385 SQEINFGKKLILEVS 399

>KLLA0B11594g complement(1018044..1018388) some similarities with
           sp|P40567 Saccharomyces cerevisiae YIR009w MSL1 U2
           snRNA-associated protein with singleton, hypothetical
           start
          Length = 114

 Score = 34.3 bits (77), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 40/85 (47%), Gaps = 8/85 (9%)

Query: 323 NLFVKNLDDSVDDEKLEEE----FAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKA 378
            ++VKNL+D +  + + E     FA YG +    +      K +G  F+ F + +EA  A
Sbjct: 33  TVYVKNLNDQIKIQTVRESLYMLFATYGEVIKVSM----TPKQRGQAFITFKSVDEANLA 88

Query: 379 ITEKNQQIVAGKPLYVAIAQRKDVR 403
           +     ++   KPL +  +++   +
Sbjct: 89  LLSLKDELFFNKPLVLQFSKQTTTK 113

>Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement
          Length = 281

 Score = 35.8 bits (81), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 323 NLFVKNLDDSVDDEKLEEEFA-PYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAI 379
            L +  L++  D+  + +E   P+G I    V+R TE G+S+G  ++ F T E A  A+
Sbjct: 199 TLKITQLNEHADESTIRQELLFPFGRIPKVVVVRNTETGRSRGISYITFETEEIAETAL 257

>Kwal_55.20718
          Length = 594

 Score = 36.2 bits (82), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 43/87 (49%), Gaps = 3/87 (3%)

Query: 324 LFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKN 383
           +FV  LD    +EKL + F+ +G+IT   ++   N     F F+ F+T E A  A+  +N
Sbjct: 202 IFVGQLDPMATEEKLLKRFSRHGSITDINLITKPNNV---FAFIKFTTEEAAAAALEMEN 258

Query: 384 QQIVAGKPLYVAIAQRKDVRRSQLAQQ 410
             I   K ++V   +   ++R +   Q
Sbjct: 259 HAIFLSKTMHVQYREIGGIKRFRRGNQ 285

>Sklu_2434.14 YOR361C, Contig c2434 32150-34360
          Length = 736

 Score = 36.2 bits (82), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 139 NKALYDTFSVFGDILSSKIATDENGKS-KGFGFVHFEEEGAAKEAIDALNGMLLN 192
            K L   FS  G ++   +  DE  K+ KG+ FV F+   AAK+AI  LNG  L+
Sbjct: 57  TKVLTKLFSQAGTVVDMNLPLDEEKKTTKGYLFVEFDSAVAAKKAIALLNGKKLD 111

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%)

Query: 54  LYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLN 100
           L  +FS  G+V  + +  D   KT+ GY +V F+   A +KAI  LN
Sbjct: 60  LTKLFSQAGTVVDMNLPLDEEKKTTKGYLFVEFDSAVAAKKAIALLN 106

>KLLA0E19943g 1766853..1768631 weakly similar to sp|P34217
           Saccharomyces cerevisiae YBL051c singleton, hypothetical
           start
          Length = 592

 Score = 36.2 bits (82), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFG-PIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVE 277
           T + +KNI      EQ  E+ AK   P+  A      +G  +G  F N+   E+    V+
Sbjct: 37  TAIVIKNIPFAIKKEQLLEVIAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTEETTTVVQ 96

Query: 278 ALNDSELNGEKLYV 291
           +LN  E+ G KL V
Sbjct: 97  SLNGKEIGGRKLRV 110

>AER349C [2850] [Homologous to NOHBY] (1278446..1279102) [657 bp,
           218 aa]
          Length = 218

 Score = 35.0 bits (79), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 33/84 (39%)

Query: 220 NLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEAL 279
            ++V    +ET        F   G IV   +      + + F FV +E HE+ V+AVE L
Sbjct: 6   TVHVSGFPAETRARDMAPDFEAVGKIVRIDIPPMRPFQDRPFAFVKFETHEECVRAVEEL 65

Query: 280 NDSELNGEKLYVGRAQKKNERMHV 303
           +      +  +    Q    R + 
Sbjct: 66  DGRPFTPDTRFTYHVQVARSRPYA 89

>Kwal_33.15208
          Length = 186

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 41/74 (55%), Gaps = 3/74 (4%)

Query: 220 NLYVKNINSETTDEQFQELFAKFGPIVS-ASLEKD-ADGKLKGFGFVNYEKHEDAVKAVE 277
           +++V NI+   T E+ Q LF      V+   ++ +  +G  KGF +V + + +D   AVE
Sbjct: 54  SVFVGNISQSITAEELQLLFKDVVSCVNRVEIQVNRVNGLTKGFAYVEFAQPKDVTAAVE 113

Query: 278 ALNDSELNGEKLYV 291
            L++ + +G +L V
Sbjct: 114 -LDNVDFHGRRLRV 126

>CAGL0J02200g complement(215042..215476) similar to sp|P40561
           Saccharomyces cerevisiae YIR001c SGN1, hypothetical
           start
          Length = 144

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 44/104 (42%), Gaps = 7/104 (6%)

Query: 1   MADITDKTAEQLENLNI-------QDDQKQAATGXXXXXXXXXXXXLYVGDLEPSVSEAH 53
           MA    K +E  ENLN+       Q + +                 +Y+G++    +   
Sbjct: 1   MAISPQKISEIFENLNVSSNNVTTQSNSRLTREQKHALQLEADACSIYIGNISLDTTPEE 60

Query: 54  LYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIE 97
           + + F   G +  I +  D  T  S+GYAYV F+  ++  KA++
Sbjct: 61  IDEHFKSCGVIKRITMLYDKNTGPSIGYAYVEFDSIDSRDKALD 104

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 49/94 (52%), Gaps = 6/94 (6%)

Query: 202 LSRKERDS-QLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDAD-GKLK 259
           L+R+++ + QLE   A   ++Y+ NI+ +TT E+  E F   G I   ++  D + G   
Sbjct: 30  LTREQKHALQLE---ADACSIYIGNISLDTTPEEIDEHFKSCGVIKRITMLYDKNTGPSI 86

Query: 260 GFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGR 293
           G+ +V ++  +   KA++  N + L    + V R
Sbjct: 87  GYAYVEFDSIDSRDKALD-FNGTNLRQHVISVER 119

>AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH]
           complement(18862..19482) [621 bp, 206 aa]
          Length = 206

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 125 SGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAI 183
           SG I+I  L      + L   F+ FGD+   ++A + + G S+ + F+ F     A  A 
Sbjct: 77  SGIIYISRLPHGFHERELSTYFAQFGDLKQVRLARNKKTGNSRHYAFIEFANPDDAVVAQ 136

Query: 184 DALNGMLLNGQEIYVA 199
           + ++  LL G  + V+
Sbjct: 137 ETMHNYLLMGHLLQVS 152

>KLLA0E00484g complement(45755..46483) similar to sp|P10080
           Saccharomyces cerevisiae YHL034c SBP1 single-strand
           nucleic acid binding protein singleton, start by
           similarity
          Length = 242

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 48/222 (21%), Positives = 79/222 (35%), Gaps = 43/222 (19%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKS--KGFGFVHFEEEGAAKEAID 184
           +IF+ NL P+   + L     VFG+ +  +I T ++ ++  + F FV F+++   ++   
Sbjct: 18  SIFVGNLSPETSPEDLQ---KVFGESVKVEIPTLQSDRTYPRIFAFVTFDDKVDVEDLRS 74

Query: 185 ALNGMLLNGQEIYV--------------------------APHLSRKERDSQLEETKAHY 218
             +  ++  + IYV                          AP    KE    LE+ +   
Sbjct: 75  KFDKTVIKDKSIYVTKVLTPEEQQLKKQKRRANQRGKAVPAPPKKNKEAQVPLEQMERSK 134

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLK----------GFGFVNYEK 268
             LYV NI   TT  +    F      V   + +  D   K          G  FV++ +
Sbjct: 135 DTLYVNNIPYHTTKAEIASFFGTTEESVILPMRRMKDTTTKRVFFSRKFNRGIAFVSFPE 194

Query: 269 HEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEA 310
             D        N       +L V  A   N+  H    Q EA
Sbjct: 195 GTDIEAKAAEFNGKNFEDRELTVDVAA--NKPAHTEPVQTEA 234

>YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein
           that may be involved in coping with heat stresses,
           contains one RNA recognition (RRM) domain [663 bp, 220
           aa]
          Length = 220

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 42/82 (51%), Gaps = 2/82 (2%)

Query: 316 MAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTE-NGKSKGFGFVCFSTPEE 374
           + +Y G+ ++V  L     +++L + FA +G +   ++ R +  G S+ +GF+ F   E+
Sbjct: 86  LEEYSGI-IYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKED 144

Query: 375 ATKAITEKNQQIVAGKPLYVAI 396
           A  A    N  ++ G  L V +
Sbjct: 145 AMIAQESMNNYLLMGHLLQVRV 166

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 66/137 (48%), Gaps = 22/137 (16%)

Query: 206 ERDSQLEETKAHYTNL-YVKNINSETTDEQFQELFAKFGPIVSASLEKDAD-GKLKGFGF 263
           E+ S+ ++T   Y+ + YV  +     +++  + FA+FG +    L ++   G  + +GF
Sbjct: 77  EKKSKDKKTLEEYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGF 136

Query: 264 VNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKY---- 319
           + +   EDA+ A E++N+  L G  L V           VL K     ++EK+ KY    
Sbjct: 137 LEFVNKEDAMIAQESMNNYLLMGHLLQV----------RVLPK---GAKIEKLYKYKKRV 183

Query: 320 ---QGVNLFVKNLDDSV 333
              +G+   VK L D++
Sbjct: 184 LVEKGITKPVKQLKDNM 200

>Kwal_26.6824
          Length = 739

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 54  LYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLN 100
           L  +FS  G V  I +  D   K + GY +V F+   + RKAI+ LN
Sbjct: 60  LTKLFSQAGKVVDINLPLDEAKKCTKGYLFVEFDSAVSARKAIKLLN 106

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 139 NKALYDTFSVFGDILSSKIATDENGK-SKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIY 197
           +K L   FS  G ++   +  DE  K +KG+ FV F+   +A++AI  LNG  L+ +   
Sbjct: 57  SKVLTKLFSQAGKVVDINLPLDEAKKCTKGYLFVEFDSAVSARKAIKLLNGKKLDVKHRL 116

Query: 198 VAPHLSRKER 207
           +   LS  E+
Sbjct: 117 LVNGLSDVEK 126

>YFR032C (YFR032C) [1713] chr6 complement(222078..222947) Protein
           with weak similarity to S. pombe poly(A)-binding protein
           (SP:P31209), has one RNA recognition (RRM) domain [870
           bp, 289 aa]
          Length = 289

 Score = 33.9 bits (76), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 40/97 (41%), Gaps = 19/97 (19%)

Query: 164 KSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLE----------- 212
           K  G  F  F     A +AI  LNG +   Q++++  H+   E DS  +           
Sbjct: 66  KPLGIAFAQFANNTLALKAIQDLNGTVFQNQKLFLKLHVPY-EADSTPDTDVKKPKEKNK 124

Query: 213 -----ETKAHYTNLYVKNINSETTDEQFQELFAKFGP 244
                ET A    +Y  ++  + TD + +ELF  + P
Sbjct: 125 VKKTPETAAD--TVYCHDLPDDITDSEIRELFQLYSP 159

>YLL046C (RNP1) [3376] chr12 complement(46713..47462)
           Ribonucleoprotein 1, contains two RNA recognition (RRM)
           domains which include RNP-1 octamer and RNP-2 hexamer
           motifs [750 bp, 249 aa]
          Length = 249

 Score = 33.5 bits (75), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 40/83 (48%), Gaps = 10/83 (12%)

Query: 168 FGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYT-------- 219
           F F+ F+E    K+  + +NG +   ++I +   L+++E+  +  +     T        
Sbjct: 79  FAFIEFQEGVNLKKVKEKMNGKIFMNEKIVIENILTKEEKSFEKNQKSNKKTAPDLKPLS 138

Query: 220 --NLYVKNINSETTDEQFQELFA 240
              LYVKNI  ++T+E   ++F 
Sbjct: 139 TNTLYVKNIPMKSTNEDLAKIFG 161

>Kwal_30.12890
          Length = 280

 Score = 33.5 bits (75), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 50/104 (48%), Gaps = 4/104 (3%)

Query: 278 ALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEK 337
           AL    + G K YV  +++   R       ++AY+ ++  +     + +  L+++ D+  
Sbjct: 155 ALETGSIVGGK-YVPPSRRVGARDPSSNNNFDAYK-DQRERDDAKTIKIMQLNENADENT 212

Query: 338 LEEEFA-PYGTITSAKVMRT-ENGKSKGFGFVCFSTPEEATKAI 379
           L  E   P+G I    V+R  E G+S+G  +V F T E A  A+
Sbjct: 213 LRYELLFPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETAL 256

 Score = 33.5 bits (75), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query: 128 IFIKNLHPDIDNKAL-YDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDA 185
           I I  L+ + D   L Y+    FG I    +  + E G+S+G  +V FE E  A+ A++ 
Sbjct: 199 IKIMQLNENADENTLRYELLFPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETALNF 258

Query: 186 LNG 188
           LNG
Sbjct: 259 LNG 261

 Score = 32.7 bits (73), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 26/61 (42%)

Query: 55  YDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWS 114
           Y++  P G +  + V R+  T  S G AYV F   E    A+  LN       +    WS
Sbjct: 215 YELLFPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETALNFLNGRGFMNLILNADWS 274

Query: 115 Q 115
           +
Sbjct: 275 K 275

>Scas_710.31*
          Length = 162

 Score = 32.7 bits (73), Expect = 0.37,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 267 EKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLF- 325
           +K +  VK  + L  +E+NG +  +G+  KK E    L +     RLE + K +G+++F 
Sbjct: 31  QKKDVTVKTAQNL--AEVNGPESLIGQGAKKGEVPTDLDQATGLARLELLGKLEGIDIFD 88

Query: 326 VKNLDDS 332
            K LD S
Sbjct: 89  TKPLDSS 95

>Scas_565.8
          Length = 322

 Score = 33.5 bits (75), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 74/200 (37%), Gaps = 69/200 (34%)

Query: 50  SEAHLYDIFSPIGSVSSIRVCRDAI----TKT-SLGYAYVNFNDHEAGRKAIEQLNYTPI 104
           S+A L ++  P G VS +           TK  S+GYAYV F   +    A  +L+ T  
Sbjct: 29  SDAELEELLKPFGKVSVLTPTESLFGFRGTKVVSIGYAYVIFETPQLAATAFNELHKTEF 88

Query: 105 KGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGK 164
           KGR                    ++IK           Y+ F  FG             +
Sbjct: 89  KGR-------------------TLYIKP----------YEEFIPFG------------WR 107

Query: 165 SKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVK 224
           +K    V  EE        DA++  L+  +++      S+KE  + +         LY  
Sbjct: 108 TKWKKKVRNEE--------DAVDTQLIQPKKV------SKKETSTDI---------LYCS 144

Query: 225 NINSETTDEQFQELFAKFGP 244
            +  + TDE+ + LF +F P
Sbjct: 145 KLPKDVTDEKIRALFREFNP 164

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 324 LFVKNLDDSVDDEKLEEEFAPYGTIT------SAKVMRTENGKSKGFGFVCFSTPEEATK 377
           L   N+  +  D +LEE   P+G ++      S    R     S G+ +V F TP+ A  
Sbjct: 19  LVFTNVRFNTSDAELEELLKPFGKVSVLTPTESLFGFRGTKVVSIGYAYVIFETPQLAAT 78

Query: 378 AITEKNQQIVAGKPLYV 394
           A  E ++    G+ LY+
Sbjct: 79  AFNELHKTEFKGRTLYI 95

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 40/90 (44%), Gaps = 6/90 (6%)

Query: 208 DSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADG----KLK--GF 261
           DS ++  +     L   N+   T+D + +EL   FG +   +  +   G    K+   G+
Sbjct: 6   DSNVDPIEITTHKLVFTNVRFNTSDAELEELLKPFGKVSVLTPTESLFGFRGTKVVSIGY 65

Query: 262 GFVNYEKHEDAVKAVEALNDSELNGEKLYV 291
            +V +E  + A  A   L+ +E  G  LY+
Sbjct: 66  AYVIFETPQLAATAFNELHKTEFKGRTLYI 95

>CAGL0I05082g complement(473462..475276) some similarities with
           sp|P34217 Saccharomyces cerevisiae YBL051c, hypothetical
           start
          Length = 604

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 30/74 (40%), Gaps = 1/74 (1%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFG-PIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVE 277
           T + +KNI      EQ  +       P+  A      +G  +G  F NY    D  K V 
Sbjct: 66  TAIVIKNIPFALKREQLLDFMTSLDLPLPYAFNYHFDNGTFRGLAFANYNSEVDTAKVVN 125

Query: 278 ALNDSELNGEKLYV 291
            LN+ E+ G  L V
Sbjct: 126 ELNEKEVGGRNLRV 139

>Scas_611.5*
          Length = 787

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 54/122 (44%), Gaps = 19/122 (15%)

Query: 40  LYVGDLE-PSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIE- 97
           L++G+L   +VS+  L+ IFSP G +  I +           + ++ +N+ ++ + AIE 
Sbjct: 315 LFIGNLPLKNVSKEDLFRIFSPYGHILQINIKN--------AFGFIQYNNPQSVKDAIEL 366

Query: 98  ---QLNYTPIKGRLCRIMWSQRDPSL----RKKGSGNIFIKNLHPDIDNKALYDTFSVFG 150
              ++N+   K  +  +  S   P          S   FI +     DN    DT +++ 
Sbjct: 367 ESDEINFD--KKLILEVSSSNSRPQFDHGDHGTNSSTTFISSAKRPFDNDEEDDTANMYN 424

Query: 151 DI 152
           DI
Sbjct: 425 DI 426

>ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH]
           (708437..709411) [975 bp, 324 aa]
          Length = 324

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 125 SGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAI 183
           S ++F+ ++ P+   + L + F   G I    I  ++  G+ KG+ ++ FE   + ++A+
Sbjct: 82  SRSVFVSSITPEATAEMLEEHFKDVGVISRITILYNKKTGEPKGYAYIQFESISSVEKAL 141

Query: 184 DALNGMLLNGQEIYVA 199
             L+G   NG  I VA
Sbjct: 142 Q-LDGSSFNGNTISVA 156

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99
           ++V  + P  +   L + F  +G +S I +  +  T    GYAY+ F    +  KA+ QL
Sbjct: 85  VFVSSITPEATAEMLEEHFKDVGVISRITILYNKKTGEPKGYAYIQFESISSVEKAL-QL 143

Query: 100 NYTPIKGRLCRI 111
           + +   G    +
Sbjct: 144 DGSSFNGNTISV 155

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 324 LFVKNLDDSVDDEKLEEEFAPYGTITSAKVM-RTENGKSKGFGFVCFSTPEEATKAI 379
           +FV ++      E LEE F   G I+   ++   + G+ KG+ ++ F +     KA+
Sbjct: 85  VFVSSITPEATAEMLEEHFKDVGVISRITILYNKKTGEPKGYAYIQFESISSVEKAL 141

>KLLA0B14432g 1267356..1267877 weakly similar to sp|P36036
           Saccharomyces cerevisiae YKL214c singleton, start by
           similarity
          Length = 173

 Score = 32.3 bits (72), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 39/79 (49%), Gaps = 3/79 (3%)

Query: 213 ETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDA 272
           + +   T L ++NI  ET+D + ++   + G + S  +    + ++   GF + +     
Sbjct: 45  DRRKRITLLRIRNIPLETSDYEIEDWINEIGEVESIRINDRKENRVATVGFKDVQL---L 101

Query: 273 VKAVEALNDSELNGEKLYV 291
             AVE LN  E++G +L V
Sbjct: 102 GTAVEKLNGKEVHGSQLEV 120

>CAGL0K09966g complement(974102..976261) highly similar to sp|P06103
           Saccharomyces cerevisiae YOR361c PRT1, hypothetical
           start
          Length = 719

 Score = 33.5 bits (75), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%)

Query: 140 KALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLN 192
           KAL   FS  G ++  +   D++ KSKGF FV    +  AK+ I A +G  L+
Sbjct: 55  KALGGLFSKAGKVVDMEFPLDDDKKSKGFLFVECGSDVDAKKIIKAFHGKRLD 107

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%)

Query: 238 LFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELN 285
           LF+K G +V      D D K KGF FV      DA K ++A +   L+
Sbjct: 60  LFSKAGKVVDMEFPLDDDKKSKGFLFVECGSDVDAKKIIKAFHGKRLD 107

>Scas_663.15
          Length = 753

 Score = 33.1 bits (74), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 140 KALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLN 192
           KAL   FS  G +++     DE +GKSKGF FV       AK+ + + NG  L+
Sbjct: 87  KALTGLFSKAGKVVNMDFPIDEASGKSKGFLFVECGSSDDAKKILKSFNGKRLD 140

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 238 LFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEALNDSELN 285
           LF+K G +V+     D A GK KGF FV     +DA K +++ N   L+
Sbjct: 92  LFSKAGKVVNMDFPIDEASGKSKGFLFVECGSSDDAKKILKSFNGKRLD 140

>CAGL0I08393g complement(818759..820051) similar to sp|P34167
           Saccharomyces cerevisiae YPR163c TIF3, start by
           similarity
          Length = 430

 Score = 32.7 bits (73), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 3/77 (3%)

Query: 225 NINSETTDEQFQELFAKFGPIVSASLEKDADG--KLKGFGFVNYEKHEDAVKAVEALNDS 282
           +I+ E      ++   K G +   SL K      +LKG  F+  ++ ED VKA+   N +
Sbjct: 107 DISPEGVQAWVEDGLGKEGAVEEVSLPKSIKDPTRLKGIAFITLKEREDLVKAL-TFNST 165

Query: 283 ELNGEKLYVGRAQKKNE 299
           +LN   +YV  A  + E
Sbjct: 166 KLNERTVYVSVAAPRRE 182

>CAGL0H04675g complement(447256..448080) highly similar to sp|Q04067
           Saccharomyces cerevisiae YDR429c TIF35, start by
           similarity
          Length = 274

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 45/101 (44%), Gaps = 7/101 (6%)

Query: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340
           DS +     YV  +++   R        +AYR +   +     L +  L+++ D+  L  
Sbjct: 153 DSGITATGAYVPPSRRAGAR----DPSSDAYR-DARERDDSCTLKILQLNENADENTLRN 207

Query: 341 EFA-PYGTITSAKVMRT-ENGKSKGFGFVCFSTPEEATKAI 379
           E   P+  I    V+R  E G+S+G  FV F   + A KA+
Sbjct: 208 ELLFPFEPIQKVVVVRNKETGRSRGLAFVTFINEDMAEKAL 248

>CAGL0G05401g complement(508557..510572) similar to sp|P34761
           Saccharomyces cerevisiae YNL197c WHI3 involved in
           regulation of cell size, hypothetical start
          Length = 671

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 3/70 (4%)

Query: 221 LYVKNINSETTDEQFQELFA-KFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEAL 279
           LYV N+ S+ T+++ ++LF+ +FG    +   K+A+G   G G + + + +D   A  AL
Sbjct: 546 LYVGNLPSDATEQELRQLFSNQFGFRRLSFRNKNANGTGHGHGPMCFVEFDDVSCATRAL 605

Query: 280 NDSELNGEKL 289
              EL G +L
Sbjct: 606 --VELYGSQL 613

>ACL071C [978] [Homologous to ScYHL034C (SBP1) - SH; ScYLL046C
           (RNP1) - SH] (229767..230663) [897 bp, 298 aa]
          Length = 298

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGK--SKGFGFVHFEEEGAAKEAID 184
            IFI NL  D   +   D   VFG  +  +I +++ GK   + + FV F  +   +E  +
Sbjct: 25  TIFIGNLAGDCSEE---DLKQVFGAHVEVEIPSNKTGKFYKQRYAFVKFPAKIDFEEVKE 81

Query: 185 ALNGMLLNGQEIYVAPHLSRKERD 208
             +  ++  + IYV   L++++RD
Sbjct: 82  KYDKTVVRERSIYVRQALTKEQRD 105

>YDR381W (YRA1) [1208] chr4 (1236546..1236830,1237597..1237992)
           Protein with RNA:RNA annealing activity, involved in
           mRNA packaging for export from the nucleus, contains one
           RNA recognition (RRM) domain [681 bp, 226 aa]
          Length = 226

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (56%)

Query: 78  SLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWS 114
           S G A + F + E  R+A+E+ N +PI G   R+  +
Sbjct: 118 STGMANITFKNGELARRAVERFNGSPIDGGRSRLRLN 154

 Score = 29.3 bits (64), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 128 IFIKNLHPDIDNKALYDTF-SVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDAL 186
           + ++ L  DI   A+ + F S  G +    ++ +E G+S G   + F+    A+ A++  
Sbjct: 80  VNVEGLPRDIKQDAVREFFASQVGGVQRVLLSYNERGQSTGMANITFKNGELARRAVERF 139

Query: 187 NGMLLNG 193
           NG  ++G
Sbjct: 140 NGSPIDG 146

>AAR022W [208] [Homologous to ScYIR009W (MSL1) - SH]
           complement(381754..382098) [345 bp, 114 aa]
          Length = 114

 Score = 30.4 bits (67), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 8/80 (10%)

Query: 323 NLFVKNLDDSVDDEKLEEE----FAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKA 378
            L++ NL+D V    L       F+ +G +    +    + K +G  FV  ST +EA  A
Sbjct: 33  TLYISNLNDQVKISTLRTNLYLLFSTFGEVLRIAM----SPKLRGQAFVVLSTVDEANLA 88

Query: 379 ITEKNQQIVAGKPLYVAIAQ 398
           +     +   GKPL +  ++
Sbjct: 89  MISLKDESFFGKPLRIQFSK 108

>ADL126C [1615] [Homologous to ScYFR032C - SH] (469991..471391)
           [1401 bp, 466 aa]
          Length = 466

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 48/242 (19%), Positives = 88/242 (36%), Gaps = 63/242 (26%)

Query: 40  LYVGDLEPSVSEAHLYDI---FSPIGSVSSIRVCRDAITKTS---LGYAYVNFNDHEAGR 93
           +Y+ +L    +E  L +    F P+  +   +  R    KTS   LG AYV F D +   
Sbjct: 51  VYISNLSQDATEEALTEFLKDFHPVSVLIPSQSVR-GFQKTSVRPLGIAYVEFKDADTAA 109

Query: 94  KAIEQLNYTPIKGRLCRIMW---------------------SQRDPSLRKKGS--GNIFI 130
           K I +LN      R  R+ +                      +R   LR++ S  G    
Sbjct: 110 KVILELNGVTFMDRELRLRYHIPFKSEKEKLARGPNKFRQIQRRLSELRRRNSDAGATVT 169

Query: 131 KNLHPDIDNKAL--------------------YDTFSVFGDILSSKIATDENGKSKGF-- 168
            +  P +D  A+                     D  + F + L  +I   ++ + +G+  
Sbjct: 170 TDNGPQVDAAAVPREMSKVTIYVGRLPGRTTDKDLRTYFHEYLPQEIIVFKHRQFRGWRI 229

Query: 169 ------GFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLY 222
                   + F +    + A+++L+ +  NG+ + +AP    K     L E +A    + 
Sbjct: 230 RRHVTAAVITFPDHERQESALESLSNLPFNGRTVRMAPAFEDK-----LAEIRAEVQRMA 284

Query: 223 VK 224
           V+
Sbjct: 285 VE 286

>AFR149C [3341] [Homologous to ScYDR381W (YRA1) - SH]
           (705111..705524,706055..706303) [663 bp, 220 aa]
          Length = 220

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 128 IFIKNLHPDIDNKALYDTF-SVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDAL 186
           + ++ L  DI   A+ D F S  G +    ++ +E G S G   + F     A+EA+   
Sbjct: 68  VNVEGLPRDIKEDAVRDFFRSSVGGLQRVLLSYNERGNSTGMATLTFANAEKAREAVKKF 127

Query: 187 NGMLLNG 193
           NG  ++G
Sbjct: 128 NGAPIDG 134

>Scas_632.7*
          Length = 229

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 41/89 (46%), Gaps = 9/89 (10%)

Query: 106 GRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTF-SVFGDILSSKIATDENGK 164
            R+ +++ SQR+          + ++ L  DI   A+ + F S  G +    ++ +E G+
Sbjct: 65  ARVSKLLDSQRE--------VKVNVEGLPRDIKQDAVREFFASQVGGVQRVLLSYNERGQ 116

Query: 165 SKGFGFVHFEEEGAAKEAIDALNGMLLNG 193
           S G   + F     AK A+   NG  ++G
Sbjct: 117 STGMANITFRNAQQAKVAVTKFNGAPIDG 145

>YOR361C (PRT1) [5138] chr15 complement(1015357..1017648)
           Translation initiation factor eIF3 beta subunit (p90),
           has an RNA recognition (RRM) domain [2292 bp, 763 aa]
          Length = 763

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 140 KALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLN 192
           KAL   FS  G +++ +   DE  GK+KGF FV       AK+ I + +G  L+
Sbjct: 97  KALTSLFSKAGKVVNMEFPIDEATGKTKGFLFVECGSMNDAKKIIKSFHGKRLD 150

>KLLA0D12364g complement(1051765..1053660) some similarities with
           sp|P32770 Saccharomyces cerevisiae YDL167c ARP1
           singleton, hypothetical start
          Length = 631

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 48/111 (43%), Gaps = 28/111 (25%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFG--PI----VSASLEKDA--------------DGKL 258
           T LY+ N+  +TT  + +  FA+FG  P+    V   +E  +              D + 
Sbjct: 236 TVLYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDTSNVNNNWSTNNNLYVDEQD 295

Query: 259 KGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERM--HVLKKQ 307
              GFV Y+ HE      EAL+   LNG  +    +  K  R+  HV++ Q
Sbjct: 296 SISGFVVYQAHE------EALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQ 340

>CAGL0E03179g 293086..294351 similar to sp|P39927 Saccharomyces
           cerevisiae YGR156w, start by similarity
          Length = 421

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDA-DGKLKGFGFVNYEKHEDAVKAVE 277
           T++ V NI S+   +    + A  GPI+  S  KD   GK+ G  + +Y + +D  +A +
Sbjct: 20  TSILVTNIPSDWNQDVVSSVVAGSGPIIDISSRKDPRTGKVNGLVY-DYREPQDCRRAYD 78

Query: 278 ALNDSE 283
            L   E
Sbjct: 79  LLQRVE 84

>KLLA0B00847g complement(65983..66792) similar to sp|Q04067
           Saccharomyces cerevisiae YDR429c TIF35 translation
           initiation factor eIF3 (p33 subunit) singleton, start by
           similarity
          Length = 269

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 323 NLFVKNLDDSVDDEKLEEEFA-PYGTITSAKVMRT-ENGKSKGFGFVCFSTPEEATKAI 379
            + +  +++  D+E L+ E   P+G I    V++  E G+S+G  +V F T E A +A+
Sbjct: 185 TIRLTQVNELADEEVLKRELLFPFGEIPRVFVVKNPETGRSRGVAYVTFQTEEIAAQAL 243

 Score = 29.3 bits (64), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 27/63 (42%)

Query: 56  DIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQ 115
           ++  P G +  + V ++  T  S G AYV F   E   +A++ L        +    WS+
Sbjct: 203 ELLFPFGEIPRVFVVKNPETGRSRGVAYVTFQTEEIAAQALKLLEGRGFMNFMLHAEWSK 262

Query: 116 RDP 118
             P
Sbjct: 263 PKP 265

>Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement
          Length = 284

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 23/47 (48%)

Query: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNF 86
           ++VG++ PS +   L   F   G +  + +  +  T    GYAY+ F
Sbjct: 85  IFVGNISPSTTPESLEAHFEDAGVIKRVTILYNKHTGAPKGYAYIEF 131

>Kwal_27.11158
          Length = 567

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 9/64 (14%)

Query: 330 DDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAG 389
           D+ V ++KL ++ + YG I S K++ TE    KG  FV F +   A K ++     + A 
Sbjct: 260 DEVVTEQKLRDDLSFYGEIESVKII-TE----KGIAFVHFCSIFSAIKVVSS----LAAV 310

Query: 390 KPLY 393
            P Y
Sbjct: 311 NPYY 314

>CAGL0E03630g complement(335091..337331) weakly similar to sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation,
           hypothetical start
          Length = 746

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 43/99 (43%), Gaps = 10/99 (10%)

Query: 128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALN 187
           IF+  L      + L   FS  G I +  + +     +  F F+ +E E AA  A+D  N
Sbjct: 378 IFVGQLDLSTTKEILVKRFSTHGKIRNIDVVSKP---TTVFAFIEYETEQAAAAALDKEN 434

Query: 188 GMLLNGQEIYV------APHLSRK-ERDSQLEETKAHYT 219
             +L  + ++V       PH  R  +R+S  +E    +T
Sbjct: 435 HSILLSKTMHVQYKEIGGPHGRRLFKRNSYFKEVSKTFT 473

>Kwal_23.5204
          Length = 294

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 40/92 (43%), Gaps = 10/92 (10%)

Query: 128 IFIKNLHPDIDNK-ALYDTFSVFGDILS--------SKIATDENGKSKGFGFVHFEEEGA 178
           I++ NL      K A+   FS +G I           K+ TDE G  KG   V +    +
Sbjct: 49  IYVSNLPLGSTTKDAVVKEFSKYGIIQKDAKTNEPRCKLYTDEQGSFKGSALVVYMRRES 108

Query: 179 AKEAIDALNGMLLNGQEIYVAPHLSRKE-RDS 209
              AID +NG    G E+ V     +K+ RDS
Sbjct: 109 VDLAIDLMNGYRFLGNELKVEEATFKKDIRDS 140

>Sklu_2391.1 YPL190C, Contig c2391 194-2479 reverse complement
          Length = 761

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 39/90 (43%), Gaps = 11/90 (12%)

Query: 96  IEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSS 155
           IE+  YT       RI   Q  P   +   GN+ +KN    +  + L+  FS +G I   
Sbjct: 316 IERQRYTEYLRGENRITEIQHFPPKSRLFIGNLPLKN----VTKEDLFRIFSPYGHIFQI 371

Query: 156 KIATDENGKSKGFGFVHFEEEGAAKEAIDA 185
            I          FGF+ +++  + K+AI+ 
Sbjct: 372 NIKN-------AFGFIQYDDPQSVKDAIEC 394

>ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH]
           complement(1034093..1034902) [810 bp, 269 aa]
          Length = 269

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/60 (23%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 322 VNLFVKNLDDSVDDEKLEEEF-APYGTITSAKVMRT-ENGKSKGFGFVCFSTPEEATKAI 379
           + L +  L+++ D+  ++++  +P+  +    V+R  E G+S+G  +V F++ ++A  A+
Sbjct: 188 MTLKIMQLNENADEMTIKQKLLSPFPNVPRVAVVRNKETGRSRGIAYVTFASEKDAETAL 247

 Score = 29.6 bits (65), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 27/59 (45%)

Query: 57  IFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQ 115
           + SP  +V  + V R+  T  S G AYV F   +    A+  L+       + ++ WS+
Sbjct: 208 LLSPFPNVPRVAVVRNKETGRSRGIAYVTFASEKDAETALRLLHGRGFMNLILQVDWSK 266

>YPL190C (NAB3) [5257] chr16 complement(185316..187724) Nuclear
           polyadenylated RNA-binding protein with one RNA
           recognition (RRM) domain [2409 bp, 802 aa]
          Length = 802

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 9/59 (15%)

Query: 40  LYVGDLE-PSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIE 97
           L++G+L   +VS+  L+ IFSP G +  I +      K + G  ++ F++ ++ R AIE
Sbjct: 332 LFIGNLPLKNVSKEDLFRIFSPYGHIMQINI------KNAFG--FIQFDNPQSVRDAIE 382

>AFL070C [3123] [Homologous to ScYPL190C (NAB3) - SH]
           (303268..305541) [2274 bp, 757 aa]
          Length = 757

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 36/73 (49%), Gaps = 11/73 (15%)

Query: 126 GNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDA 185
           GN+ +KN    +  + L+  FS +G I    I          FGF+ ++   + K+AI+ 
Sbjct: 294 GNLPLKN----VTKEDLFRIFSPYGHIFQINI-------KNAFGFIQYDNAQSVKDAIEC 342

Query: 186 LNGMLLNGQEIYV 198
            +G +  G+++ +
Sbjct: 343 ESGTMNFGKKLIL 355

>CAGL0C01419g complement(153063..154982) similar to sp|Q08925
           Saccharomyces cerevisiae YPL184c, hypothetical start
          Length = 639

 Score = 29.3 bits (64), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 14/96 (14%)

Query: 333 VDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAIT---EKN-----Q 384
           + +EKL E+   YG I S K++       K   FV FS+   A K ++   +KN     +
Sbjct: 335 LTEEKLREDLKEYGEIDSIKII-----PEKDIAFVHFSSIATAIKVVSTLAQKNPFYQEK 389

Query: 385 QIVAGKPLYVAIAQRKDVRRSQ-LAQQIQARNQMRY 419
           +I  GK     I + +    +Q L  Q +  + MRY
Sbjct: 390 KIFYGKDRCAFITKTQQHNAAQFLGVQPEMEHLMRY 425

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.132    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,043,529
Number of extensions: 801967
Number of successful extensions: 3472
Number of sequences better than 10.0: 242
Number of HSP's gapped: 2878
Number of HSP's successfully gapped: 690
Length of query: 567
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 460
Effective length of database: 12,891,983
Effective search space: 5930312180
Effective search space used: 5930312180
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)