Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER164W (CHD1)1468144266100.0
Scas_576.61457133147480.0
CAGL0L11770g1476134047350.0
Kwal_56.234421435132944700.0
AGR123C1422144544460.0
KLLA0C17578g1525139342670.0
Scas_665.17106054212161e-146
YOR304W (ISW2)112056312061e-143
CAGL0I09614g103953811801e-141
Kwal_34.15925102554811641e-138
KLLA0F24838g106254211601e-138
Scas_652.17102557211511e-137
AFR537W102553911461e-136
CAGL0C01683g111556711471e-135
Kwal_14.1600110252611221e-132
AFL040W108657311011e-129
AER375C128851811031e-128
KLLA0F04521g134456011031e-127
Kwal_23.4777130156010971e-127
Scas_662.7134251810911e-126
YBR245C (ISW1)112951910781e-125
Scas_597.8106556410711e-125
KLLA0F06710g109657610711e-125
YIL126W (STH1)135952910781e-124
Kwal_26.9164145455110621e-121
Scas_594.7170351910691e-121
CAGL0G08756g135451810521e-120
YOR290C (SNF2)170352110571e-119
KLLA0B08327g153456110501e-119
AFR562C144456210441e-118
CAGL0M04807g173052910471e-118
Kwal_47.180778095508636e-99
KLLA0E04048g8265918646e-99
CAGL0J02662g8445488561e-97
ADL098C8045478021e-90
Sklu_2125.310525226912e-74
CAGL0I01694g10715236912e-74
KLLA0F07513g10485306902e-74
Scas_549.410795236893e-74
ACR286C10195376874e-74
YJR035W (RAD26)10855266884e-74
Kwal_26.712310815456806e-73
KLLA0E22726g10335436778e-73
CAGL0H05533g19045646842e-72
CAGL0H06193g11265416735e-72
YAL019W (FUN30)11315376664e-71
AEL065C10255546591e-70
AEL256C18665316557e-69
KLLA0E23804g18735356503e-68
YPL082C (MOT1)18675336469e-68
Scas_664.918595336441e-67
Scas_548.410545366352e-67
Scas_668.188754815998e-64
Kwal_34.160827264795911e-63
KLLA0A03069g8954795873e-62
AEL297W8954875865e-62
Kwal_14.15378424815702e-60
ADR309W14863335715e-59
YGL163C (RAD54)8984815626e-59
CAGL0I04224g9424795611e-58
CAGL0M01188g14503715671e-58
AGR379W14143335626e-58
Scas_646.3*14563765626e-58
Scas_669.2013973215609e-58
YDR334W15143735619e-58
KLLA0F21758g15723255554e-57
KLLA0F11814g9315905466e-57
KLLA0E08965g14893265538e-57
YGL150C (INO80)14893735521e-56
CAGL0E05038g14843295483e-56
Kwal_55.2014314943275483e-56
Kwal_27.1138813343535421e-55
Scas_718.409264975172e-53
Scas_520.58632835135e-53
AGL212W9034795145e-53
YBR073W (RDH54)9244795092e-52
YFR038W8532845045e-52
CAGL0M01958g9204964994e-51
Kwal_27.105139004914976e-51
Sklu_1582.22831624158e-45
KLLA0C05368g16051472442e-20
CAGL0K07766g8302232352e-19
ADL345C7462272262e-18
Scas_591.107722302227e-18
Kwal_23.36607682062201e-17
YBR114W (RAD16)7902362163e-17
KLLA0B09240g8002062146e-17
Kwal_14.186813571312102e-16
AAR147W15801332085e-16
CAGL0G09493g14083492051e-15
Scas_721.10011371362022e-15
YLR032W (RAD5)11691571986e-15
Scas_674.12d13231281987e-15
CAGL0A03432g11511381961e-14
Kwal_47.177719721601941e-14
AFR220W10851761942e-14
YOR191W (RIS1)16191341898e-14
KLLA0F17479g11141341871e-13
Sklu_2412.711273591654e-11
YLR247C15561621531e-09
Scas_573.915021191422e-08
CAGL0B05049g14701301404e-08
KLLA0F12166g15281381306e-07
AAL030C15391281234e-06
Kwal_14.128715181171234e-06
Sklu_2234.210061651091e-04
Sklu_2432.914751021030.001
ADL273C623145900.028
KLLA0A05203g435139830.16
Sklu_2273.4435138810.24
Kwal_56.24760433139810.25
CAGL0L03047g715113820.25
AFR082C710100790.46
KLLA0F10505g812141790.55
CAGL0L02915g617152770.93
YHR169W (DBP8)431141761.1
Scas_588.1669360761.1
CAGL0I02354g437138732.0
Scas_713.5796265742.1
YPR179C (HDA3)655235723.1
YDR088C (SLU7)38251714.0
Sklu_2436.436476696.1
CAGL0J06908g604112696.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER164W
         (1442 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in ...  2550   0.0  
Scas_576.6                                                           1833   0.0  
CAGL0L11770g 1254125..1258555 highly similar to sp|P32657 Saccha...  1828   0.0  
Kwal_56.23442                                                        1726   0.0  
AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH] (980963..98...  1717   0.0  
KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces...  1648   0.0  
Scas_665.17                                                           473   e-146
YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required fo...   469   e-143
CAGL0I09614g 917707..920826 highly similar to tr|Q08773 Saccharo...   459   e-141
Kwal_34.15925                                                         452   e-138
KLLA0F24838g complement(2309842..2313030) similar to sgd|S000583...   451   e-138
Scas_652.17                                                           447   e-137
AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH] complement(...   446   e-136
CAGL0C01683g 178695..182042 highly similar to sp|P38144 Saccharo...   446   e-135
Kwal_14.1600                                                          436   e-132
AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH] complement(...   428   e-129
AER375C [2876] [Homologous to ScYIL126W (STH1) - SH] (1332505..1...   429   e-128
KLLA0F04521g complement(435649..439683) similar to sp|P32597 Sac...   429   e-127
Kwal_23.4777                                                          427   e-127
Scas_662.7                                                            424   e-126
YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative AT...   419   e-125
Scas_597.8                                                            417   e-125
KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces c...   417   e-125
YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundan...   419   e-124
Kwal_26.9164                                                          413   e-121
Scas_594.7                                                            416   e-121
CAGL0G08756g complement(829778..833842) highly similar to sp|P32...   409   e-120
YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component...   411   e-119
KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces c...   409   e-119
AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH] (1439983..1...   406   e-118
CAGL0M04807g complement(514847..520039) similar to sp|P22082 Sac...   407   e-118
Kwal_47.18077                                                         337   6e-99
KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces c...   337   6e-99
CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces c...   334   1e-97
ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH] (508448..51...   313   1e-90
Sklu_2125.3 YJR035W, Contig c2125 6474-9632                           270   2e-74
CAGL0I01694g complement(141422..144637) similar to sp|P40352 Sac...   270   2e-74
KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces c...   270   2e-74
Scas_549.4                                                            270   3e-74
ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH] (877337..8...   269   4e-74
YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase ...   269   4e-74
Kwal_26.7123                                                          266   6e-73
KLLA0E22726g complement(2018248..2021349) similar to sp|P40352 S...   265   8e-73
CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharo...   268   2e-72
CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces c...   263   5e-72
YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p f...   261   4e-71
AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH] (511520..5...   258   1e-70
AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..16...   256   7e-69
KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces...   254   3e-68
YPL082C (MOT1) [5362] chr16 complement(398475..404078) Transcrip...   253   9e-68
Scas_664.9                                                            252   1e-67
Scas_548.4                                                            249   2e-67
Scas_668.18                                                           235   8e-64
Kwal_34.16082                                                         232   1e-63
KLLA0A03069g complement(271516..274203) similar to sp|P32863 Sac...   230   3e-62
AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH] complement...   230   5e-62
Kwal_14.1537                                                          224   2e-60
ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH] complement(...   224   5e-59
YGL163C (RAD54) [1826] chr7 complement(193711..196407) DNA-depen...   221   6e-59
CAGL0I04224g complement(369858..372686) highly similar to sp|P32...   220   1e-58
CAGL0M01188g complement(132330..136682) similar to sp|Q05471 Sac...   223   1e-58
AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH] complement...   221   6e-58
Scas_646.3*                                                           221   6e-58
Scas_669.20                                                           220   9e-58
YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2...   220   9e-58
KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471 S...   218   4e-57
KLLA0F11814g complement(1089699..1092494) similar to sp|P38086 S...   214   6e-57
KLLA0E08965g complement(797861..802330) similar to sp|P53115 Sac...   217   8e-57
YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of...   217   1e-56
CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces c...   215   3e-56
Kwal_55.20143                                                         215   3e-56
Kwal_27.11388                                                         213   1e-55
Scas_718.40                                                           203   2e-53
Scas_520.5                                                            202   5e-53
AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH] complement...   202   5e-53
YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for...   200   2e-52
YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the Snf...   198   5e-52
CAGL0M01958g complement(238113..240875) similar to sp|P38086 Sac...   196   4e-51
Kwal_27.10513                                                         196   6e-51
Sklu_1582.2 , Contig c1582 197-1048                                   164   8e-45
KLLA0C05368g 481598..486415 some similarities with sgd|S0005717 ...    99   2e-20
CAGL0K07766g 770935..773427 highly similar to sp|P31244 Saccharo...    95   2e-19
ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH] (100332..1...    92   2e-18
Scas_591.10                                                            90   7e-18
Kwal_23.3660                                                           89   1e-17
YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision ...    88   3e-17
KLLA0B09240g complement(810178..812580) similar to sp|P31244 Sac...    87   6e-17
Kwal_14.1868                                                           86   2e-16
AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH] complement(6...    85   5e-16
CAGL0G09493g complement(902228..906454) similar to tr|Q08562 Sac...    84   1e-15
Scas_721.100                                                           82   2e-15
YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded DNA...    81   6e-15
Scas_674.12d                                                           81   7e-15
CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces c...    80   1e-14
Kwal_47.17771                                                          79   1e-14
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...    79   2e-14
YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in...    77   8e-14
KLLA0F17479g complement(1601287..1604631) similar to sp|P32849 S...    77   1e-13
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          68   4e-11
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    64   1e-09
Scas_573.9                                                             59   2e-08
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    59   4e-08
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    55   6e-07
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    52   4e-06
Kwal_14.1287                                                           52   4e-06
Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement         47   1e-04
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              44   0.001
ADL273C [1468] [Homologous to ScYOR204W (DED1) - SH; ScYPL119C (...    39   0.028
KLLA0A05203g complement(462167..463474) highly similar to sp|P38...    37   0.16 
Sklu_2273.4 YHR169W, Contig c2273 4981-6288                            36   0.24 
Kwal_56.24760                                                          36   0.25 
CAGL0L03047g 350035..352182 similar to sp|P36120 Saccharomyces c...    36   0.25 
AFR082C [3274] [Homologous to ScYKR024C (DBP7) - SH] (576175..57...    35   0.46 
KLLA0F10505g complement(966736..969174) some similarities with s...    35   0.55 
CAGL0L02915g complement(340834..342687) highly similar to sp|P06...    34   0.93 
YHR169W (DBP8) [2456] chr8 (442180..443475) Essential nucleolar ...    34   1.1  
Scas_588.16                                                            34   1.1  
CAGL0I02354g 209279..210592 highly similar to sp|P38719 Saccharo...    33   2.0  
Scas_713.57                                                            33   2.1  
YPR179C (HDA3) [5593] chr16 complement(893791..895758) Protein o...    32   3.1  
YDR088C (SLU7) [940] chr4 complement(618491..619639) Pre-mRNA sp...    32   4.0  
Sklu_2436.4 YDR459C, Contig c2436 10516-11610 reverse complement       31   6.1  
CAGL0J06908g complement(659917..661731) similar to sp|P24784 Sac...    31   6.8  

>YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in
            ATP-dependent nucleosome remodeling activity, member of
            the Chromodomain-Helicase-DNA-binding (CHD) family [4407
            bp, 1468 aa]
          Length = 1468

 Score = 2550 bits (6610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1261/1442 (87%), Positives = 1261/1442 (87%)

Query: 1    MAAKDISTEVLQNPELYGLRRSHRAAAHQQNYFNXXXXXXXXXNIKQSRRKRMTTIXXXX 60
            MAAKDISTEVLQNPELYGLRRSHRAAAHQQNYFN         NIKQSRRKRMTTI    
Sbjct: 1    MAAKDISTEVLQNPELYGLRRSHRAAAHQQNYFNDSDDEDDEDNIKQSRRKRMTTIEDDE 60

Query: 61   XXXXXXXXXXXXXXXXXXXXXXXXXXYYGSPIKQNXXXXXXXXXXXXXXXXXXXXXXXXX 120
                                      YYGSPIKQN                         
Sbjct: 61   DEFEDEEGEEDSGEDEDEEDFEEDDDYYGSPIKQNRSKPKSRTKSKSKSKPKSQSEKQST 120

Query: 121  VKIPTRFSNRQNKTVNYNIXXXXXXXXXXXXXXGSEEALSEENVHEASANPQPEDFHGID 180
            VKIPTRFSNRQNKTVNYNI              GSEEALSEENVHEASANPQPEDFHGID
Sbjct: 121  VKIPTRFSNRQNKTVNYNIDYSDDDLLESEDDYGSEEALSEENVHEASANPQPEDFHGID 180

Query: 181  IVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQVRGLK 240
            IVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQVRGLK
Sbjct: 181  IVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQVRGLK 240

Query: 241  RLDNYCKQFIIEDQQVRLDPYVTAXXXXXXXXXXXXXXXXXXXXHVPERIIDSQRASLED 300
            RLDNYCKQFIIEDQQVRLDPYVTA                    HVPERIIDSQRASLED
Sbjct: 241  RLDNYCKQFIIEDQQVRLDPYVTAEDIEIMDMERERRLDEFEEFHVPERIIDSQRASLED 300

Query: 301  GTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQRPR 360
            GTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQRPR
Sbjct: 301  GTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQRPR 360

Query: 361  FEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIF 420
            FEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIF
Sbjct: 361  FEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIF 420

Query: 421  ARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGK 480
            ARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGK
Sbjct: 421  ARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGK 480

Query: 481  KTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLI 540
            KTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLI
Sbjct: 481  KTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLI 540

Query: 541  TGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKK 600
            TGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKK
Sbjct: 541  TGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKK 600

Query: 601  DVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASN 660
            DVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASN
Sbjct: 601  DVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASN 660

Query: 661  HPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQM 720
            HPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQM
Sbjct: 661  HPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQM 720

Query: 721  VRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINL 780
            VRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINL
Sbjct: 721  VRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINL 780

Query: 781  MTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILE 840
            MTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILE
Sbjct: 781  MTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILE 840

Query: 841  YAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDNQKKLEDLNLDDVLNHAED 900
            YAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDNQKKLEDLNLDDVLNHAED
Sbjct: 841  YAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDNQKKLEDLNLDDVLNHAED 900

Query: 901  HVTTPDLGESHLGGEEFLKQFEVTDYKAXXXXXXXXXXXXXXXXXXXXXXXXXXXYVKEQ 960
            HVTTPDLGESHLGGEEFLKQFEVTDYKA                           YVKEQ
Sbjct: 901  HVTTPDLGESHLGGEEFLKQFEVTDYKADIDWDDIIPEEELKKLQDEEQKRKDEEYVKEQ 960

Query: 961  LEMMNRRDNALKKIKNSVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGESEVRALYK 1020
            LEMMNRRDNALKKIKNSVN                              IGESEVRALYK
Sbjct: 961  LEMMNRRDNALKKIKNSVNGDGTAANSDSDDDSTSRSSRRRARANDMDSIGESEVRALYK 1020

Query: 1021 AILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEKLEK 1080
            AILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEKLEK
Sbjct: 1021 AILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEKLEK 1080

Query: 1081 HATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLFNFKGVKSLNAESLLSRVEDL 1140
            HATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLFNFKGVKSLNAESLLSRVEDL
Sbjct: 1081 HATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLFNFKGVKSLNAESLLSRVEDL 1140

Query: 1141 KYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQIRD 1200
            KYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQIRD
Sbjct: 1141 KYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQIRD 1200

Query: 1201 DPFLGITDKIFLNEVHNPVAXXXXXXXXXXXXXXXXXXXXXXXXXXVPGAIHLGRRVDYL 1260
            DPFLGITDKIFLNEVHNPVA                          VPGAIHLGRRVDYL
Sbjct: 1201 DPFLGITDKIFLNEVHNPVAKKSASSSDTTPTPSKKGKGITGSSKKVPGAIHLGRRVDYL 1260

Query: 1261 LSFLRGGLNTKSPSADIGSKKLPTGPSKKRQRKPANHSKSMTPEITSSEPANGPPSKRMK 1320
            LSFLRGGLNTKSPSADIGSKKLPTGPSKKRQRKPANHSKSMTPEITSSEPANGPPSKRMK
Sbjct: 1261 LSFLRGGLNTKSPSADIGSKKLPTGPSKKRQRKPANHSKSMTPEITSSEPANGPPSKRMK 1320

Query: 1321 ALPKGPAALINNTRLSPNSPTPPLKSKVSRDNGTRQSSNPSSGSAHEKEYDSMDEEDCRH 1380
            ALPKGPAALINNTRLSPNSPTPPLKSKVSRDNGTRQSSNPSSGSAHEKEYDSMDEEDCRH
Sbjct: 1321 ALPKGPAALINNTRLSPNSPTPPLKSKVSRDNGTRQSSNPSSGSAHEKEYDSMDEEDCRH 1380

Query: 1381 TMSAIRTSLKRLRRGGKSLDRKEWAKILKTELTTIGNHIESQKGSSRKASPEKYRKHLWS 1440
            TMSAIRTSLKRLRRGGKSLDRKEWAKILKTELTTIGNHIESQKGSSRKASPEKYRKHLWS
Sbjct: 1381 TMSAIRTSLKRLRRGGKSLDRKEWAKILKTELTTIGNHIESQKGSSRKASPEKYRKHLWS 1440

Query: 1441 YS 1442
            YS
Sbjct: 1441 YS 1442

>Scas_576.6
          Length = 1457

 Score = 1833 bits (4748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 916/1331 (68%), Positives = 1029/1331 (77%), Gaps = 34/1331 (2%)

Query: 123  IPTRFSNRQNKTVNYNIXXXXXXXXXXXXXXGSEEALSEE--------NVHEASANPQPE 174
            +P RFS R NKTVNYN+                     +E        N  E SA PQ E
Sbjct: 122  VPVRFSERNNKTVNYNVDYSDDDLLVSEEDYDMNSDDEDEENDEEDTGNRLEYSATPQLE 181

Query: 175  DFHGIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIG 234
            D H ID+VI H+LK  ++E   + K V +L  CK+N +FLIKWTD+SHLHNTWETYES+G
Sbjct: 182  DVHSIDMVITHKLKDGVDES--VWKKVMNLQECKDNIQFLIKWTDQSHLHNTWETYESLG 239

Query: 235  QVRGLKRLDNYCKQFIIEDQQVRLDPYVTAXXXXXXXXXXXXXXXXXXXXHVPERIIDSQ 294
            Q++GLKRLDNYCKQFII+DQQVRLDPY+T                      +PERI+DSQ
Sbjct: 240  QIKGLKRLDNYCKQFIIQDQQVRLDPYITPEDLEVMDMEQERRLDEFQEFTIPERIVDSQ 299

Query: 295  RASLEDGTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENSKILPQYSSNY 354
            R +L+DGTS+LQYLVKW+RLNYDEATWE A DIVK APEQVKHFQNR NSKILPQ S+NY
Sbjct: 300  RVTLDDGTSELQYLVKWKRLNYDEATWEAAADIVKDAPEQVKHFQNRINSKILPQNSTNY 359

Query: 355  T-SQRPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVA 413
              S RP+FEKL  QP ++K GELRDFQLTGINWMAFLWSK DNGILADEMGLGKTVQTVA
Sbjct: 360  NNSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVA 419

Query: 414  FISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYT 473
            FISWLI+ARRQNGPHI+VVPLSTMPAW +TF+KWAPDLN ICYMGNQ+SRD IRE+EFYT
Sbjct: 420  FISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYT 479

Query: 474  NPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFK 533
            NP AKGKK +KFNVLLTTYEYILKDR+ELGSIKWQF+AVDEAHRLKNAESSLYESLNSFK
Sbjct: 480  NPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFK 539

Query: 534  VANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPF 593
            V NR+LITGTPLQNNIKELAAL+NFLMPGRFTIDQEIDFENQDEEQEEYI DLH+R+QPF
Sbjct: 540  VNNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEIDFENQDEEQEEYIRDLHKRLQPF 599

Query: 594  ILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMN 653
            ILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAG+KGGHFSLLNIM+
Sbjct: 600  ILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIMS 659

Query: 654  ELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHR 713
            ELKKASNHPYLFDNAEERVL+KFGDG+M+RENVLRGLIMSSGKMVLLDQLL +LKKDGHR
Sbjct: 660  ELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGKMVLLDQLLNKLKKDGHR 719

Query: 714  VLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRA 773
            VLIFSQMVRMLDILGDYLSIKGI FQRLDGTVPSAQRRISIDHFN+PDS D VFLLSTRA
Sbjct: 720  VLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRA 779

Query: 774  GGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERA 833
            GGLGINLMTADTV+IFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERA
Sbjct: 780  GGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERA 839

Query: 834  RKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDNQKKLEDLNLDD 893
            RKKMILEYAIISLGVTDG+KYTKKNEPN GELS ILKFGAGNMF A DNQKKLEDLNLDD
Sbjct: 840  RKKMILEYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAAKDNQKKLEDLNLDD 899

Query: 894  VLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKAXXXXXXXXXXXXXXXXXXXXXXXXX 953
            VLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKA                         
Sbjct: 900  VLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPEEELKKLKDEEQKRKD 959

Query: 954  XXYVKEQLEMMNRRDNALKKIKNSVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGES 1013
              Y+KEQL+MMNRRDNALKKIK+SVN                              IGES
Sbjct: 960  DEYIKEQLDMMNRRDNALKKIKHSVN---GDGTTVDSDDESSSRTSKRRARNDLTSIGES 1016

Query: 1014 EVRALYKAILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKE 1073
            E+RA+YKA+LK+G+L  + +ELI+DG LPVKS +KY E Y EMME A++ +H EE  RKE
Sbjct: 1017 EIRAIYKAVLKYGDLTNLFEELISDGNLPVKSIDKYQEVYAEMMEVARENLHSEEAKRKE 1076

Query: 1074 ILEKLEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLFNFKGVKSLNAESL 1133
            I+EKLEK A  YR KLKSGEIK ++QPKDNP   L++K++EKKA+LF F  VKSLNAES 
Sbjct: 1077 IMEKLEKKAHEYRLKLKSGEIKPDDQPKDNPNAELAMKRKEKKAILFTFYDVKSLNAESF 1136

Query: 1134 LSRVEDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYG 1193
            + R E L +L+  I+ ++KDDPLKF + N +PK VQNWSSNW KE+DEKLL+GVFKYGYG
Sbjct: 1137 IGRAEALDFLRKYIHEHFKDDPLKFHIANRSPKAVQNWSSNWNKEDDEKLLVGVFKYGYG 1196

Query: 1194 SWTQIRDDPFLGITDKIFLNE-VHNPVAXXXXXXXXXXXXXXXXXXXXXXXXXXVPGAIH 1252
            SWTQIRDDPFLG+T+KIFLN+   +PV                           VPGAIH
Sbjct: 1197 SWTQIRDDPFLGLTNKIFLNDSSSDPVM---KKETATNTTNTKKGKGVTGSSKKVPGAIH 1253

Query: 1253 LGRRVDYLLSFLRGGLNTKSPSADIGSKKLPT-GPSKKRQRKPANHSKSMTPEITSSEPA 1311
            LGRRVDYL+S +R      +PSA       PT G  +KRQ K +       P    S   
Sbjct: 1254 LGRRVDYLISVMRDESQENTPSA----TATPTSGLKRKRQTKLSK------PPTAKSSVN 1303

Query: 1312 NGPPSKRMKALPKGPAALINNTRLSPNSPTPPLKSKVSRDNGTRQSSNPSSGSAHEKEYD 1371
            + P SKR K  PK    +   ++   NSPTP     V++   T   + P S +  EKEY+
Sbjct: 1304 STPSSKRTKLTPKTLKKVTKASKSVSNSPTP-----VNKKRTTSNMTPPGSENVIEKEYE 1358

Query: 1372 SMDEEDCRHTMSAIRTSLKRLRRGGKSLDRKEWAKILKTELTTIGNHIESQKGSSRKASP 1431
            SMDE++CRH M+ +R SLK+LR G K LDRKE+A +LK+ELT IG+HIESQKG+S+K  P
Sbjct: 1359 SMDEDECRHAMAPVRLSLKKLRNGNKGLDRKEFAHMLKSELTNIGDHIESQKGTSKKTDP 1418

Query: 1432 EKYRKHLWSYS 1442
              ++KHLWSYS
Sbjct: 1419 VNFKKHLWSYS 1429

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/32 (68%), Positives = 25/32 (78%), Gaps = 2/32 (6%)

Query: 2  AAKDISTEVLQNPELYGLRRSHRAAAHQQNYF 33
          + KD+  E+LQNPELYGLRRSHRA  H  NYF
Sbjct: 3  SVKDLPNEILQNPELYGLRRSHRAPTH--NYF 32

>CAGL0L11770g 1254125..1258555 highly similar to sp|P32657
            Saccharomyces cerevisiae YER164w CHD1 transcriptional
            regulator, start by similarity
          Length = 1476

 Score = 1828 bits (4735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 915/1340 (68%), Positives = 1050/1340 (78%), Gaps = 40/1340 (2%)

Query: 121  VKIPTRFSNRQNKTVNYNIXXXXXXXXXXXXXXGSEEA--LSEENVHEASANPQP-EDFH 177
            V IPTRFS+R NK VNYNI               S+E   L E+    A +N  P ED H
Sbjct: 134  VAIPTRFSSRANKQVNYNIDYSDDDLLESEEEFDSDEDELLDEDQESRARSNTPPQEDVH 193

Query: 178  GIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQVR 237
            GID+VI HR+K    + + L K VP+LN CKENYEF IKWTD+SHLHNTWETYES+  V+
Sbjct: 194  GIDMVITHRIKEG-SDKEHLAKIVPELNVCKENYEFQIKWTDQSHLHNTWETYESLAGVK 252

Query: 238  GLKRLDNYCKQFIIEDQQVRLDPYVTAXXXXXXXXXXXXXXXXXXXXHVPERIIDSQRAS 297
            G+KRLDNYCKQ+II++QQVRLDPY+T                       PERIIDSQR  
Sbjct: 253  GIKRLDNYCKQYIIQEQQVRLDPYITPEDIEIMDMEHERRLDELQEFTNPERIIDSQRVE 312

Query: 298  LEDGTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQ 357
            LEDGTSQLQYLVKWR LNYDEATWE+A +IVK+APE VKHFQ+R+NSKILPQYSSNYTS+
Sbjct: 313  LEDGTSQLQYLVKWRHLNYDEATWEDAAEIVKIAPEPVKHFQSRQNSKILPQYSSNYTSE 372

Query: 358  RPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISW 417
            RPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSK DNGILADEMGLGKTVQTVAFISW
Sbjct: 373  RPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISW 432

Query: 418  LIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRA 477
            LIFARRQNGPH++VVPLSTMPAW++TFEKWAPD++ ICYMGNQKSRD  REYEFY+NP+ 
Sbjct: 433  LIFARRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKG 492

Query: 478  KGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANR 537
            KGKK +KFNVL+TTYEYILKDRAELGSIKWQF+AVDEAHRLKNAESSLYESLNSFKVANR
Sbjct: 493  KGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANR 552

Query: 538  MLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRR 597
            +LITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQE+YI DLH+R+QPFILRR
Sbjct: 553  LLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEQYIRDLHKRLQPFILRR 612

Query: 598  LKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKK 657
            LKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGG FS+LNIMN L K
Sbjct: 613  LKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLNIMNTLMK 672

Query: 658  ASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIF 717
            ASNHPYLFD+AEE+VL+KFG G M+REN+LRGLIMSSGKMVLLD+LLTRLKKDGHRVLIF
Sbjct: 673  ASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGKMVLLDKLLTRLKKDGHRVLIF 732

Query: 718  SQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLG 777
            SQMVR+LDILGDYLSIKGINFQRLDGTVPS QRRI+IDHFN+P S+DFVFLLSTRAGGLG
Sbjct: 733  SQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLG 792

Query: 778  INLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM 837
            INLMTADTV+IFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM
Sbjct: 793  INLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM 852

Query: 838  ILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDNQKKLEDLNLDDVLNH 897
            ILEYAIISLGVTDGNKYTKK EP+AGELS ILKFGAGNMF A DNQKKLEDLNLDDVL+H
Sbjct: 853  ILEYAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAAKDNQKKLEDLNLDDVLSH 912

Query: 898  AEDHVTTPDLGESHLGGEEFLKQFEVTDYKAXXXXXXXXXXXXXXXXXXXXXXXXXXXYV 957
            AEDHVTTPDLGESHLGGEEFLKQFEVTDYKA                           YV
Sbjct: 913  AEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPEEELKKLQDEEQRHKDEEYV 972

Query: 958  KEQLEMMNRRDNALKKIKNSVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGESEVRA 1017
            KEQLEMMNRR+NALKKIK+SVN                              IG+SEVRA
Sbjct: 973  KEQLEMMNRRNNALKKIKDSVN---GEGSTVTSDDEDGRSSRRRAKTNDLNSIGDSEVRA 1029

Query: 1018 LYKAILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEK 1077
            LY+A+L+FG++ + LDELIADGTLPVKS EKY E  +E+++ AK    EE+  R + L +
Sbjct: 1030 LYRAVLRFGDVTDKLDELIADGTLPVKSIEKYKEILEELLDEAKSIYEEEDTKRTQTLRE 1089

Query: 1078 LEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLFNFKGVKSLNAESLLSRV 1137
             E  A  Y+ KLK+GEIKAE Q KDNP+TRL++K+REKKA+LF F  VKSLNAES+++R 
Sbjct: 1090 FEAAAHEYKMKLKTGEIKAEEQEKDNPITRLTMKRREKKAILFTFHKVKSLNAESIVNRC 1149

Query: 1138 EDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQ 1197
             DL+++ N   +++K+DPL+F      PKPV NW+ +W + +DEKL++G+ KYGYG+W Q
Sbjct: 1150 RDLEFVNNYFKTHFKNDPLEFKFDKAHPKPVTNWNCDWNQMDDEKLMVGIHKYGYGAWAQ 1209

Query: 1198 IRDDPFLGITDKIFLNEVHNPVAXXXXXXXXXXX-XXXXXXXXXXXXXXXVPGAIHLGRR 1256
            IRDDPFLG+T+KIFL++V +                              VPGA+HLGRR
Sbjct: 1210 IRDDPFLGLTNKIFLSDVSSAATDKVKEEVKQETPDATGGKRSKGRESKKVPGALHLGRR 1269

Query: 1257 VDYLLSFLRGGLNTKSPSADI--------GSKKLPTGPSKKRQRKPANHSK------SMT 1302
            VDYL+ FL+   N   P+            S+K    P +KR RKP N S       S T
Sbjct: 1270 VDYLIDFLQ---NDGKPTTGASGSSSISESSRKTAANP-RKRNRKPNNTSSFSETSASGT 1325

Query: 1303 PEITSSEPANGPPSKRMKALPKGPAALINNTRLSPNSPTPPLKSKVSRDNGTRQSSNPSS 1362
            PE+   + + G P+KR+KALPKGPA+L++  + + NSP         RD G +++ N +S
Sbjct: 1326 PELGKLD-SPGQPTKRIKALPKGPASLVSRNKKT-NSP--------QRD-GNKENENGTS 1374

Query: 1363 GSAHEKEYDSMDEEDCRHTMSAIRTSLKRLRRGGKSLDRKEWAKILKTELTTIGNHIESQ 1422
            G AH KEYDSMDEE+CRHTM+++R+SLKRLRRGGK LDR+EWAKILK+ELT IG++IE+Q
Sbjct: 1375 G-AHAKEYDSMDEEECRHTMTSMRSSLKRLRRGGKGLDRREWAKILKSELTAIGDYIEAQ 1433

Query: 1423 KGSSRKASPEKYRKHLWSYS 1442
              + +  +P+++RKHLWSYS
Sbjct: 1434 --AKKNKNPDRHRKHLWSYS 1451

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/26 (80%), Positives = 23/26 (88%)

Query: 4  KDISTEVLQNPELYGLRRSHRAAAHQ 29
          K+I  EVLQNPELYGLRRSHRA AH+
Sbjct: 2  KEIDEEVLQNPELYGLRRSHRAVAHR 27

>Kwal_56.23442
          Length = 1435

 Score = 1726 bits (4470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 873/1329 (65%), Positives = 1003/1329 (75%), Gaps = 36/1329 (2%)

Query: 121  VKIPTRFSNRQNKTVNYNIXXXXXXXXXXXXXXGSEEALSEENVHEASANPQPEDFHGID 180
            +++PTRFS+R N++VNYN+               +E+A ++   ++ +  P  +D  GID
Sbjct: 110  IELPTRFSSRNNRSVNYNVDYSDEDLLESE----TEQADADMEEYDYTPTPSSQDGQGID 165

Query: 181  IVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQVRGLK 240
            +VI HRLK   EE K     +PD+  CK NYEFLIKW DESHLHN+WETY  IGQVRG+K
Sbjct: 166  LVITHRLKPDTEESK----DIPDVATCKTNYEFLIKWVDESHLHNSWETYADIGQVRGIK 221

Query: 241  RLDNYCKQFIIEDQQVRLDPYVTAXXXXXXXXXXXXXXXXXXXXHVPERIIDSQRASLED 300
            ++DNY KQFII D+Q+R DPY TA                     +PERIIDS R +LED
Sbjct: 222  KIDNYIKQFIILDKQIRSDPYTTAEDIEVMDLEKERRLDEFEEYKIPERIIDSDRVTLED 281

Query: 301  GTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQRPR 360
            G+SQLQY VKWRRLNYDEATWE+A  IVKLAPEQVKHFQNR NSKILPQYSS+Y S+RPR
Sbjct: 282  GSSQLQYQVKWRRLNYDEATWESAGTIVKLAPEQVKHFQNRINSKILPQYSSHYGSERPR 341

Query: 361  FEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIF 420
            FEKL  QP FIKGGELRDFQLTGINWMAFLWSK DNGILADEMGLGKTVQTVAFISWLI+
Sbjct: 342  FEKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIY 401

Query: 421  ARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGK 480
            ARRQNGPH++VVPLSTMPAW +TFEKWAPDLNCI ++GNQKSRD IRE EF+TNP+AK K
Sbjct: 402  ARRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTK 461

Query: 481  KTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLI 540
            K  KFNVLLTTYEYILKDRAELG+IKWQF+AVDEAHRLKNAESSLYESLNSFKVANR+LI
Sbjct: 462  KHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLI 521

Query: 541  TGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKK 600
            TGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQD EQE YI DLH R+QPFILRRLKK
Sbjct: 522  TGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDAEQETYIRDLHSRLQPFILRRLKK 581

Query: 601  DVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASN 660
            DVEKSLPSKTERILRVELSDVQT+YYKNILTKNYSAL+AG+KG HFSLLNIMNELKKASN
Sbjct: 582  DVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKGAHFSLLNIMNELKKASN 641

Query: 661  HPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQM 720
            HPYLFD AE+RVL KFGDG+M+REN+LRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQM
Sbjct: 642  HPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQM 701

Query: 721  VRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINL 780
            VRMLDILGDYL+IKGI +QRLDGTVPSAQRRISIDHFN+PDSNDFVFLLSTRAGGLGINL
Sbjct: 702  VRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINL 761

Query: 781  MTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILE 840
            MTADTV+IFDSDWNPQADLQAMARAHRIGQKNHVMVYR VSKDTVEEEVLERARKKMILE
Sbjct: 762  MTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILE 821

Query: 841  YAIISLGVTDGNKYT--KKNEPNAGELSAILKFGAGNMFTATDNQKKLEDLNLDDVLNHA 898
            YAIISLGVTDG+  T  KK++P+AGELS ILKFGAGNMF ATDNQ+KLEDLNLDDVLNHA
Sbjct: 822  YAIISLGVTDGSNITQSKKSDPSAGELSEILKFGAGNMFKATDNQRKLEDLNLDDVLNHA 881

Query: 899  EDHVTTPDLGESHLGGEEFLKQFEVTDYKAXXXXXXXXXXXXXXXXXXXXXXXXXXXYVK 958
            EDHVTTPDLGESHLGGEEFL+QFEVTDYKA                           YV+
Sbjct: 882  EDHVTTPDLGESHLGGEEFLRQFEVTDYKADVEWDDIIPEEELKKLKDEEQKRMDEEYVQ 941

Query: 959  EQLEMMNRRDNALKKIKNSVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGESEVRAL 1018
            EQL++MNRR+NAL +IK SVN                               GE EVRA+
Sbjct: 942  EQLQLMNRRNNALNRIKASVN--GSGINNGDDNEDENTGSKRKSRMSNLDSFGEREVRAI 999

Query: 1019 YKAILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEKL 1078
            YK IL++GNL +  +ELIADG+LPVK+ + Y   Y EM+  AK C+  EE+ R      L
Sbjct: 1000 YKCILRYGNLDDKFEELIADGSLPVKTIDGYSGIYHEMIAEAKSCIKIEEEKRSAAFASL 1059

Query: 1079 EKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLFNFKGVKSLNAESLLSRVE 1138
            EK A AYR KLK+   + + + K NP+ +L+ KK+EKKAVLF F  VKSLNAE++L+R +
Sbjct: 1060 EKSAQAYREKLKAHGQQLDEKDKSNPIAKLAAKKKEKKAVLFEFYDVKSLNAETILTRPD 1119

Query: 1139 DLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQI 1198
            ++ +L   +  NY DDPLKF   N  PKPV NW+ +W+KE+DEKLL+GV KYGYG+W QI
Sbjct: 1120 EMGFLTTFLRKNYPDDPLKFKFVNKIPKPVTNWNCSWSKEDDEKLLVGVNKYGYGAWAQI 1179

Query: 1199 RDDPFLGITDKIFLNEVHNPVAXXXXXXXXXXXXXXXXXXXXXXXXXXVPGAIHLGRRVD 1258
            RDDPFLG++DKIFLNE                                VPG++HLGRR D
Sbjct: 1180 RDDPFLGLSDKIFLNEPQT----NNGKADNISAADQKTKNSGAGGSKKVPGSVHLGRRTD 1235

Query: 1259 YLLSFLRGGLNTKSPSADIGSKKLP-----TGPSKKRQRKPANHSKSMTPEITSSEPANG 1313
            YL + L+  +   + S        P     TG SKKR RK A  S+S TP+  + E  +G
Sbjct: 1236 YLFAVLKDEIKPHTSSGTNSGNSSPLPGASTG-SKKRVRK-APTSRSATPDAKADEIRSG 1293

Query: 1314 PPSKRMKALPKGPAALINNTRLSPNSPTPPLKSKVSRDNGTRQSSNPSSGSAHEKEYDSM 1373
             P+KR+K +  G        R SP    PPL +   +    +  + P   SA +KEYDSM
Sbjct: 1294 -PAKRVKKMGMG--------RSSP----PPLVATARKAKSVKGGTAPRGNSAPDKEYDSM 1340

Query: 1374 DEEDCRHTMSAIRTSLKRLRRGGKSLDRKEWAKILKTELTTIGNHIESQKGSSRKASPEK 1433
            +EE+C+  M  ++ SLKRL RGGK LDRKEWA ILK EL T+G+HIE++K SS+K  PEK
Sbjct: 1341 EEEECKAAMQPMKNSLKRLSRGGKGLDRKEWATILKEELRTVGDHIETKKVSSKKYPPEK 1400

Query: 1434 YRKHLWSYS 1442
            +RKHLW++S
Sbjct: 1401 FRKHLWAFS 1409

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/35 (62%), Positives = 27/35 (77%), Gaps = 1/35 (2%)

Query: 1  MAAKDISTEVLQNPELYGLRRSHRAAAH-QQNYFN 34
          MA KD++ ++L NPELYGLRRS RAAA  Q  YF+
Sbjct: 1  MATKDVAMDMLDNPELYGLRRSGRAAASVQTRYFS 35

>AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH] (980963..985231)
            [4269 bp, 1422 aa]
          Length = 1422

 Score = 1717 bits (4446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 896/1445 (62%), Positives = 1029/1445 (71%), Gaps = 57/1445 (3%)

Query: 3    AKDISTEVLQNPELYGLRRSHR---AAAHQQNYFNXXXXXXXXXNIKQSRRKRMTTIXXX 59
            AKD+  EVL NPELYGLRRSHR     + Q  Y+           +    RKR   I   
Sbjct: 2    AKDLPDEVLANPELYGLRRSHRTPVGGSTQATYYESNDDEDSVV-VSGRGRKRKKAIDID 60

Query: 60   XXXXXXXXXXXXXXXXXXXXXXXXXXXYYGSPIKQNXXXXXXXXXXXXXXXXXXXXXXXX 119
                                        +G+P+++                         
Sbjct: 61   SYSEEEPADNESTNEDISGDEDED----FGAPVRRRRKKGRRELSAEDD----------- 105

Query: 120  XVKIPTRFSNRQNKTVNYNIXXXXXXXXXXXXXXGSEEALSEENVHEASANPQPEDFHGI 179
             + +PTRFS+R NK VNYNI                 +   E      +  PQ  D HGI
Sbjct: 106  -IMLPTRFSSRNNKAVNYNIDYSDDDLLESAEEEYEGDEGDEGEEEAYAQTPQIPDEHGI 164

Query: 180  DIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQVRGL 239
            D V+ HRL     E   +E  VP+   CKE YEFLIKW +ESH+HNTWET ES+G VRG+
Sbjct: 165  DFVVTHRLHEGHTEP--VEWDVPE---CKECYEFLIKWNNESHIHNTWETAESLGNVRGV 219

Query: 240  KRLDNYCKQFIIEDQQVRLDPYVTAXXXXXXXXXXXXXXXXXXXXHVPERIIDSQRASLE 299
            K++DNY KQ+I+ D ++R D Y T                        ERIIDS R +L+
Sbjct: 220  KKVDNYIKQYILLDHELRTDKYTTREDIEVMDLEHERRCDEFEEFKKVERIIDSDRVTLD 279

Query: 300  DGTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQRP 359
            DG+SQLQYLVKW+RLNYDEATWENA+ IVK+APE+VK FQ+R +SKILPQ+SSNY SQRP
Sbjct: 280  DGSSQLQYLVKWKRLNYDEATWENASVIVKMAPEEVKRFQSRSSSKILPQHSSNYGSQRP 339

Query: 360  RFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLI 419
             FEKLSVQP FIKGGELRDFQLTGINWMAFLWSK DNGILADEMGLGKTVQTV+FISWLI
Sbjct: 340  GFEKLSVQPSFIKGGELRDFQLTGINWMAFLWSKSDNGILADEMGLGKTVQTVSFISWLI 399

Query: 420  FARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKG 479
            FARRQNGPH++VVPLSTMPAW +TFEKWAP+LNC+ YMGNQKSRD IREYEFYTNP  KG
Sbjct: 400  FARRQNGPHLVVVPLSTMPAWQETFEKWAPELNCVYYMGNQKSRDVIREYEFYTNPHTKG 459

Query: 480  KKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRML 539
            KK +KFNVLLTTYEYILKDR ELG+IKWQF+AVDEAHRLKNAESSLYESL+SFKVANRML
Sbjct: 460  KKNIKFNVLLTTYEYILKDRLELGAIKWQFLAVDEAHRLKNAESSLYESLSSFKVANRML 519

Query: 540  ITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLK 599
            ITGTPLQNNIKELAALVNFLMPG+FTIDQEIDFENQDE+QE YI DLH+R+QP+ILRRLK
Sbjct: 520  ITGTPLQNNIKELAALVNFLMPGKFTIDQEIDFENQDEKQENYIRDLHKRLQPYILRRLK 579

Query: 600  KDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKAS 659
            KDVEKSLPSKTERILRVELSDVQTEYYKNILTKNY+ALTAG KG HFSLLNIMNELKKAS
Sbjct: 580  KDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYNALTAGTKGTHFSLLNIMNELKKAS 639

Query: 660  NHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQ 719
            NHPYLF NAE RVL KFGDG  +REN+LRGLIMSSGKMVLLD+LLTRLKKDGHRVLIFSQ
Sbjct: 640  NHPYLFGNAENRVLAKFGDGNRSRENILRGLIMSSGKMVLLDKLLTRLKKDGHRVLIFSQ 699

Query: 720  MVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGIN 779
            MVRMLDILGDYLSIKGINFQRLDGTVPS+QRRISIDHFN+PDSNDFVFLLSTRAGGLGIN
Sbjct: 700  MVRMLDILGDYLSIKGINFQRLDGTVPSSQRRISIDHFNAPDSNDFVFLLSTRAGGLGIN 759

Query: 780  LMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMIL 839
            LMTADTV+IFDSDWNPQADLQAMARAHRIGQKNHVMVYR VSKDTVEEEVLERARKKMIL
Sbjct: 760  LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMIL 819

Query: 840  EYAIISLGVTDGNKYTKKN--EPNAGELSAILKFGAGNMFTATDNQKKLEDLNLDDVLNH 897
            EYAIISLGVTDGNKYT K+  EP+AGELS ILKFGAGNMF A DNQKKLEDLNLDDVLNH
Sbjct: 820  EYAIISLGVTDGNKYTSKSKAEPSAGELSEILKFGAGNMFKAHDNQKKLEDLNLDDVLNH 879

Query: 898  AEDHVTTPDLGESHLGGEEFLKQFEVTDYKAXXXXXXXXXXXXXXXXXXXXXXXXXXXYV 957
            AEDHVTTPDLGESHLGGEEFLKQFEVTDYKA                           YV
Sbjct: 880  AEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVEWDDIIPEDELRKLKDEEQKRKDEEYV 939

Query: 958  KEQLEMMNRRDNALKKIKNSVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGESEVRA 1017
            +EQL+MMNRR+ AL KIKNSVN                              IGE E+RA
Sbjct: 940  QEQLQMMNRRNVALNKIKNSVNGDGAQSLSDKEDSRSKKRAKSNNLNS----IGEREIRA 995

Query: 1018 LYKAILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEK 1077
            LYKAILK+G+L E L +LIADGTLPVKS EKYGE YDE+M  A+  +++EE  R E + +
Sbjct: 996  LYKAILKYGDLTERLGDLIADGTLPVKSLEKYGELYDELMSIARKQINDEESKRNEAISR 1055

Query: 1078 LEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLFNFKGVKSLNAESLLSRV 1137
            LE+    Y+ K+KSGEIK ++  KD P+ RL+ K+REK+AVLF F  +K LNAE++++R 
Sbjct: 1056 LERDVEEYKTKVKSGEIKPDDNAKDLPIARLAAKRREKRAVLFEFYEIKGLNAETIVNRT 1115

Query: 1138 EDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQ 1197
            +DL++L N + +NY  DP+KF   N  PKP+ NW+  WT+E+DEKLL+GV KYGYGSW+Q
Sbjct: 1116 DDLRFLHNFLKNNYPSDPMKFRFLNRLPKPITNWNCTWTQEDDEKLLVGVDKYGYGSWSQ 1175

Query: 1198 IRDDPFLGITDKIFLNEVHNPVAXXXXXXXXXXXXXXXXXXXXXXXXXXVPGAIHLGRRV 1257
            +RDDPFLG++DKIFLNE                                VPG++HLGRRV
Sbjct: 1176 VRDDPFLGLSDKIFLNEP----GTQTNDSAAADADAADKKTRLANAAKKVPGSVHLGRRV 1231

Query: 1258 DYLLSFLRGGLNTKSPSADIGSKKLPTGPSKKRQRKPANHSKSMTPEITSSEPANGPPSK 1317
            DYLL+ LR     ++   D  +       +KKR RK +  SKS TP+   + P + P  K
Sbjct: 1232 DYLLTVLR----EEAKGTDSAAAPQAALAAKKRARKSSGSSKSATPD---ARPEDSPSIK 1284

Query: 1318 RMKALPKGPAALINNTRLSPNSPTPPLKSKVSRDNGTRQSSNPSSGSAHEKEYDSMDEED 1377
            R +ALP         +R S  SP P LK      NG +Q+S     +  E+EY+SMDE++
Sbjct: 1285 RTRALPAA-------SRPSSGSPGPQLKR-----NGKKQAS---PKAPMEREYESMDEDE 1329

Query: 1378 CRHTMSAIRTSLKRLRRGGKSLDRKEWAKILKTELTTIGNHIESQKGSSRKASPEKYRKH 1437
            CR TM ++R SLKRL+RGG  LDR EWA ILK EL  +GN+IE  KG S      ++++H
Sbjct: 1330 CRRTMHSVRASLKRLKRGGAGLDRNEWAAILKRELLAVGNYIERHKGDSADRDRAQFKRH 1389

Query: 1438 LWSYS 1442
            LWSYS
Sbjct: 1390 LWSYS 1394

>KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces
            cerevisiae YER164w CHD1 transcriptional regulator, start
            by similarity
          Length = 1525

 Score = 1648 bits (4267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 855/1393 (61%), Positives = 998/1393 (71%), Gaps = 84/1393 (6%)

Query: 121  VKIPTRFSNRQN-KTVNYNIXXXXXXXXXXXXXXGSEEA--LSEENV-----HEASANPQ 172
            V +PTRFS+R N K +NY +                +E   L  E++     + AS +PQ
Sbjct: 121  VVLPTRFSSRNNNKVINYTLNDDSNDEDLMESSEEQDEGHNLDSEDMDLQDGYSASPSPQ 180

Query: 173  PEDFHGIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYES 232
             E  H IDIV++HRLK  ++     +    D+++ + N+EFLIKW D+SHLHN+WE+YE 
Sbjct: 181  QET-HSIDIVVDHRLKEGVDNSGSTKNRRWDVDSIRANFEFLIKWADQSHLHNSWESYED 239

Query: 233  IGQ--VRGLKRLDNYCKQFIIEDQQVRLDPYVTAXXXXXXXXXXXXXXXXXXXXHVPERI 290
            + +   +GLKR++NY KQFII DQ+VR DPY T                      VPERI
Sbjct: 240  LKENGTKGLKRIENYYKQFIILDQEVRADPYTTREDIEVMDLEHERRIDEFEEFKVPERI 299

Query: 291  IDSQRASLEDGT--SQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENSKILP 348
            IDS+R   EDG+  SQL+YLVKWRRLNYDE TWE A++IVK+APEQVK FQNR NSKI+P
Sbjct: 300  IDSERFENEDGSGSSQLKYLVKWRRLNYDECTWEVASEIVKMAPEQVKEFQNRTNSKIMP 359

Query: 349  QYSSNY-TSQRPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGK 407
            Q SSNY  +QRP+FEKL  QP FIKGGELRDFQLTGINWMAFLWSK DNGILADEMGLGK
Sbjct: 360  QNSSNYPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGK 419

Query: 408  TVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIR 467
            TVQTV+FISWLI+ARRQNGPH++VVPLSTMPAW +TF+KWAP LNC+ YMGNQ SRD I+
Sbjct: 420  TVQTVSFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQ 479

Query: 468  EYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYE 527
            +YEFYTNP+AKGKK +KFNVLLTTYEYILKDR+ LGSIKWQF+AVDEAHRLKNAESSLYE
Sbjct: 480  DYEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYE 539

Query: 528  SLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDLH 587
            SLNSFKVANR+LITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDE+QEEYI DLH
Sbjct: 540  SLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEQQEEYIRDLH 599

Query: 588  RRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFS 647
            +R+QPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALT+G KGGH S
Sbjct: 600  KRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKGGHVS 659

Query: 648  LLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRL 707
            LLN+MNELKKASNHPYLFDNAEERVL KFGDG  +REN+LRGLIMSSGKMVLLD+LLTRL
Sbjct: 660  LLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGKMVLLDKLLTRL 719

Query: 708  KKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVF 767
            KKDGHRVLIFSQMVR+LDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFN+ DSNDFVF
Sbjct: 720  KKDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVF 779

Query: 768  LLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEE 827
            LLSTRAGGLGINLMTADTV+IFDSDWNPQADLQAMARAHRIGQKNHVMVYR VSKDTVEE
Sbjct: 780  LLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEE 839

Query: 828  EVLERARKKMILEYAIISLGVTDGNKY--TKKNEPNAGELSAILKFGAGNMFTATDNQKK 885
            EVLERARKKMILEYAIISLGVTDGNK   TKKNEP+AGELS ILKFGAGNMF   DNQ+K
Sbjct: 840  EVLERARKKMILEYAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPNDNQQK 899

Query: 886  LEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKAXXXXXXXXXXXXXXXXX 945
            LEDLNLD+VLNHAEDH+TTP+LGES+LGGEEFL+QFEVTDYKA                 
Sbjct: 900  LEDLNLDEVLNHAEDHITTPELGESNLGGEEFLRQFEVTDYKADVDWDDIIPEDELKKLK 959

Query: 946  XXXXXXXXXXYVKEQLEMMNRRDNALKKIKNSVNXXXXXXXXXXXXXXXXXXXXXXXXXX 1005
                      YV+EQL++MNR+  A+ KIK SVN                          
Sbjct: 960  DEEQRRIDEEYVREQLDIMNRKTAAIDKIKRSVN---GETFGSDSEDEGNSKSRKRSKAN 1016

Query: 1006 XXXXIGESEVRALYKAILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVH 1065
                 GE E+RALYK IL+FG+++   +ELIADG+LPVKS ++Y E Y EM+  A+  + 
Sbjct: 1017 NLDAFGEREIRALYKCILRFGDIENKFEELIADGSLPVKSIDRYKELYHEMITEAETLMR 1076

Query: 1066 EEEKNRKEILEKLEKHATAYRAKLKSGEIKAENQP-KDNPLTRLSLKKREKKAVLFNFKG 1124
            +EE  R EI  KLEK A  YR K+K+ EIK E+   K+ P+T LS K+REK+A+LF F  
Sbjct: 1077 DEEAKRHEIFSKLEKDAAEYRQKIKNLEIKPEDDAGKETPITLLSAKRREKRAILFEFHD 1136

Query: 1125 VKSLNAESLLSRVEDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLL 1184
             K+LNA++L++R ++LK+L N +  NYKDDPL+F   N  PKPV  W+  W KE+DEKLL
Sbjct: 1137 TKALNADTLVNRRDNLKFLSNFVERNYKDDPLQFKFVNKNPKPVSAWNCVWGKEDDEKLL 1196

Query: 1185 IGVFKYGYGSWTQIRDDPFLGITDKIFL-NEVHNPVAXXXXXXXXXXXXXXXXXXXXXXX 1243
            IG++KYGYG+W QIRDDPFLG+T+K+FL NEV    A                       
Sbjct: 1197 IGIYKYGYGAWMQIRDDPFLGLTEKLFLNNEVTQKAATPAAPSLTPSAPGASVAGSSTPG 1256

Query: 1244 XXXV-----------------------------PGAIHLGRRVDYLLSFLRG---GLNTK 1271
               V                             PGA+HLGRRVDYL + LR    G  T 
Sbjct: 1257 ADAVKTETPDTTANTPIVTASSENTNKKTVKKAPGAVHLGRRVDYLFTVLRDEAKGPQT- 1315

Query: 1272 SPSADIGSKKLPTGPSKKRQRKPA-------------NHSKSMTPEITS--------SEP 1310
             PS   GS    T   ++ +RKP              N   + TP   +        S P
Sbjct: 1316 DPSHPAGSSSTGTTTPQQNKRKPKKSATTAGNSNGNENAHTAGTPSDGNSVNLTGKDSTP 1375

Query: 1311 ANGPPSKRMKALPKGPAALINNTRLSPNSPTPPLKSKVSRDNGTRQSSNPSSG-SAHEKE 1369
             N   +KR KA         ++ + S  S TP + SK  +  G      P +     +KE
Sbjct: 1376 DNSSETKRGKAH--------HHQQPSSRSGTPVVGSKKQQRKGKDIPLAPKADIRLPDKE 1427

Query: 1370 YDSMDEEDCRHTMSAIRTSLKRLRRGGKSLDRKEWAKILKTELTTIGNHIESQKGSSRKA 1429
            YDSMDEE+C+ TM+ +R+SLKRLR GG  L+RK+WA +LK EL  +G++IES K  S K 
Sbjct: 1428 YDSMDEEECKKTMTNVRSSLKRLRSGGDGLERKQWANLLKKELKRVGDYIESHKKDSSKT 1487

Query: 1430 SPEKYRKHLWSYS 1442
            SPEKY++HLWS++
Sbjct: 1488 SPEKYKRHLWSFT 1500

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 21/30 (70%)

Query: 3  AKDISTEVLQNPELYGLRRSHRAAAHQQNY 32
           +D+  EVL NPELYGLRRSHRAA     Y
Sbjct: 2  VQDLPDEVLANPELYGLRRSHRAAITHNTY 31

>Scas_665.17
          Length = 1060

 Score =  473 bits (1216), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 244/542 (45%), Positives = 356/542 (65%), Gaps = 29/542 (5%)

Query: 364 LSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARR 423
           +S  P FIKGG+LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT++F+ +L + ++
Sbjct: 125 VSESPAFIKGGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKK 184

Query: 424 QNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTM 483
            +GP +IVVP ST+  W   F KW P++N I   G+++ R  I  Y+             
Sbjct: 185 IDGPFLIVVPKSTLDNWRREFNKWTPEVNAIVLHGDKEERHKIL-YDIVLEA-------- 235

Query: 484 KFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGT 543
           KF+VL+T+YE ++K++  L    WQ++ +DEAHR+KN +S L + +  F   NR+LITGT
Sbjct: 236 KFDVLITSYEMVIKEKNVLKKFAWQYIVIDEAHRIKNEQSQLSQIIRLFYSKNRLLITGT 295

Query: 544 PLQNNIKELAALVNFLMPGRF----TIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLK 599
           PLQNN+ EL AL+NFL+P  F      D+  +  N +++QE  +  LH  + PF+LRR+K
Sbjct: 296 PLQNNLHELWALLNFLLPDVFGDSGIFDEWFEQNNSEQDQEIVVQQLHTVLNPFLLRRIK 355

Query: 600 KDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSAL--TAGAKGGHFSLLNIMNELKK 657
            DVEKSL  K E  + V ++++Q ++YK++L K+  A+    G + G   LLNI+ +L+K
Sbjct: 356 ADVEKSLLPKIETNVYVGMTEMQVKWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRK 415

Query: 658 ASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIF 717
             NHPYLF+ AE       G    T E+    L+ ++GKM++LD+LL RLK+ G RVLIF
Sbjct: 416 CCNHPYLFEGAEP------GPPYTTDEH----LVFNAGKMIVLDKLLKRLKEKGSRVLIF 465

Query: 718 SQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLG 777
           SQM R+LDIL DY   +G  + R+DG+     R  +ID +N P+S+ FVFLL+TRAGGLG
Sbjct: 466 SQMSRLLDILEDYCFFRGYEYCRIDGSTAHEDRIEAIDEYNKPNSDKFVFLLTTRAGGLG 525

Query: 778 INLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM 837
           INL+TADTV+++DSDWNPQADLQAM RAHRIGQK  V VYR V+++ +EE+V+ERA +K+
Sbjct: 526 INLVTADTVILYDSDWNPQADLQAMDRAHRIGQKKQVTVYRFVTENAIEEKVIERAAQKL 585

Query: 838 ILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDNQKKLEDLNLDDVLNH 897
            L+  +I  G     K T     N  +L  ++++GA NMF   + Q+  +D ++D++L  
Sbjct: 586 RLDQLVIQQGT---GKKTASLGSNKDDLLEMIQYGAKNMFENKE-QQITKDADIDEILKK 641

Query: 898 AE 899
            +
Sbjct: 642 GQ 643

>YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required for
           Ume6p-dependent transcriptional repression of several
           meiotic genes, has chromatin remodeling activity, has
           strong similarity to Drosophila nucleosome remodeling
           factor ISWI (Imitator SWI) [3363 bp, 1120 aa]
          Length = 1120

 Score =  469 bits (1206), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 246/563 (43%), Positives = 360/563 (63%), Gaps = 31/563 (5%)

Query: 364 LSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARR 423
           +S  P F+K G+LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT++F+ +L + ++
Sbjct: 172 VSESPSFVKSGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKQ 231

Query: 424 QNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSR-DTIREYEFYTNPRAKGKKT 482
             GP +I+VP ST+  W   F KW P++N +   G++ +R D +R               
Sbjct: 232 IEGPFLIIVPKSTLDNWRREFLKWTPNVNVLVLHGDKDTRADIVRNIIL----------E 281

Query: 483 MKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITG 542
            +F+VL+T+YE +++++  L  + WQ++ +DEAHR+KN +S+L + +  F   NR+LITG
Sbjct: 282 ARFDVLITSYEMVIREKNALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITG 341

Query: 543 TPLQNNIKELAALVNFLMPGRF----TIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRL 598
           TPLQNN+ EL AL+NFL+P  F      D+  +  N +++QE  I  LH  + PF+LRR+
Sbjct: 342 TPLQNNLHELWALLNFLLPDIFGDSELFDEWFEQNNSEQDQEIVIQQLHSVLNPFLLRRV 401

Query: 599 KKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSAL--TAGAKGGHFSLLNIMNELK 656
           K DVEKSL  K E  + V ++D+Q ++YK++L K+  A+    G + G   LLNI+ +L+
Sbjct: 402 KADVEKSLLPKIETNVYVGMTDMQIQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLR 461

Query: 657 KASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLI 716
           K  NHPYLF+ AE       G    T E+    LI +SGKM++LD+LL RLK+ G RVLI
Sbjct: 462 KCCNHPYLFEGAEP------GPPYTTDEH----LIFNSGKMIILDKLLKRLKEKGSRVLI 511

Query: 717 FSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGL 776
           FSQM R+LDIL DY   +   + R+DG+    +R  +ID +N P+S  FVFLL+TRAGGL
Sbjct: 512 FSQMSRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGL 571

Query: 777 GINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKK 836
           GINL+TADTV++FDSDWNPQADLQAM RAHRIGQK  V VYR V+++ +EE+V+ERA +K
Sbjct: 572 GINLVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQK 631

Query: 837 MILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDNQKKLEDLNLDDVLN 896
           + L+  +I  G     K T     +  +L  +++FGA NMF    ++  + D ++DD+L 
Sbjct: 632 LRLDQLVIQQGT---GKKTASLGNSKDDLLDMIQFGAKNMFEKKASKVTV-DADIDDILK 687

Query: 897 HAEDHVTTPDLGESHLGGEEFLK 919
             E      +     LG ++  K
Sbjct: 688 KGEQKTQELNAKYQSLGLDDLQK 710

>CAGL0I09614g 917707..920826 highly similar to tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2 or sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1, hypothetical
           start
          Length = 1039

 Score =  459 bits (1180), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 238/538 (44%), Positives = 348/538 (64%), Gaps = 29/538 (5%)

Query: 368 PPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGP 427
           P +I+ G+LRD+Q+ G+NWM  L     +GILADEMGLGKT+QT++F+ +L + ++  GP
Sbjct: 125 PSYIQSGKLRDYQIQGLNWMISLHENKISGILADEMGLGKTLQTISFLGYLRYVKKIEGP 184

Query: 428 HIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNV 487
            +++VP ST+  W   F KW P+++     G ++ R  I +     N   + +    F+V
Sbjct: 185 FLVIVPKSTLDNWRREFFKWTPNVSTTVLQGTKEQRQDILQ-----NIVLEAR----FDV 235

Query: 488 LLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQN 547
           L+T+YE +++++  L  + W+++ +DEAHR+KN +S+L + +  F   NR+LITGTPLQN
Sbjct: 236 LITSYEMVIREKGYLKRLAWEYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQN 295

Query: 548 NIKELAALVNFLMPGRF----TIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKKDVE 603
           N+ EL AL+NFL+P  F      D      N D++QE  +  LH  + PF+LRR+K DVE
Sbjct: 296 NLHELWALLNFLLPDVFGDSEVFDDWFQQNNSDQDQEVVVQQLHAVLNPFLLRRIKADVE 355

Query: 604 KSLPSKTERILRVELSDVQTEYYKNILTKNYSAL--TAGAKGGHFSLLNIMNELKKASNH 661
           KSL  K E  + V ++D+Q ++YK++L K+  A+    G + G   LLNI+ +L+K  NH
Sbjct: 356 KSLLPKIETNVYVGMTDMQVQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNH 415

Query: 662 PYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMV 721
           PYLF+ AE       G    T E+    LI ++GKM++LD+LL RLK+ G RVLIFSQM 
Sbjct: 416 PYLFEGAEP------GPPYTTDEH----LIFNAGKMIVLDKLLKRLKEKGSRVLIFSQMS 465

Query: 722 RMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLM 781
           R+LDIL DY   +  N+ R+DG+    +R  +ID +N P+S  FVFLL+TRAGGLGINL+
Sbjct: 466 RLLDILEDYCYFRNYNYCRIDGSTSHEERIDAIDEYNKPNSEKFVFLLTTRAGGLGINLV 525

Query: 782 TADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEY 841
           TADTVV+FDSDWNPQADLQAM RAHRIGQK  V VYR V+++ +EE+VLERA +K+ L+ 
Sbjct: 526 TADTVVLFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVLERAAQKLRLDQ 585

Query: 842 AIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDNQKKLEDLNLDDVLNHAE 899
            +I  G     K T     +  +L  ++++GA N+F        + D ++D++L   E
Sbjct: 586 LVIQQG---SGKKTANLGNSKDDLIEMIQYGAKNVFEKNGTTISV-DADIDEILKKGE 639

>Kwal_34.15925
          Length = 1025

 Score =  452 bits (1164), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 246/548 (44%), Positives = 353/548 (64%), Gaps = 41/548 (7%)

Query: 364 LSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARR 423
           L+  P +IK G LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT+AF+ +L + + 
Sbjct: 117 LTESPSYIKSGVLRDYQVQGLNWLLSLHDNRLSGILADEMGLGKTLQTIAFLGYLRYLKD 176

Query: 424 QNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSR-----DTIREYEFYTNPRAK 478
            +GPHI++VP ST+  W   F KW P++  +   G+++ R     D + E          
Sbjct: 177 IDGPHIVIVPKSTLNNWKREFSKWTPEVEAVVLSGDKEERQHLLKDIVLE---------- 226

Query: 479 GKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRM 538
                KF+VL+T+YE ++K+++ L    WQ++ VDEAHR+KN +S+L + +  F   +R+
Sbjct: 227 ----CKFDVLITSYEMVIKEKSTLKRFMWQYIIVDEAHRIKNEQSTLSQIIRLFHSKSRL 282

Query: 539 LITGTPLQNNIKELAALVNFLMPGRFTIDQEID--FENQDEE--QEEYIHDLHRRIQPFI 594
           LITGTPLQNN+ EL AL+NFL+P  F      D  FE  D E  Q+  +  LH  + PF+
Sbjct: 283 LITGTPLQNNLHELWALLNFLLPDVFGDSDAFDRWFEQSDTEKDQDVVVQQLHTVLSPFL 342

Query: 595 LRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GAKGGHFSLLNIM 652
           LRRLK +VE SL  K E  L V ++D+Q ++YK++L K+  A+    G + G+  LLNI+
Sbjct: 343 LRRLKSEVETSLLPKIETNLYVGMTDMQVQWYKSLLEKDLDAVNGAIGKREGNTRLLNIV 402

Query: 653 NELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGH 712
            +L+K  NHPYLF+ AE       G    T E+    LI ++GKM++LD+LL + K+ G 
Sbjct: 403 MQLRKCCNHPYLFEGAEP------GPPYTTDEH----LIFNAGKMIVLDKLLKKKKEAGS 452

Query: 713 RVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTR 772
           RVLIFSQM R+LDIL DY   +  ++ R+DG+    +R  +ID FN P S  F+FLL+TR
Sbjct: 453 RVLIFSQMSRLLDILEDYCFFRDYDYCRIDGSTAHEERIEAIDQFNEPGSEKFIFLLTTR 512

Query: 773 AGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLER 832
           AGGLGINL+TADTVVI+DSDWNPQADLQAM RAHRIGQK  V VYR V+++ +EE+V+ER
Sbjct: 513 AGGLGINLVTADTVVIYDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIER 572

Query: 833 ARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDNQKKLE-DLNL 891
           A +K+ L+  +I  GV    K T     + GEL  ++++GA ++F   D  +K+  D ++
Sbjct: 573 AAQKLRLDQLVIQQGV---GKKTSAIGNSKGELLGMIQYGAKDVF--GDGARKITVDDDI 627

Query: 892 DDVLNHAE 899
           D++L   E
Sbjct: 628 DEILKKGE 635

>KLLA0F24838g complement(2309842..2313030) similar to sgd|S0005831
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1062

 Score =  451 bits (1160), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 239/542 (44%), Positives = 348/542 (64%), Gaps = 29/542 (5%)

Query: 364 LSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARR 423
           L+  P FIK G+LRD+Q+ G+NW+  L     +GILADEMGLGKT+Q+++F+ +L + + 
Sbjct: 124 LTQSPSFIKEGKLRDYQVYGLNWLISLHESKLSGILADEMGLGKTLQSISFLGYLRYIKG 183

Query: 424 QNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTM 483
             GP+I++VP ST+  W   F KW P++  +   G++  R  + E +  T          
Sbjct: 184 IEGPYIVIVPKSTLDNWQREFAKWTPEVKTVILQGDKDFRKELIETKILT---------C 234

Query: 484 KFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGT 543
            F+VL+T+YE +LK++  L    W+++ +DEAHR+KN +S+L + +  F   NR+LITGT
Sbjct: 235 NFDVLITSYEMVLKEKLTLKRFAWEYILIDEAHRIKNEQSALSQVIRLFYSKNRLLITGT 294

Query: 544 PLQNNIKELAALVNFLMPGRF----TIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLK 599
           PLQNN+ EL AL+NFL+P  F      D+      ++E+QE  +  LH  +QPF+LRR+K
Sbjct: 295 PLQNNLHELWALLNFLLPDVFGDSEVFDEWFQQNGKEEDQEVVVQQLHSVLQPFLLRRVK 354

Query: 600 KDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSAL--TAGAKGGHFSLLNIMNELKK 657
            +VEKSL  K E  L V ++D+Q E+YK++L K+  A+    G + G   LLNI+ +L+K
Sbjct: 355 SEVEKSLLPKKEINLYVGMTDMQIEWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRK 414

Query: 658 ASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIF 717
             NHPYLF+ AE       G    T E+    L+ +SGKM++LD+LL + K+ G RVLIF
Sbjct: 415 CCNHPYLFEGAEP------GPPYTTDEH----LVFNSGKMIVLDKLLKKKKEQGSRVLIF 464

Query: 718 SQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLG 777
           SQM R+LDIL DY   +G  + R+DG+    +R  +ID +N P+S  F+FLL+TRAGGLG
Sbjct: 465 SQMSRLLDILEDYCYFRGYEYCRIDGSTSHDERVEAIDEYNKPNSEKFIFLLTTRAGGLG 524

Query: 778 INLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM 837
           INL+TADTVV++DSDWNPQADLQAM RAHRIGQK  V VYR V+++ +EE+V+ERA +K+
Sbjct: 525 INLVTADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVFVYRFVTENAIEEKVIERAAQKL 584

Query: 838 ILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDNQKKLEDLNLDDVLNH 897
            L+  +I  G     K T     N  +L  +++FGA +M         + D ++D++L  
Sbjct: 585 RLDQLVIQQGT---GKKTSALTNNKDDLIDMIQFGARDMLQHGSGNITV-DEDIDEILKK 640

Query: 898 AE 899
            E
Sbjct: 641 GE 642

>Scas_652.17
          Length = 1025

 Score =  447 bits (1151), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 240/572 (41%), Positives = 361/572 (63%), Gaps = 40/572 (6%)

Query: 368 PPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGP 427
           P +I G  LR +Q+ G+NW+  L   G  GILADEMGLGKT+QT+AF+ +L +    NGP
Sbjct: 106 PKYIHGT-LRPYQIQGLNWLVSLHKNGLAGILADEMGLGKTLQTIAFLGYLKYMEGINGP 164

Query: 428 HIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNV 487
            +++ P ST+  WL    KW PD+      G+++ R ++ + +  T           F++
Sbjct: 165 FLVIAPKSTLNNWLREINKWTPDVKAFVLQGDKQERASLIKEKLMT---------CDFDI 215

Query: 488 LLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQN 547
           ++ +YE I++++A      W+++ +DEAHR+KN ES L + L  F   NR+LITGTPLQN
Sbjct: 216 VVASYEIIIREKAAFKKFNWEYIIIDEAHRIKNEESLLSQVLREFTSRNRLLITGTPLQN 275

Query: 548 NIKELAALVNFLMPGRFTIDQEID----FENQDEEQEEYIHDLHRRIQPFILRRLKKDVE 603
           N+ EL AL+NFL+P  F+  Q+ D     E  +E+Q++ +  LH  +QPF+LRR+K DVE
Sbjct: 276 NLHELWALLNFLLPDIFSSSQDFDDWFSSETTEEDQDKVVKQLHTVLQPFLLRRIKNDVE 335

Query: 604 KSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GAKGGHFSLLNIMNELKKASNH 661
            SL  K E  L V +S++Q ++YK IL K+  A+     +K     LLNI+ +L+K  NH
Sbjct: 336 TSLLPKKELNLYVGMSNMQKKWYKKILEKDLDAVNGENSSKESKTRLLNIVMQLRKCCNH 395

Query: 662 PYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMV 721
           PYLFD AE       G    T E+    L+ +S K+ +LD+LL ++K+DG RVLIFSQM 
Sbjct: 396 PYLFDGAEP------GPPYTTDEH----LVYNSKKLQVLDKLLKKMKEDGSRVLIFSQMS 445

Query: 722 RMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLM 781
           R+LDIL DY   +G  + R+DG+     R  SID +N+PDS+ F+FLL+TRAGGLGINL 
Sbjct: 446 RVLDILEDYCFFRGYKYCRIDGSTDHEDRIKSIDDYNAPDSDKFIFLLTTRAGGLGINLT 505

Query: 782 TADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEY 841
           +AD VV++DSDWNPQADLQAM RAHRIGQK  V V+R V+ ++VEE++LERA +K+ L+ 
Sbjct: 506 SADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRFVTDNSVEEKILERATQKLRLDQ 565

Query: 842 AIISLGVTDGNKYTKKNEPNAGE-LSAILKFGAGNMF-----TATDN--------QKKLE 887
            +I       NK  K+++ +A + L ++++ GA ++F     T T++         +++E
Sbjct: 566 LVIQQNKASMNKNKKESKKDAKDALLSMIQHGAADIFQSGNSTTTESTPQPGEAKSEEVE 625

Query: 888 DLNLDDVLNHAEDHVTTPDLGESHLGGEEFLK 919
           D++L+ +L  +E+  ++ +     LG ++  K
Sbjct: 626 DVDLESILATSENKTSSLNAKYETLGLDDLQK 657

>AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH]
           complement(1400495..1400512,1400676..1403735) [3078 bp,
           1025 aa]
          Length = 1025

 Score =  446 bits (1146), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 245/539 (45%), Positives = 350/539 (64%), Gaps = 31/539 (5%)

Query: 368 PPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGP 427
           P F+K G+LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT++F+ +L F +  +GP
Sbjct: 120 PSFVKAGKLRDYQIYGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRFIKDIDGP 179

Query: 428 HIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNV 487
            I+VVP ST+  W   F KW P++N I   G++++R  + E    T           F+V
Sbjct: 180 FIVVVPKSTLDNWKREFAKWTPEVNTIVLHGDRETRTQLIEERILT---------CDFDV 230

Query: 488 LLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQN 547
           L+T+YE ++K++A L    WQ++ +DEAHR+KN +S+L + +  F   +R+LITGTPLQN
Sbjct: 231 LITSYEMVIKEKAILKKFAWQYIVIDEAHRIKNEQSTLSQIIRLFYSKSRLLITGTPLQN 290

Query: 548 NIKELAALVNFLMPGRF----TIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKKDVE 603
           N+ EL AL+NFL+P  F      D+      + ++QE  +  LH  +QPF+LRR+K DVE
Sbjct: 291 NLHELWALLNFLLPDVFGESEVFDEWFQQNEKAQDQEIVVQQLHAVLQPFLLRRVKADVE 350

Query: 604 KSLPSKTERILRVELSDVQTEYYKNILTKNYSAL--TAGAKGGHFSLLNIMNELKKASNH 661
           KSL  K E  + V ++ +Q ++Y+++L K+  A+    G + G   LLNI+ +L+K  NH
Sbjct: 351 KSLLPKIETNVYVGMTAMQLQWYRSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNH 410

Query: 662 PYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMV 721
           PYLF+ AE       G    T E+    LI +SGKM++LD+LL R KK+G RVLIFSQM 
Sbjct: 411 PYLFEGAEP------GPPYTTDEH----LIYNSGKMIVLDKLLKRKKKEGSRVLIFSQMS 460

Query: 722 RMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLM 781
           R+LDIL DY   +   + R+DG     +R  +ID FN+ DS  F+FLL+TRAGGLGINL+
Sbjct: 461 RLLDILEDYCYFRDFEYCRIDGATSHEERIAAIDEFNAHDSKKFIFLLTTRAGGLGINLV 520

Query: 782 TADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEY 841
           TADTVV++DSDWNPQADLQAM RAHRIGQK  V VYRLV+++ +EE+V+ERA +K+ L+ 
Sbjct: 521 TADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVHVYRLVTENAIEEKVIERAAQKLRLDQ 580

Query: 842 AIISLGVTDGNKYTKKNEPNA-GELSAILKFGAGNMFTATDNQKKLEDLNLDDVLNHAE 899
            +I  G   G K    N  N  GEL  +++FGA ++F     +  + D ++D +L   E
Sbjct: 581 LVIQQGA--GRK--SANLGNTKGELIDMIQFGARDVFDKKLTEATVAD-DIDAILMKGE 634

>CAGL0C01683g 178695..182042 highly similar to sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1 or tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1115

 Score =  446 bits (1147), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 242/567 (42%), Positives = 351/567 (61%), Gaps = 36/567 (6%)

Query: 368 PPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGP 427
           P +I  G+LRD+Q+ G+NW+  L      GILADEMGLGKT+QT++F+ +L + ++  GP
Sbjct: 168 PAYI-NGQLRDYQVQGLNWLVSLDKNRIAGILADEMGLGKTLQTISFLGYLRYIKKIPGP 226

Query: 428 HIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNV 487
            +++ P ST+  WL    KW P++N     G+++ R  + + +F             F+V
Sbjct: 227 FLVIAPKSTLNNWLREINKWTPEVNAFILQGDKEERARLIQDKFMA---------CDFDV 277

Query: 488 LLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQN 547
           ++ +YE I++++A    + W+++ +DEAHR+KN ES L + L  F   NR+LITGTPLQN
Sbjct: 278 VIASYEIIIREKAAFRKMNWEYIMIDEAHRIKNEESMLSQVLREFHSKNRLLITGTPLQN 337

Query: 548 NIKELAALVNFLMPGRFTIDQEIDF----ENQDEEQEEYIHDLHRRIQPFILRRLKKDVE 603
           N+ EL AL+NFL+P  F+  Q+ D     E  +E+QE+ +  LH  +QPF+LRR+K DVE
Sbjct: 338 NLHELWALLNFLLPDIFSDSQDFDEWFSKETDEEDQEKIVKQLHTVLQPFLLRRIKSDVE 397

Query: 604 KSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GAKGGHFSLLNIMNELKKASNH 661
            SL  K E  + V +S +Q ++Y+ IL K+  A+ A  G+K     LLNI+ +L+K  NH
Sbjct: 398 TSLLPKKELNVYVGMSPMQKKWYRQILEKDIDAVNADSGSKESKTRLLNIVMQLRKCCNH 457

Query: 662 PYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMV 721
           PYLFD AE       G    T E+    L+ +S K+ +LD+LL +LK+ G RVLIFSQM 
Sbjct: 458 PYLFDGAEP------GPPYTTDEH----LVYNSEKLKVLDKLLRKLKEAGSRVLIFSQMS 507

Query: 722 RMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLM 781
           R+LDIL DY   +   + R+DG+     R  +ID +N+PDS  F+FLL+TRAGGLGINL 
Sbjct: 508 RVLDILEDYCYFREYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFLFLLTTRAGGLGINLT 567

Query: 782 TADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEY 841
           TAD VV+FDSDWNPQADLQAM RAHRIGQK  V V+R V+ ++VEE++LERA +K+ L+ 
Sbjct: 568 TADVVVLFDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQKLRLDQ 627

Query: 842 AIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMF---------TATDNQKKLEDLNLD 892
            +I        K   KN+     LS I + GA ++F         T   +  K ED++LD
Sbjct: 628 LVIQQNRPTNKKKENKNDSKDALLSMI-QHGAADVFKSNTTSERGTPQPDDDKGEDVDLD 686

Query: 893 DVLNHAEDHVTTPDLGESHLGGEEFLK 919
           ++L  +E    + +     LG ++  K
Sbjct: 687 ELLAQSESKTQSLNAKYESLGLDDLQK 713

>Kwal_14.1600
          Length = 1102

 Score =  436 bits (1122), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 229/526 (43%), Positives = 329/526 (62%), Gaps = 28/526 (5%)

Query: 368 PPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGP 427
           PPFI G  LR +Q+ G+NW+  L      GILADEMGLGKT+QT++F+ +L +  ++ GP
Sbjct: 129 PPFINGC-LRPYQVQGVNWLVSLHRNNLAGILADEMGLGKTLQTISFLGYLRYVEKKPGP 187

Query: 428 HIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNV 487
            +++ P ST+  WL    +W PD+      G+++ R  +          A       F++
Sbjct: 188 FVVIAPKSTLNNWLREINRWTPDVRAFILQGDKEERAKLV---------ANKLMACDFDI 238

Query: 488 LLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQN 547
           ++ +YE I+K++A    I W+++ +DEAHR+KN ES L + L  F   NR+LITGTPLQN
Sbjct: 239 VVASYEIIIKEKASFKKIAWEYIVIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQN 298

Query: 548 NIKELAALVNFLMPGRFTIDQEID----FENQDEEQEEYIHDLHRRIQPFILRRLKKDVE 603
           N+ EL AL+NFL+P  F+  Q  D     E+ ++++ + +  LH  +QPF+LRRLK +VE
Sbjct: 299 NLHELWALLNFLLPDVFSDSQAFDDWFSSESSEDDKGKIVKQLHTVLQPFLLRRLKNEVE 358

Query: 604 KSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GAKGGHFSLLNIMNELKKASNH 661
            SL  K E  L + +S +Q  +YK IL K+  A+    G K     LLN+M +L+K  NH
Sbjct: 359 TSLLPKKELNLYIGMSSMQKRWYKQILEKDIDAVNGANGNKESKTRLLNVMMQLRKCCNH 418

Query: 662 PYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMV 721
           PYLFD AE       G    T E+    L+ +S K+ +LD+LL + K++G RVLIFSQM 
Sbjct: 419 PYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLRKFKEEGSRVLIFSQMS 468

Query: 722 RMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLM 781
           R+LDIL DY   +   + R+DG+     R  +ID +N+PDS  FVFLL+TRAGGLGINL 
Sbjct: 469 RVLDILEDYCFFRQYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFVFLLTTRAGGLGINLT 528

Query: 782 TADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEY 841
           TAD VV++DSDWNPQADLQAM RAHRIGQK  V V+RLV+ ++VEE++LERA +K+ L+ 
Sbjct: 529 TADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRLVTDNSVEEKILERATQKLRLDQ 588

Query: 842 AIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFT--ATDNQKK 885
            +I       N+   K   +   L ++++ GA ++F+  +TD   K
Sbjct: 589 LVIQQSRNGVNQKEVKKGDSKDALLSMIQHGAADVFSTNSTDTSTK 634

>AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH]
           complement(363162..366422) [3261 bp, 1086 aa]
          Length = 1086

 Score =  428 bits (1101), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 241/573 (42%), Positives = 355/573 (61%), Gaps = 43/573 (7%)

Query: 368 PPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGP 427
           P F+  G LR +Q+ G+NW+  L      GILADEMGLGKT+QT+ F+ +L +  ++ GP
Sbjct: 137 PGFV-DGRLRPYQVQGVNWLVSLHKNNLAGILADEMGLGKTLQTITFLGYLRYIEKKRGP 195

Query: 428 HIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNV 487
            +++ P ST+  W     +W PD++     G+++ R  + +                F+V
Sbjct: 196 FLVIAPKSTLNNWQREINRWTPDVDAFILQGDKEERARLCQERLLA---------CNFDV 246

Query: 488 LLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQN 547
            + +YE I++++A    I W+++ +DEAHR+KN ES L + L  F   NR+LITGTPLQN
Sbjct: 247 AIASYEIIIREKASFKKIDWEYIVIDEAHRIKNEESMLSQVLREFSSRNRLLITGTPLQN 306

Query: 548 NIKELAALVNFLMPGRFT----IDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKKDVE 603
           N+ EL AL+NFL+P  F+     D+    E  D+++++ +  LH  +QPF+LRR+K DVE
Sbjct: 307 NLHELWALLNFLLPDIFSDSAAFDEWFSSEASDDDKDKIVKQLHTILQPFLLRRIKSDVE 366

Query: 604 KSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GAKGGHFSLLNIMNELKKASNH 661
            SL  K E  L V +S +Q ++YK IL K+  A+    G+K     LLNIM +L+K  NH
Sbjct: 367 TSLLPKKELNLYVGMSSMQRKWYKQILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCCNH 426

Query: 662 PYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMV 721
           PYLFD AE       G    T E+    L+ +S K+ +LD+LL +LK+DG RVLIFSQM 
Sbjct: 427 PYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLKKLKEDGSRVLIFSQMS 476

Query: 722 RMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLM 781
           R+LDIL DY   +G  + R+DG+     R  +ID +N+PDS  F+FLL+TRAGGLGINL 
Sbjct: 477 RLLDILEDYCYFRGYEYCRIDGSTAHEDRIEAIDEYNAPDSRKFIFLLTTRAGGLGINLT 536

Query: 782 TADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEY 841
           TAD VV++DSDWNPQADLQAM RAHRIGQK  V V+RLV+ ++VEE++LERA +K+ L+ 
Sbjct: 537 TADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRLDQ 596

Query: 842 AIISLGVTDGNKYTKKNEPNAGE-LSAILKFGAGNMFTATDNQK--------------KL 886
            +I  G T  +K  K+N  +A + L ++++ GA +MF +TD                 K 
Sbjct: 597 LVIQQGRTSISK--KENAKDAKDALLSMIQHGAVDMFRSTDTSNASSAKGTPQPETGDKD 654

Query: 887 EDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLK 919
           ++++L+ +LN +E+   + +   + LG ++  K
Sbjct: 655 DEVDLESLLNKSENKTKSLNEKYAALGLDQLQK 687

>AER375C [2876] [Homologous to ScYIL126W (STH1) - SH]
           (1332505..1336371) [3867 bp, 1288 aa]
          Length = 1288

 Score =  429 bits (1103), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 223/518 (43%), Positives = 324/518 (62%), Gaps = 38/518 (7%)

Query: 362 EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFA 421
           EK+  QP  + GG L+++Q+ G+ WM  L++   NGILADEMGLGKT+Q+++ I++L   
Sbjct: 443 EKVEKQPSILVGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEV 502

Query: 422 RRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKK 481
           ++ +GP +++VPLST+  W   FEKWAP L  + Y G    R +++             +
Sbjct: 503 KKDSGPFLVIVPLSTITNWTLEFEKWAPSLTTVIYKGTPNQRRSLQH----------QVR 552

Query: 482 TMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSL-YESLNSFKVANRMLI 540
              F+VLLTTYEYI+KDR+ L   +W  M +DE HR+KNA+S L Y   + +K  +R+++
Sbjct: 553 IGDFDVLLTTYEYIIKDRSLLAKHEWSHMIIDEGHRMKNAQSKLSYTLTHYYKTRHRLIL 612

Query: 541 TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDEEQEE---------YIHD 585
           TGTPLQNN+ EL AL+NF++P  F   +  D      F N   +++           I  
Sbjct: 613 TGTPLQNNLPELWALLNFVLPKIFNSSKTFDEWFNTPFSNTGGQEKLELTEEEALLVIRR 672

Query: 586 LHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGA---- 641
           LH+ ++PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   + AG     
Sbjct: 673 LHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQHQLYQQMLKHNALFVGAGTEGAT 732

Query: 642 KGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLD 701
           KGG   L N + +L+K  NHP++FD  E       G    TR N    L   SGK  LLD
Sbjct: 733 KGGIKGLNNKIMQLRKICNHPFVFDEVE-------GVVNPTRTNS-SLLYRVSGKFELLD 784

Query: 702 QLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPD 761
           ++L + K  GHRVL+F QM +++DI+ D+L +K + + RLDG   + +R   ++ FN+PD
Sbjct: 785 RVLPKFKATGHRVLMFFQMTQVMDIMEDFLQMKNLKYMRLDGATKAEERTGMLNAFNAPD 844

Query: 762 SNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVS 821
           S+ F FLLSTRAGGLG+NL TADTV+IFD+DWNP  DLQA  RAHRIGQKN V + RL++
Sbjct: 845 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 904

Query: 822 KDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNE 859
            D+VEE +LERA +K+ ++  +I  G  D     ++ E
Sbjct: 905 TDSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQE 942

>KLLA0F04521g complement(435649..439683) similar to sp|P32597
            Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
            complex, start by similarity
          Length = 1344

 Score =  429 bits (1103), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 235/560 (41%), Positives = 333/560 (59%), Gaps = 46/560 (8%)

Query: 362  EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFA 421
            E +  QP  + GG L+++QL G+ WM  L++   NGILADEMGLGKT+Q+++ IS+L   
Sbjct: 499  ETVDKQPSILVGGTLKEYQLKGLEWMVSLYNNHLNGILADEMGLGKTIQSISLISYLYEI 558

Query: 422  RRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKK 481
            + +  P +++VPLST+  W   FEKWAP L  I Y GN   R  ++             K
Sbjct: 559  KNERQPFLVIVPLSTITNWTIEFEKWAPSLRTIVYKGNPNQRKALQH----------TIK 608

Query: 482  TMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSL-YESLNSFKVANRMLI 540
               F+V+LTTYEYI+KDR  L    W  M +DE HR+KNA+S L Y   + +K  NR+++
Sbjct: 609  MGNFDVVLTTYEYIIKDRPLLAKHDWAHMIIDEGHRMKNAQSKLSYTLTHYYKTKNRLIL 668

Query: 541  TGTPLQNNIKELAALVNFLMPGRFTIDQEID---------------FENQDEEQEEYIHD 585
            TGTPLQNN+ EL AL+NF++P  F   +  D                E  +EE    I  
Sbjct: 669  TGTPLQNNLPELWALLNFVLPKIFNSSKTFDEWFNTPFANTGTQEKLEMTEEETLLVIRR 728

Query: 586  LHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKG-- 643
            LH+ ++PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   + AG +G  
Sbjct: 729  LHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSSLQQQLYEQMLKHNAFFIGAGTEGAT 788

Query: 644  --GHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLD 701
              G   L N + +L+K  NHP++FD  E  +         TREN    L   SGK  LLD
Sbjct: 789  KAGIKGLNNKVMQLRKICNHPFVFDEVENVI-------NPTRENS-SILYRVSGKFELLD 840

Query: 702  QLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPD 761
            ++L + K  GHRVL+F QM +++DI+ D+L ++ + + RLDG   +  R   +  FN+PD
Sbjct: 841  RVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMRDLKYMRLDGGTKAEDRTGMLKLFNAPD 900

Query: 762  SNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVS 821
            S  F FLLSTRAGGLG+NL TADTV+IFD+DWNP  DLQA  RAHRIGQKN V + RL++
Sbjct: 901  SEYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 960

Query: 822  KDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAIL-KFGAGNMFTAT 880
             D+VEE +LERA +K+ ++  +I  G  D       N+  A E    L +   G+     
Sbjct: 961  TDSVEEVILERAMQKLDIDGKVIQAGKFD-------NKSTAEEQEEFLRRLLEGDTNKDD 1013

Query: 881  DNQKKLEDLNLDDVLNHAED 900
            +   +L+D  L+++L   ED
Sbjct: 1014 EYSGELDDEELNEILARTED 1033

>Kwal_23.4777
          Length = 1301

 Score =  427 bits (1097), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 234/560 (41%), Positives = 338/560 (60%), Gaps = 46/560 (8%)

Query: 362 EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFA 421
           EK+  QP  + GG L+++Q+ G+ WM  L++   NGILADEMGLGKT+Q+++ I++L   
Sbjct: 442 EKIEKQPSILVGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLRET 501

Query: 422 RRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKK 481
           + + GP +++VPLST+  W   FEKWAP L  I Y G    R +++      N       
Sbjct: 502 KNEPGPFLVIVPLSTITNWTLEFEKWAPSLATIVYKGTPNQRKSMQHQIRIGN------- 554

Query: 482 TMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSF-KVANRMLI 540
              F VLLTTYEYI+KDR+ L    W  M +DE HR+KNA+S L  +L  + +  NR+++
Sbjct: 555 ---FEVLLTTYEYIIKDRSLLAKHDWSHMIIDEGHRMKNAQSKLSFTLTRYYRTRNRLIL 611

Query: 541 TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDEEQEE---------YIHD 585
           TGTPLQNN+ EL AL+NF++P  F   +  D      F N   +++           I  
Sbjct: 612 TGTPLQNNLPELWALLNFVLPKIFNSAKTFDEWFNTPFANTGGQEKLELTEEETLLVIRR 671

Query: 586 LHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKN---YSALTAGA- 641
           LH+ ++PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   + A T GA 
Sbjct: 672 LHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQHQLYQQMLKHNALFFGAGTEGAT 731

Query: 642 KGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLD 701
           KGG   L N + +L+K  NHP++FD  E  +     +  +        L   +GK  LLD
Sbjct: 732 KGGIKGLNNKIMQLRKICNHPFVFDEVEGIINPSRANSPL--------LYRVAGKFELLD 783

Query: 702 QLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPD 761
           ++L + K  GHRVL+F QM +++DI+ D+L ++G+ + RLDG   +  R   +  FN+P+
Sbjct: 784 RILLKFKVTGHRVLMFFQMTQVMDIMEDFLRMRGLKYLRLDGATKTEDRTGMLKLFNAPN 843

Query: 762 SNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVS 821
           S  F FLLSTRAGGLG+NL TADTV+IFD+DWNP  DLQA  RAHRIGQKN V + RL++
Sbjct: 844 SEYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 903

Query: 822 KDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTA-T 880
            D+VEE +LERA +K+ ++  +I  G  D       N+  A E  A L+    N      
Sbjct: 904 TDSVEEVILERALQKLDIDGKVIQAGKFD-------NKSTAEEQEAFLRRLLENENAKDE 956

Query: 881 DNQKKLEDLNLDDVLNHAED 900
           D++ +L D  L+D+L   ED
Sbjct: 957 DDEAELNDEELNDILARGED 976

>Scas_662.7
          Length = 1342

 Score =  424 bits (1091), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 223/518 (43%), Positives = 322/518 (62%), Gaps = 38/518 (7%)

Query: 362 EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFA 421
           EK+  QP  + GG L+++Q+ G+ WM  L++   NGILADEMGLGKT+Q+++ I++L   
Sbjct: 447 EKIDKQPSMLVGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLFEE 506

Query: 422 RRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKK 481
           ++  GP++++VPLST+  W   FEKWAP LN + Y G    R  ++      N       
Sbjct: 507 KKDPGPYLVIVPLSTITNWTLEFEKWAPSLNTVIYKGTPNQRRNLQHQVRIGN------- 559

Query: 482 TMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSL-YESLNSFKVANRMLI 540
              F+VLLTTYEYI+KDRA L   +W  M +DE HR+KNA+S L Y   + +K  +R+++
Sbjct: 560 ---FDVLLTTYEYIIKDRALLAKHEWTHMIIDEGHRMKNAQSKLSYTITHYYKTRHRLIL 616

Query: 541 TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDEEQEE---------YIHD 585
           TGTPLQNN+ EL AL+NF++P  F   +  +      F N    ++           I  
Sbjct: 617 TGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTGEKLELTEEETLLVIRR 676

Query: 586 LHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKG-- 643
           LH+ ++PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   L  G +G  
Sbjct: 677 LHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQQQLYEQMLKHNALFLGEGTEGAT 736

Query: 644 --GHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLD 701
             G   L N + +L+K  NHP++FD  E       G    TR N    L   SGK  LL+
Sbjct: 737 KSGIKGLNNKIMQLRKICNHPFVFDEVE-------GVINPTRANS-NLLYRVSGKFELLN 788

Query: 702 QLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPD 761
           ++L + K  GHRVL+F QM +++DI+ D+L +K + + RLDG+  +  R   ++ FN+PD
Sbjct: 789 RVLPKFKAAGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKADDRTGMLNDFNAPD 848

Query: 762 SNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVS 821
           S+ F FLLSTRAGGLG+NL TADTV+IFD+DWNP  DLQA  RAHRIGQKN V + RL++
Sbjct: 849 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 908

Query: 822 KDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNE 859
            D+VEE +LERA +K+ ++  +I  G  D     ++ E
Sbjct: 909 TDSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQE 946

>YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative
           ATP-dependent chromatin remodeling factor, has strong
           similarity to Drosophila nucleosome remodeling factor
           ISWI [3390 bp, 1129 aa]
          Length = 1129

 Score =  419 bits (1078), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 229/519 (44%), Positives = 330/519 (63%), Gaps = 26/519 (5%)

Query: 367 QPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNG 426
           + P    G+LR +Q+ G+NW+  L      GILADEMGLGKT+QT++F+ +L +  +  G
Sbjct: 187 ESPAYVNGQLRPYQIQGVNWLVSLHKNKIAGILADEMGLGKTLQTISFLGYLRYIEKIPG 246

Query: 427 PHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFN 486
           P +++ P ST+  WL    +W PD+N     G+++ R  + + +              F+
Sbjct: 247 PFLVIAPKSTLNNWLREINRWTPDVNAFILQGDKEERAELIQKKLLG---------CDFD 297

Query: 487 VLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQ 546
           V++ +YE I+++++ L  I W+++ +DEAHR+KN ES L + L  F   NR+LITGTPLQ
Sbjct: 298 VVIASYEIIIREKSPLKKINWEYIIIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQ 357

Query: 547 NNIKELAALVNFLMPGRFTIDQEID----FENQDEEQEEYIHDLHRRIQPFILRRLKKDV 602
           NN+ EL AL+NFL+P  F+  Q+ D     E+ +E+Q++ +  LH  +QPF+LRR+K DV
Sbjct: 358 NNLHELWALLNFLLPDIFSDAQDFDDWFSSESTEEDQDKIVKQLHTVLQPFLLRRIKSDV 417

Query: 603 EKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GAKGGHFSLLNIMNELKKASN 660
           E SL  K E  L V +S +Q ++YK IL K+  A+    G+K     LLNIM +L+K  N
Sbjct: 418 ETSLLPKKELNLYVGMSSMQKKWYKKILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCCN 477

Query: 661 HPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQM 720
           HPYLFD AE       G    T E+    L+ ++ K+ +LD+LL +LK++G RVLIFSQM
Sbjct: 478 HPYLFDGAEP------GPPYTTDEH----LVYNAAKLQVLDKLLKKLKEEGSRVLIFSQM 527

Query: 721 VRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINL 780
            R+LDIL DY   +   + R+DG+     R  +ID +N+PDS  FVFLL+TRAGGLGINL
Sbjct: 528 SRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLGINL 587

Query: 781 MTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILE 840
            +AD VV++DSDWNPQADLQAM RAHRIGQK  V V+RLV+ ++VEE++LERA +K+ L+
Sbjct: 588 TSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRLD 647

Query: 841 YAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTA 879
             +I    T   K   K +     LS I + GA ++F +
Sbjct: 648 QLVIQQNRTSLKKKENKADSKDALLSMI-QHGAADVFKS 685

>Scas_597.8
          Length = 1065

 Score =  417 bits (1071), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 235/564 (41%), Positives = 348/564 (61%), Gaps = 38/564 (6%)

Query: 368 PPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGP 427
           P FI  G LR++Q+ G+NW+  L      GILADEMGLGKT+QT++F+ +L +  +  GP
Sbjct: 125 PGFI-NGTLRNYQIQGLNWLVSLHKSKLAGILADEMGLGKTLQTISFLGYLRYVEKIPGP 183

Query: 428 HIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNV 487
            +++ P ST+  WL    KW P++N     G+++ R  + + +              F++
Sbjct: 184 FLVIAPKSTLNNWLREINKWTPEVNAFILQGDKEERAQLVKDKLLA---------CDFDI 234

Query: 488 LLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQN 547
           ++ +YE I+++++    I WQ++ +DEAHR+KN ES L + L  F  +NR+LITGTPLQN
Sbjct: 235 VVASYEIIIREKSAFRKIDWQYIIIDEAHRIKNEESLLSQVLREFTSSNRLLITGTPLQN 294

Query: 548 NIKELAALVNFLMPGRFTIDQEID----FENQDEEQEEYIHDLHRRIQPFILRRLKKDVE 603
           N+ EL AL+NFL+P  F+  Q+ D     E  +E+QE+ +  LH  +QPF+LRRLK DVE
Sbjct: 295 NLHELWALLNFLLPDIFSDSQDFDDWFSSETTEEDQEKVVKQLHTVLQPFLLRRLKNDVE 354

Query: 604 KSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGA--KGGHFSLLNIMNELKKASNH 661
            SL  K E  L V +S++Q ++YK IL K+  A+      K     LLNI+ +L+K  NH
Sbjct: 355 TSLLPKQELNLYVGMSNMQKKWYKQILEKDIDAVNGSNVNKESKTRLLNIVMQLRKCCNH 414

Query: 662 PYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMV 721
           PYLFD AE       G    T E+    L+ +S K+ +LD+LL ++K++G RVLIFSQM 
Sbjct: 415 PYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLKKMKEEGSRVLIFSQMS 464

Query: 722 RMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLM 781
           R+LDIL DY   +G  + R+DG+     R  +ID +N P S  F+FLL+TRAGGLGINL 
Sbjct: 465 RVLDILEDYCFFRGYEYCRIDGSTDHEDRIRAIDEYNEPGSKKFIFLLTTRAGGLGINLT 524

Query: 782 TADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEY 841
           +A+ VV+FDSDWNPQADLQAM RAHRIGQK  V V+RLV+ ++VEE++LERA +K+ L+ 
Sbjct: 525 SANIVVLFDSDWNPQADLQAMDRAHRIGQKRQVKVFRLVTDNSVEEKILERATQKLRLDQ 584

Query: 842 AIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDNQKK------------LEDL 889
            +I    +   K  +  + N   L ++++ GA ++F + D+  +             +D+
Sbjct: 585 LVIQQNRSTLKKKKENKKDNKEALLSMIQHGAADVFQSIDSSAENSNRNTPQPGDATDDI 644

Query: 890 NLDDVLNHAEDHVTTPDLGESHLG 913
           +LD +L  +ED   + +     LG
Sbjct: 645 DLDSILALSEDKTKSLNAKYESLG 668

>KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces
           cerevisiae YBR245c ISW1, start by similarity
          Length = 1096

 Score =  417 bits (1071), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 240/576 (41%), Positives = 351/576 (60%), Gaps = 42/576 (7%)

Query: 367 QPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNG 426
           + P    G+LR +Q+ G+NW+  L      GILADEMGLGKT+QT+AF+ +L +  ++NG
Sbjct: 132 ESPAYVNGQLRPYQIQGLNWLVALHKNQLAGILADEMGLGKTLQTIAFLGYLRYIEKKNG 191

Query: 427 PHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFN 486
           P +++ P ST+  WL    +W P+++     G+++ R  +   +              F+
Sbjct: 192 PFLVIAPKSTLNNWLREINRWTPEVSAFILQGDKEERSKLCHDKLLA---------CDFD 242

Query: 487 VLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQ 546
           + + +YE I++++A    I W+++ +DEAHR+KN ES L + L  F   NR+LITGTPLQ
Sbjct: 243 ICVASYEIIIREKASFKKIDWEYVVIDEAHRIKNEESMLSQVLREFSSRNRLLITGTPLQ 302

Query: 547 NNIKELAALVNFLMPGRF----TIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKKDV 602
           NN+ EL AL+NFL+P  F    T D+    E+ +E++E+ +  LH  + PF+LRR+K DV
Sbjct: 303 NNLHELWALLNFLLPDIFADSATFDEWFSSESSEEDKEKVVKQLHTVLSPFLLRRIKNDV 362

Query: 603 EKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GAKGGHFSLLNIMNELKKASN 660
           E SL  K E  + V +S +Q ++YK IL K+  A+    G K     LLNI+ +L+K  N
Sbjct: 363 EGSLLPKKELNVYVGMSSMQKKWYKQILEKDIDAVNGSNGQKESKTRLLNIVMQLRKCCN 422

Query: 661 HPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQM 720
           HPYLFD AE       G    T E+    L+ +S K+ +LD+LL + K+ G RVLIFSQM
Sbjct: 423 HPYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLKKFKEQGSRVLIFSQM 472

Query: 721 VRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINL 780
            R+LDIL DY   +   + R+DG+     R  +ID +N+PDS  F+FLL+TRAGGLGINL
Sbjct: 473 SRVLDILEDYCYFREYEYCRIDGSTAHEDRINAIDDYNAPDSKKFIFLLTTRAGGLGINL 532

Query: 781 MTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILE 840
            TAD VV++DSDWNPQADLQAM RAHRIGQK  V V+R V+ ++VEE++LERA +K+ L+
Sbjct: 533 TTADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQKLKLD 592

Query: 841 YAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDN---------------QKK 885
             +I  G     K   KN+   G LS I + GA ++F + D+               + K
Sbjct: 593 QLVIQQGRVTNKKKENKNDSKEGLLSMI-QHGAVDVFKSNDSSAMTSQTGTPHPDDGKDK 651

Query: 886 LEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLKQF 921
            ED++LD +L  +ED   + +   + LG +E L++F
Sbjct: 652 DEDVDLDALLAQSEDKTRSLNAKYATLGLDE-LQRF 686

>YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundant
           chromatin remodeling complex (RSC), involved in the
           response to DNA damage, DNA helicase of the Snf2p
           family, has a bromodomain [4080 bp, 1359 aa]
          Length = 1359

 Score =  419 bits (1078), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 225/529 (42%), Positives = 329/529 (62%), Gaps = 45/529 (8%)

Query: 362 EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFA 421
           EK+  QP  + GG L+++QL G+ WM  L++   NGILADEMGLGKT+Q+++ I++L   
Sbjct: 456 EKIDKQPSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEV 515

Query: 422 RRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKK 481
           ++  GP +++VPLST+  W   FEKWAP LN I Y G    R +++      N       
Sbjct: 516 KKDIGPFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQRHSLQHQIRVGN------- 568

Query: 482 TMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSF-KVANRMLI 540
              F+VLLTTYEYI+KD++ L    W  M +DE HR+KNA+S L  +++ + +  NR+++
Sbjct: 569 ---FDVLLTTYEYIIKDKSLLSKHDWAHMIIDEGHRMKNAQSKLSFTISHYYRTRNRLIL 625

Query: 541 TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDEEQEE---------YIHD 585
           TGTPLQNN+ EL AL+NF++P  F   +  +      F N   +++           I  
Sbjct: 626 TGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLIIRR 685

Query: 586 LHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGA---- 641
           LH+ ++PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   + AG     
Sbjct: 686 LHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYQQMLKHNALFVGAGTEGAT 745

Query: 642 KGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLD 701
           KGG   L N + +L+K  NHP++FD  E  V    G+  +        L   +GK  LLD
Sbjct: 746 KGGIKGLNNKIMQLRKICNHPFVFDEVEGVVNPSRGNSDL--------LFRVAGKFELLD 797

Query: 702 QLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPD 761
           ++L + K  GHRVL+F QM +++DI+ D+L +K + + RLDG+  + +R   ++ FN+PD
Sbjct: 798 RVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPD 857

Query: 762 SNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVS 821
           S+ F FLLSTRAGGLG+NL TADTV+IFD+DWNP  DLQA  RAHRIGQKN V + RL++
Sbjct: 858 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 917

Query: 822 KDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILK 870
            D+VEE +LERA +K+ ++  +I  G  D       N+  A E  A L+
Sbjct: 918 TDSVEEVILERAMQKLDIDGKVIQAGKFD-------NKSTAEEQEAFLR 959

>Kwal_26.9164
          Length = 1454

 Score =  413 bits (1062), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 220/551 (39%), Positives = 340/551 (61%), Gaps = 48/551 (8%)

Query: 362  EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFA 421
            E++  QP  + GG L+++QL G+ WM  L++   NGILADEMGLGKT+QT++ +++L   
Sbjct: 588  EEIKQQPSILVGGTLKEYQLKGLQWMVSLYNNHLNGILADEMGLGKTIQTISLLTYLYEV 647

Query: 422  RRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKK 481
            +   GP +++VPLST+  W   F+KWAP +  + Y G+   R +          +    +
Sbjct: 648  KNVRGPSLVIVPLSTLTNWDSEFDKWAPVIRKVAYKGSPNERKS----------KQGIIR 697

Query: 482  TMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVAN-RMLI 540
            + +F+V+LTT+EYI+K+RA L  IKW  M +DE HR+KNA+S L  +LN++   + R+++
Sbjct: 698  SGQFDVVLTTFEYIIKERALLSKIKWVHMIIDEGHRMKNAQSKLSLTLNNYYHTDYRLIL 757

Query: 541  TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FEN---------QDEEQEEYIHD 585
            TGTPLQNN+ EL AL+NF++P  F   +  D      F N          +EE    I  
Sbjct: 758  TGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRR 817

Query: 586  LHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKN---YSALTAGAK 642
            LH+ ++PF+LRRLKKDVEK LP K E++L+ ++S +Q + Y+ +L         L +   
Sbjct: 818  LHKVLRPFLLRRLKKDVEKELPDKVEKVLKCKMSALQQKLYEQMLKHRRLFIGDLNSNKN 877

Query: 643  GGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQ 702
             G     N + +LKK  NHP++F+  E+++       + T  N+ R     +GK  LL++
Sbjct: 878  VGMRGFNNQIMQLKKICNHPFVFEEVEDQI----NPTRETNANIWR----VAGKFELLER 929

Query: 703  LLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDS 762
            +L + K  GHR+LIF QM +++DI+ D+L +  + + RLDG   S  R + ++ FN+P+S
Sbjct: 930  ILPKFKATGHRILIFFQMTQIMDIMEDFLRLSNMKYLRLDGHTKSDDRTLLLNLFNAPNS 989

Query: 763  NDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSK 822
              F FLLSTRAGGLG+NL +ADTV+IFD+DWNP  DLQA  RAHRIGQKN V + RL+++
Sbjct: 990  EYFCFLLSTRAGGLGLNLQSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITE 1049

Query: 823  DTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDN 882
            ++VEE +L+RA KK+ ++  +I  G  D       N+  + E  A+L+    ++  A + 
Sbjct: 1050 NSVEEVILDRAHKKLDIDGKVIQAGKFD-------NKSTSEEQEALLR----SLLEAEEE 1098

Query: 883  QKKLEDLNLDD 893
            QK+  +L L++
Sbjct: 1099 QKRKRELGLEE 1109

>Scas_594.7
          Length = 1703

 Score =  416 bits (1069), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 218/519 (42%), Positives = 322/519 (62%), Gaps = 41/519 (7%)

Query: 362  EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFA 421
            E++  QP  + GG L+++QL G+ WM  L++   NGILADEMGLGKT+QT++ +++L   
Sbjct: 799  EEIRQQPAMLVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYET 858

Query: 422  RRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKK 481
            +  +GP++++VPLST+  W + F KWAP + CI Y G+   R +          +    K
Sbjct: 859  KHIHGPYLVIVPLSTLSNWSNEFAKWAPTMRCISYKGSPNERKS----------KHAIIK 908

Query: 482  TMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVAN-RMLI 540
            + +F+V+LTT+EYI+K+RA L  +KW  M +DE HR+KNA+S L  +LN++  ++ R+++
Sbjct: 909  SGEFDVVLTTFEYIIKERALLSKVKWIHMIIDEGHRMKNAQSKLSLTLNTYYHSDYRLIL 968

Query: 541  TGTPLQNNIKELAALVNFLMPGRFTIDQEID---------------FENQDEEQEEYIHD 585
            TGTPLQNN+ EL AL+NF +P  F   +  D                E  +EE    I  
Sbjct: 969  TGTPLQNNLPELWALLNFALPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRR 1028

Query: 586  LHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKG-- 643
            LH+ ++PF+LRRLKKDVEK LP K E++++ ++S +Q   Y+ +L   Y  L  G     
Sbjct: 1029 LHKVLRPFLLRRLKKDVEKELPDKVEKVIKCKMSALQQIMYQQML--KYRRLFIGDHTNK 1086

Query: 644  ---GHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLL 700
               G     N + +LKK  NHP++F+  E+++       + T  N+ R     +GK  LL
Sbjct: 1087 KMVGLRGFNNQLMQLKKICNHPFVFEEVEDQI----NPTRETNANIWR----VAGKFELL 1138

Query: 701  DQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSP 760
            +++L +LK  GHRVLIF QM +++DI+ D+L    I + RLDG   S  R   +  FN+P
Sbjct: 1139 EKVLPKLKATGHRVLIFFQMTQIMDIVEDFLRFIDIKYLRLDGHTKSDDRSNLLKLFNAP 1198

Query: 761  DSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLV 820
            DS    F+LSTRAGGLG+NL TADTV+IFD+DWNP  DLQA  RAHRIGQKN V + RL+
Sbjct: 1199 DSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLI 1258

Query: 821  SKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNE 859
            ++ +VEE +LERA KK+ ++  +I  G  D    +++ E
Sbjct: 1259 TEHSVEEAILERAHKKLDIDGKVIQAGKFDNKSTSEEQE 1297

>CAGL0G08756g complement(829778..833842) highly similar to sp|P32597
           Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
           complex, hypothetical start
          Length = 1354

 Score =  409 bits (1052), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 217/518 (41%), Positives = 320/518 (61%), Gaps = 38/518 (7%)

Query: 362 EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFA 421
           EK+  QP  + GG L+++QL G+ WM  L++   NGILADEMGLGKT+Q+++ I++L   
Sbjct: 439 EKIEKQPSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEV 498

Query: 422 RRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKK 481
           +++ GP++++VPLST+  W   FEKWAP L  I Y G    R  ++             +
Sbjct: 499 KQEPGPYLVIVPLSTITNWTLEFEKWAPSLTTIIYKGTPNQRHALQH----------KIR 548

Query: 482 TMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSF-KVANRMLI 540
           +  F+VLLTTYEYI+KD+A L   +W  M +DE HR+KNA S L  ++  + +  NR+++
Sbjct: 549 SGNFDVLLTTYEYIIKDKALLSKHEWSHMIIDEGHRMKNANSKLSFTITKYYRTRNRLIL 608

Query: 541 TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDEEQEE---------YIHD 585
           TGTPLQNN+ EL AL+NF++P  F   +  +      F N   +++           I  
Sbjct: 609 TGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLVIRR 668

Query: 586 LHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGA---- 641
           LH+ ++PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   + AG     
Sbjct: 669 LHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQQQLYQQMLKHNALFVGAGTEGAT 728

Query: 642 KGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLD 701
           KGG   L N + +L+K  NHP++FD  E  V    G+  +        L   +GK  LLD
Sbjct: 729 KGGIKGLNNKIMQLRKICNHPFVFDEVEAVVNPSRGNSDL--------LYRVAGKFELLD 780

Query: 702 QLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPD 761
           ++L + K  GHRVLIF QM +++DI+ D+L ++ + + RLDG+  +  R   +  FN  +
Sbjct: 781 RILPKFKATGHRVLIFFQMTQVMDIMEDFLRMRDLKYMRLDGSTKAEDRNDMLKEFNVEN 840

Query: 762 SNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVS 821
           S  F FLLSTRAGGLG+NL +ADTV+IFD+DWNP  DLQA  RAHRIGQKN V + RL++
Sbjct: 841 SEYFCFLLSTRAGGLGLNLQSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 900

Query: 822 KDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNE 859
            D+VEE +LERA +K+ ++  +I  G  D     ++ E
Sbjct: 901 TDSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQE 938

>YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component of
            SWI-SNF global transcription activator complex, acts to
            assist gene-specific activators through chromatin
            remodeling, involved in sensitivity to UV irradiation
            [5112 bp, 1703 aa]
          Length = 1703

 Score =  411 bits (1057), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 220/521 (42%), Positives = 321/521 (61%), Gaps = 45/521 (8%)

Query: 362  EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFA 421
            E +  QP  + GG L+D+Q+ G+ WM  L++   NGILADEMGLGKT+QT++ +++L   
Sbjct: 753  EDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEM 812

Query: 422  RRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKK 481
            +   GP++++VPLST+  W   F KWAP L  I + G+   R            +AK  K
Sbjct: 813  KNIRGPYLVIVPLSTLSNWSSEFAKWAPTLRTISFKGSPNER------------KAKQAK 860

Query: 482  TM--KFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVAN-RM 538
                +F+V+LTT+EYI+K+RA L  +KW  M +DE HR+KNA+S L  +LN+   A+ R+
Sbjct: 861  IRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRL 920

Query: 539  LITGTPLQNNIKELAALVNFLMPGRFTIDQEID---------------FENQDEEQEEYI 583
            ++TGTPLQNN+ EL AL+NF++P  F   +  D                E  +EE    I
Sbjct: 921  ILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVI 980

Query: 584  HDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKG 643
              LH+ ++PF+LRRLKKDVEK LP K E++++ ++S +Q   Y+ +L   Y  L  G + 
Sbjct: 981  RRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQML--KYRRLFIGDQN 1038

Query: 644  -----GHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMV 698
                 G     N + +LKK  NHP++F+  E+++       + T +++ R     +GK  
Sbjct: 1039 NKKMVGLRGFNNQIMQLKKICNHPFVFEEVEDQI----NPTRETNDDIWR----VAGKFE 1090

Query: 699  LLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFN 758
            LLD++L +LK  GHRVLIF QM +++DI+ D+L    I + RLDG   S +R   +  FN
Sbjct: 1091 LLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFN 1150

Query: 759  SPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYR 818
            +PDS    F+LSTRAGGLG+NL TADTV+IFD+DWNP  DLQA  RAHRIGQKN V + R
Sbjct: 1151 APDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILR 1210

Query: 819  LVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNE 859
            L++ ++VEE +LERA KK+ ++  +I  G  D    +++ E
Sbjct: 1211 LITTNSVEEVILERAYKKLDIDGKVIQAGKFDNKSTSEEQE 1251

>KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces
            cerevisiae YOR290c SNF2 component of SWI/SNF global
            transcription activator complex, hypothetical start
          Length = 1534

 Score =  409 bits (1050), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 219/561 (39%), Positives = 338/561 (60%), Gaps = 38/561 (6%)

Query: 362  EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFA 421
            E++  QP  + GG L+++QL G+ WM  L++   NGILADEMGLGKT+QT++ +++L  A
Sbjct: 670  EEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEA 729

Query: 422  RRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKK 481
            +  +GP +++VPLST+  W   F+KWAP L  I + G    R           P+    K
Sbjct: 730  KGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMER----------KPKQALIK 779

Query: 482  TMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVAN-RMLI 540
              +F+V+LTT+EYI+K+R  L  IKW    +DE HR+KNA+S L  +LN++  ++ R+++
Sbjct: 780  NREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLIL 839

Query: 541  TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FEN---------QDEEQEEYIHD 585
            TGTPLQNN+ EL AL+NF++P  F   +  D      F N          +EE    I  
Sbjct: 840  TGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRR 899

Query: 586  LHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGH 645
            LH+ ++PF+LRRLKKDVEK LP K E++L+ ++S +Q + Y+ +L      +   +    
Sbjct: 900  LHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQK 959

Query: 646  FS----LLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLD 701
            FS      N + +L+K  NHP++F+  E+++       + T + + R    S+GK  LL+
Sbjct: 960  FSSSRGFNNQIMQLRKICNHPFVFEEVEDQI----NPARETNDTIWR----SAGKFELLE 1011

Query: 702  QLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPD 761
            ++L + K  GHRVLIF QM +++DI+ D+L    + + RLDG   S  R   ++ FN+P+
Sbjct: 1012 RILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPN 1071

Query: 762  SNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVS 821
            S+ F FLLSTRAGGLG+NL TADTV+IFD+DWNP  DLQA  RAHRIGQKN V + RL++
Sbjct: 1072 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 1131

Query: 822  KDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATD 881
             ++VEE +L++A  K+ ++  +I  G  D     ++ E     L    +          +
Sbjct: 1132 DNSVEEAILDKAHAKLDIDGKVIQAGKFDNKSTAEEQEALLRSLLEAEEEEKKRRELGIE 1191

Query: 882  NQKKLEDLNLDDVLNHAEDHV 902
             +++L+D  L+++L   E+ +
Sbjct: 1192 EEEQLDDNELNEILARNENEI 1212

>AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH]
            (1439983..1444257,1444339..1444398) [4335 bp, 1444 aa]
          Length = 1444

 Score =  406 bits (1044), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 226/562 (40%), Positives = 334/562 (59%), Gaps = 63/562 (11%)

Query: 362  EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFA 421
            E + VQP  + GG L+++QL G+ WM  L++   NGILADEMGLGKT+QT++ +++L   
Sbjct: 547  EDVRVQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEF 606

Query: 422  RRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKK 481
            +  +GP +++VPLST+  W   F+KWAP L  + + G    R  +          +   K
Sbjct: 607  KGIHGPFLVIVPLSTLTNWNAEFDKWAPTLRKLAFKGPPSERKAL----------SGIIK 656

Query: 482  TMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVAN-RMLI 540
            +  F+V+LTT+EYI+K+R  L  +KW  M +DE HR+KNA+S L  +LN +   + R+++
Sbjct: 657  SGNFDVVLTTFEYIIKERPLLSKVKWVHMIIDEGHRMKNAQSKLSLTLNQYYHTDYRLIL 716

Query: 541  TGTPLQNNIKELAALVNFLMPGRFTIDQEID---------------FENQDEEQEEYIHD 585
            TGTPLQNN+ EL AL+NF++P  F   +  D                E  +EE    I  
Sbjct: 717  TGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRR 776

Query: 586  LHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKN--------YSAL 637
            LH+ ++PF+LRRLKKDVEK LP K E++L+  +S +Q + Y+ +L            S  
Sbjct: 777  LHKVLRPFLLRRLKKDVEKELPDKVEKVLKCRMSALQQKLYEQMLKHRRLFVVDDPSSKK 836

Query: 638  TAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKM 697
              G +G +    N + +LKK  NHP++F+  E+++       + T  N+ R     +GK 
Sbjct: 837  MVGLRGFN----NQIMQLKKICNHPFVFEEVEDQI----NPNRETNANIWR----VAGKF 884

Query: 698  VLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHF 757
             LL+++L + K  GHRVLIF QM +++DI+ D+L    + + RLDG   S  R   ++ F
Sbjct: 885  ELLEKILPKFKASGHRVLIFFQMTQIMDIMEDFLRFCDMKYLRLDGHTKSDDRTALLNKF 944

Query: 758  NSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVY 817
            N+P S+ F FLLSTRAGGLG+NL TADTV+IFD+DWNP  DLQA  RAHRIGQKN V + 
Sbjct: 945  NAPGSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRIL 1004

Query: 818  RLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMF 877
            RL++ ++VEE +LERA +K+ ++  +I  G  D       N+  A E  A+L+    ++ 
Sbjct: 1005 RLITDNSVEEVILERAHRKLDIDGKVIQAGKFD-------NKSTAEEQEALLR----SLL 1053

Query: 878  TATDNQKK------LEDLNLDD 893
             A + QK+       ED  LDD
Sbjct: 1054 EAEEEQKRKREMGVAEDEQLDD 1075

>CAGL0M04807g complement(514847..520039) similar to sp|P22082
            Saccharomyces cerevisiae YOR290c SNF2 or sp|P32597
            Saccharomyces cerevisiae YIL126w STH1, hypothetical start
          Length = 1730

 Score =  407 bits (1047), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 220/529 (41%), Positives = 321/529 (60%), Gaps = 46/529 (8%)

Query: 362  EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFA 421
            E++  QP  + GG L+++Q+ G+ WM  L++   NGILADEMGLGKT+QT++ +++L   
Sbjct: 788  EEVRQQPSILVGGTLKEYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEM 847

Query: 422  RRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKK 481
            +   GP +I+VPLST+P W   F KWAP L  I Y G+   R            +    K
Sbjct: 848  KNIKGPFLIIVPLSTLPNWSSEFAKWAPKLRTISYKGSPNERKM----------KQAQIK 897

Query: 482  TMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVAN-RMLI 540
            + +F+ ++TT+EYI+K+RA L  +KW  M +DE HR+KNA+S L  +LN+F  ++ R+++
Sbjct: 898  SGEFDAVITTFEYIIKERAILSKVKWVHMIIDEGHRMKNAQSKLSLTLNTFYHSDYRLIL 957

Query: 541  TGTPLQNNIKELAALVNFLMPGRFTIDQEID---------------FENQDEEQEEYIHD 585
            TGTPLQNN+ EL AL+NF++P  F   +  D                E  +EE    I  
Sbjct: 958  TGTPLQNNLPELWALLNFVLPKIFNSAKSFDEWFNTPFANTGGQDKIELSEEETLLIIRR 1017

Query: 586  LHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGH 645
            LH+ ++PF+LRRLKKDVEK LP K E++++ ++S +Q   Y+ +L K+        K   
Sbjct: 1018 LHKVLRPFLLRRLKKDVEKELPDKVEKVIKCKMSALQHAMYQQML-KHKQLFIGDQKKNK 1076

Query: 646  FSLL----NIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLD 701
               L    N + +LKK  NHP++F+  E+ +       + T  N+ R     +GK  LL+
Sbjct: 1077 LVGLRGFNNQLMQLKKICNHPFVFEEVEDHI----NPTRDTNMNIWR----VAGKFELLE 1128

Query: 702  QLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPD 761
            ++L +LK   HRVLIF QM +++DI+ D+L    I + RLDG   S +R   +  FN P+
Sbjct: 1129 RILPKLKASRHRVLIFFQMTQIMDIMEDFLRYIDIKYLRLDGHTRSDERGELLKLFNDPN 1188

Query: 762  SNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVS 821
            S  F F+LSTRAGGLG+NL TADTV+IFD+DWNP  DLQA  RAHRIGQKN V + RL++
Sbjct: 1189 SEYFCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRIIRLIT 1248

Query: 822  KDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILK 870
             ++VEE +LERA KK+ ++  +I  G  D       N+  A E  A+L+
Sbjct: 1249 TNSVEEVILERAYKKLDIDGKVIQAGKFD-------NKSTAEEQEALLR 1290

>Kwal_47.18077
          Length = 809

 Score =  337 bits (863), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 206/550 (37%), Positives = 300/550 (54%), Gaps = 76/550 (13%)

Query: 364 LSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARR 423
           L  QP  +K  +L+ +QL G+NW+  L+  G NGILADEMGLGKT+Q++A +++ I    
Sbjct: 168 LHQQPSLLKNCQLKPYQLEGVNWLITLYENGLNGILADEMGLGKTLQSIALLAF-ITEMD 226

Query: 424 QNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKS--RDTIREYEFYTNPRAKGKK 481
             GP +I  PLST+  W++ F ++APD+  + Y   Q    R ++ + +F+ + + +G  
Sbjct: 227 TGGPFLIAAPLSTLDTWVNEFSRFAPDIQVLKYYSTQGQSYRQSLLK-KFFKSTKGQG-- 283

Query: 482 TMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLIT 541
                V++T+YE I++D   + S +W+F+ VDE HR+KN    L   L      NR+LIT
Sbjct: 284 -----VVITSYEIIIRDIELILSYQWKFLIVDEGHRIKNINCKLIRELKRINTLNRLLIT 338

Query: 542 GTPLQNNIKELAALVNFLMPGRFTIDQEI-----DFEN--------------QDEEQEEY 582
           GT LQNN+ EL +L+NF+MP  F  D EI     DF +               DE ++  
Sbjct: 339 GTALQNNLSELWSLLNFIMPDIFA-DFEIFHKWFDFSDLELKSSSQGLNRLINDELEKNL 397

Query: 583 IHDLHRRIQPFILRRLKKDV-EKSLPSKTERILRVELSDVQTEYYKNIL----------- 630
           I +LH  ++PF+LRRLKK V   SLP K E I+   L+ VQ + YK+ L           
Sbjct: 398 ISNLHAILKPFLLRRLKKVVLAGSLPPKREYIVNCPLTSVQKKLYKSALNGKLKQAIFKQ 457

Query: 631 -TKNYSALTAGAKGG---------------------HFSLLNIMNELKKASNHPYLFDNA 668
             K++  L +   G                         +L  M++L K   H  L +  
Sbjct: 458 AIKDFFVLNSDQIGQVSNKSIRDFMEWKLNANDEDPDTEILQQMDKLYKQHIHRALLNKR 517

Query: 669 EER---VLQKFGDGKMT--------RENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIF 717
            +     L++  D  +          +  L  L+ SSGK+ +L QL+  L K GH+VLIF
Sbjct: 518 LQNPMVQLRQVVDSTLLFFFPFINPEKLTLDFLLQSSGKLQILQQLVPPLIKKGHKVLIF 577

Query: 718 SQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLG 777
           +Q V MLD++ D+  +  +   R+DG++ +  R+  I+ FN PD +   FL+STRAGGLG
Sbjct: 578 TQFVGMLDLIEDWCELNDVRVCRIDGSMGNETRQEHIERFNDPDDSFDAFLISTRAGGLG 637

Query: 778 INLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM 837
           INL  AD+V++FDSDWNPQ DLQA  R HRIGQ   V+VYRL   +T+E  +L RA  K 
Sbjct: 638 INLTAADSVILFDSDWNPQVDLQATDRTHRIGQTKPVIVYRLCCDNTIEHVILTRAASKR 697

Query: 838 ILEYAIISLG 847
            LE  +I LG
Sbjct: 698 KLEKMVIQLG 707

>KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, start by similarity
          Length = 826

 Score =  337 bits (864), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 214/591 (36%), Positives = 314/591 (53%), Gaps = 102/591 (17%)

Query: 366 VQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQN 425
           +QP F+K  +L+ +Q  G+NW+  L+  G NGILADEMGLGKT+Q++A +++ I+     
Sbjct: 187 MQPSFLKNCQLKPYQKEGLNWLITLYENGLNGILADEMGLGKTIQSIALLAF-IYEMDTK 245

Query: 426 GPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGN--QKSRDTIREYEFYTNPRAKGKKTM 483
           GP +I  PLST+  W++ F ++APD+  + Y  +  Q +R  +   +F+ N + +G    
Sbjct: 246 GPFLIAAPLSTVENWMNEFARFAPDIPVLKYYNSEGQAARHAMMG-KFFKNNKGEG---- 300

Query: 484 KFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGT 543
              V++T+YE I++D   + S +W+F+ VDE HRLKN    L   L     +NR+L+TGT
Sbjct: 301 ---VIITSYEIIIRDIELILSYQWKFLIVDEGHRLKNINCKLIRELKRINTSNRLLLTGT 357

Query: 544 PLQNNIKELAALVNFLMPGRFTIDQEI-----DFEN--------------QDEEQEEYIH 584
           PLQNN+ EL +L+NF++P  F+ D EI     DF +               DE ++  I 
Sbjct: 358 PLQNNLGELWSLLNFILPNIFS-DFEIFNKWFDFSDLNLESSSEKLTKIINDELEKNLIS 416

Query: 585 DLHRRIQPFILRRLKKDV-EKSLPSKTERILRVELSDVQTEYYKNIL------------T 631
           +LH  ++PF+LRRLKK+V   SLP K E I+   ++ +Q +YYK  L             
Sbjct: 417 NLHTILKPFLLRRLKKNVLAGSLPPKREYIITCPVTPLQKKYYKQALKGNLKQTIQKQAI 476

Query: 632 KNYSALTAGAKGG-------------------------------------HFSLL----- 649
           K++  L A   G                                      H  LL     
Sbjct: 477 KDFFTLNAEYIGTVSNKSIRDFIEWKLSADSQDIPNDNIGKMEKLYDMHIHKELLNKRLQ 536

Query: 650 NIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKK 709
           N+M +L++  N  YLF               +T EN+L+    +SGK+ +L +L+  L K
Sbjct: 537 NMMIQLRQIVNSTYLF------YFPLLEPTDLTLENLLK----TSGKLQVLQKLVPELIK 586

Query: 710 DGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLL 769
             H+VLIFSQ V MLD++ D+  +      R+DG++ +  R+  I+ F+   S   +FLL
Sbjct: 587 KKHKVLIFSQFVSMLDLIEDWSELNNFISCRIDGSMQNNSRKEQIEEFSKKGSKANLFLL 646

Query: 770 STRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEV 829
           STRA GLGINL  AD+V+IFDSDWNPQ DLQAM RAHRIGQ   V+VYRL   +T+E  +
Sbjct: 647 STRAAGLGINLTAADSVIIFDSDWNPQVDLQAMDRAHRIGQTKPVIVYRLYCDNTIENVI 706

Query: 830 LERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTAT 880
           + RA  K  LE  +I +G  +  K    NE         LK    ++ T T
Sbjct: 707 MTRAVNKRKLEKLVIQMGKFNTLKKLAFNE------QTFLKMNGSSLATTT 751

>CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, hypothetical start
          Length = 844

 Score =  334 bits (856), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 205/548 (37%), Positives = 299/548 (54%), Gaps = 77/548 (14%)

Query: 367 QPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNG 426
           QP ++K   L+ +Q+ G+NW+  L+  G NGILADEMGLGKT+Q++A +S+ I+     G
Sbjct: 210 QPSYLKNCVLKPYQMEGLNWLITLYENGLNGILADEMGLGKTIQSIALLSF-IYEMDTKG 268

Query: 427 PHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGN--QKSRDTIREYEFYTNPRAKGKKTMK 484
           P +I  PLST+  W++ F K+AP++  + Y     Q +R  + + +F+ N   +G     
Sbjct: 269 PFLIAAPLSTVDNWMNEFAKFAPEIPILKYYSQNGQDARQKLLK-KFFKNNNREG----- 322

Query: 485 FNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTP 544
             V++T+YE I++D   +   +W+F+ VDE HRLKN    L + L     +NR+L+TGTP
Sbjct: 323 --VIVTSYEMIIRDANIIMGEQWKFLIVDEGHRLKNINCRLIQELKRINTSNRLLLTGTP 380

Query: 545 LQNNIKELAALVNFLMPGRFTIDQEI-----DFEN--------------QDEEQEEYIHD 585
           LQNN+ EL +L+NF++P  F  D EI     DF++               DE ++  I +
Sbjct: 381 LQNNLSELWSLLNFILPDIFA-DFEIFNKWFDFKDLDLQSNSAKLNKLINDELEKNLISN 439

Query: 586 LHRRIQPFILRRLKKDVEKS-LPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGG 644
           LH  ++PF+LRRLK  V K  LP K E I+   LS +QT++Y+  L+             
Sbjct: 440 LHTILKPFLLRRLKSVVLKDVLPPKREYIVNCPLSPIQTKFYRMALSGKLKVTVFKELVK 499

Query: 645 HFSLLN--IMNELKKASNHPYL-FDNAEE-------RVLQKFGDGKM------TRENVLR 688
            F  LN   +  +   S   ++ +  +EE        V+++  D  M      T+   L+
Sbjct: 500 AFFTLNQEYIGTVSNKSIRDFIDYKLSEEPDEDKVTAVIKQMDDIYMEHLNTFTKNQRLQ 559

Query: 689 GLIM-----------------------------SSGKMVLLDQLLTRLKKDGHRVLIFSQ 719
            ++M                             SSGK+ +L +L   L K GH++LIFSQ
Sbjct: 560 NMMMQLRQVVDSTLLFFFPYMEPEDITLDYLLASSGKLQMLQKLAIPLIKKGHKILIFSQ 619

Query: 720 MVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGIN 779
            V MLD+L D+  +   N  R+DG V +  R+  ID FN    +  +FLLSTRA GLGIN
Sbjct: 620 FVGMLDLLEDWSELNSFNSLRIDGGVDNESRKEYIDEFNKKGDDHQIFLLSTRAAGLGIN 679

Query: 780 LMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMIL 839
           L+ ADTV+IFDSDWNPQ DLQAM R HRIGQ   V+VYR    +T+E  +L RA  K  L
Sbjct: 680 LVAADTVIIFDSDWNPQVDLQAMDRCHRIGQTKPVIVYRFCCDNTIEHVILTRAVNKRKL 739

Query: 840 EYAIISLG 847
           E  +I +G
Sbjct: 740 ERMVIQMG 747

>ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH]
           (508448..510862) [2415 bp, 804 aa]
          Length = 804

 Score =  313 bits (802), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 196/547 (35%), Positives = 290/547 (53%), Gaps = 77/547 (14%)

Query: 367 QPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNG 426
           QP  ++   L+ +Q+ G+NW+  L+  G NGILADEMGLGKT+Q++A +++ I+     G
Sbjct: 178 QPTLVRNCTLKPYQVEGVNWLITLYENGLNGILADEMGLGKTIQSIALLAF-IYEMDTRG 236

Query: 427 PHIIVVPLSTMPAWLDTFEKWAPDLNCICYM---GNQKSRDTIREYEFYTNPRAKGKKTM 483
           P ++  PLS +  W+  FEK+AP +  + Y    G  K    ++E  F+     +G    
Sbjct: 237 PFLVTAPLSVVDNWITEFEKFAPSIPVLKYYSADGPGKRHAILKE--FFRKNSGEG---- 290

Query: 484 KFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGT 543
              V++T+YE +++D   + S +W+F+ VDE HRLKN    L   L      NR+L+TGT
Sbjct: 291 ---VVVTSYEIVMRDMNVILSHQWKFLIVDEGHRLKNINCKLIRELKRINTFNRLLLTGT 347

Query: 544 PLQNNIKELAALVNFLMPGRFTIDQEI-----DFENQD--------------EEQEEYIH 584
           PLQNN+ EL +L+NF++P  F  D EI     DF + D              E ++  + 
Sbjct: 348 PLQNNLAELWSLLNFILPDVFA-DFEIFSKWFDFSDLDLKTSSQRWDKIIGEELEKNLVT 406

Query: 585 DLHRRIQPFILRRLKKDV-EKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKG 643
           +LH  ++PF+LRRLK+ V   +LP K E I+   L+ +QT +YK  L             
Sbjct: 407 NLHTILKPFLLRRLKRVVLADALPPKREYIINCPLTPLQTRFYKMALAGKLKRTVFTQAI 466

Query: 644 GHFSLLN---IMNELKKASNHPYLFDNAEERV--------LQKFGDG---KMTRENVLRG 689
             F  LN   I +   K       +  ++E +        ++K  +    K  R   L+ 
Sbjct: 467 KEFFTLNREHIGSVSNKTIREFIDYKTSDEEIQASKVITDMEKLYEQHIHKELRNKRLQN 526

Query: 690 LIMSSGKMV-----------------------------LLDQLLTRLKKDGHRVLIFSQM 720
           L+M   ++V                             +L QLL RL    H+VLIFSQ 
Sbjct: 527 LMMQLRQIVDSTFLFYFPYLKAEDLQLPVLLQTSGKLQILQQLLPRLLAAKHKVLIFSQF 586

Query: 721 VRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINL 780
           V MLD++ D+  +   +  R+DG++ +  RR  I+ F+   S   +FLLSTRAGGLGINL
Sbjct: 587 VSMLDLIEDWCELNNYSACRIDGSMDNETRREQINSFSEKGSPHSLFLLSTRAGGLGINL 646

Query: 781 MTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILE 840
             AD+V++FD+DWNPQ DLQAM R+HRIGQ++ V+VYRL    TVE  +L RA  K  LE
Sbjct: 647 TAADSVILFDNDWNPQVDLQAMDRSHRIGQQHPVIVYRLYCDKTVESVILARATNKRKLE 706

Query: 841 YAIISLG 847
             +I +G
Sbjct: 707 QLVIQMG 713

>Sklu_2125.3 YJR035W, Contig c2125 6474-9632
          Length = 1052

 Score =  270 bits (691), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 174/522 (33%), Positives = 263/522 (50%), Gaps = 70/522 (13%)

Query: 376 LRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLS 435
           L ++Q T + W+  L+ +   GI+ DEMGLGKT+Q ++F++ L  +   +GP +IV P +
Sbjct: 285 LFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQIISFLASLHHSGMLDGPILIVCPAT 344

Query: 436 TMPAWLDTFEKWAPDLNCICY------MGNQK--SRDTIREYEFYTNPR----------A 477
            M  W + F  W P    +        M N++  S D + E    +NP            
Sbjct: 345 VMKQWCNEFHTWWPPFRAVILHSIGSGMSNKEKLSEDRLEEMLMNSNPEEFSYVDYTDSK 404

Query: 478 KGKKTM--KFN-------------VLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAE 522
           K K TM  K N             VL+TTY  +     EL  +KW +  +DE H+++N +
Sbjct: 405 KTKSTMESKLNLTKLVDKVVNDGHVLITTYVGLRLHADELLKVKWGYAVLDEGHKIRNPD 464

Query: 523 SSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRF----TIDQEI-------D 571
           S +  +    K +NR++++GTP+QNN+ EL +L +F+ PGR        Q+         
Sbjct: 465 SDISLTCKQLKTSNRVILSGTPIQNNLTELWSLFDFIFPGRLGTLPVFQQQFAIPINMGG 524

Query: 572 FENQDEEQEEYIHD----LHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYK 627
           + N    Q +  +     L   I P++LRR+K DV K LP K E +L  +L+  Q   Y 
Sbjct: 525 YANATNIQVQTGYKCAVALRDLISPYLLRRVKTDVAKDLPKKNEMVLFCKLTQYQRNKYL 584

Query: 628 NILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVL 687
             L    S      K G   +L  ++ L+K  NHP +         + +GD K       
Sbjct: 585 QFLN---SGDLVKIKNGKRQVLYGIDILRKICNHPDILVRDMRHSEESYGDPK------- 634

Query: 688 RGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLS-----IKGINFQRLD 742
                 SGKM ++ QLL   K+ GH+ L+F+Q  +MLDIL  ++S     +  + + R+D
Sbjct: 635 -----RSGKMQVVKQLLKLWKEQGHKTLLFTQSRQMLDILEKFISYRDPELSSLTYLRMD 689

Query: 743 GTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAM 802
           GT   A R+  +D FN+   +  VFLL+TR GGLG+NL  A+ ++IFD DWNP  DLQA 
Sbjct: 690 GTTNIAARQHLVDKFNNELYD--VFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDLQAR 747

Query: 803 ARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 844
            RA RIGQK  V +YRL+   ++EE++  R   K  L   I+
Sbjct: 748 ERAWRIGQKREVTIYRLMIAGSIEEKIYHRQIFKQFLTNKIL 789

>CAGL0I01694g complement(141422..144637) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1071

 Score =  270 bits (691), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 171/523 (32%), Positives = 266/523 (50%), Gaps = 70/523 (13%)

Query: 376 LRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLS 435
           L ++Q TG+ W+  L+ +   GI+ DEMGLGKT+Q  AF++ L  +   +GP +IV P +
Sbjct: 297 LFNYQKTGVQWLYELFQQRRGGIIGDEMGLGKTIQVTAFLAALHHSNLLSGPVLIVCPAT 356

Query: 436 TMPAWLDTFEKWAPD-----LNCICYMGNQKSRDT-----------------IREYEFYT 473
            M  W +   +W P      L+ I    N KS  T                   +YE  +
Sbjct: 357 VMKQWCNEIHQWWPPFRAVILHSIGAGMNDKSNLTEDEIENMIIKSELENTDFHDYENAS 416

Query: 474 NPRAKGKKTMKF-----------NVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAE 522
             ++K +  M             ++++TTY  +     +L ++ W +  +DE H+++N +
Sbjct: 417 KLKSKVETGMHMQNLISKVVADGHIIITTYVGLRIHSDKLLNVNWSYCVLDEGHKIRNPD 476

Query: 523 SSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRF----TIDQEI-------D 571
           S +  +    K  NR++++GTP+QNN+ EL +L +F+ PGR        Q+         
Sbjct: 477 SEISLTCKKLKCKNRIILSGTPIQNNLVELWSLFDFIYPGRLGTLPVFQQQFVQPINMGG 536

Query: 572 FENQDEEQEEYIH----DLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYK 627
           + N    Q +  +     L   I P++LRR+K DV K LP K E +L  +L++ Q   Y 
Sbjct: 537 YANATNTQVQTGYRCAVALRDLISPYLLRRVKADVAKDLPKKKEMVLFCKLTEFQRRKYL 596

Query: 628 NILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVL 687
             L+   S   +  KGG   +L  ++ L+K  NHP L D    +    +GD K       
Sbjct: 597 EFLS---SDELSQIKGGKRHVLYGIDILRKICNHPDLLDRDYIKNTSGYGDPK------- 646

Query: 688 RGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIK-----GINFQRLD 742
                 SGKM ++ QLL   K +GH+ L+F+Q  +MLDIL +++  K      I + R+D
Sbjct: 647 -----RSGKMQVVKQLLKLWKSEGHKTLLFTQSRQMLDILEEFIKFKEPELSDIRYLRMD 701

Query: 743 GTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAM 802
           GT     R+  +D FN+   +  VFLL+TR GGLG+NL  A+ ++I+D DWNP  DLQA 
Sbjct: 702 GTTSIQVRQTLVDRFNNESYD--VFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDLQAR 759

Query: 803 ARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIIS 845
            RA RIGQK  V +YRL+   T+EE++  R   K  L   ++S
Sbjct: 760 ERAWRIGQKREVSIYRLMISGTIEEKIYHRQIFKQFLMNKVLS 802

>KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, start by similarity
          Length = 1048

 Score =  270 bits (690), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 182/530 (34%), Positives = 273/530 (51%), Gaps = 71/530 (13%)

Query: 375  ELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPL 434
            EL+D+Q TGINW+  L+    + ILADEMGLGKT Q ++F+++L      NGPH++VVP 
Sbjct: 501  ELKDYQQTGINWLHLLYQNDLSCILADEMGLGKTCQVISFLAYLK-QTHHNGPHLVVVPS 559

Query: 435  STMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEY 494
            ST+  WL  F K+ P L    Y G+Q+ R  +R+           +   +++V++TTY  
Sbjct: 560  STLENWLREFNKFCPHLKVEPYYGSQQERAELRDI--------LEENEGQYDVIVTTYNL 611

Query: 495  ILKDRAELGSIK---WQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKE 551
                + ++  ++   +  +  DE H LKN+ S  +  L       R+L+TGTPLQNN+KE
Sbjct: 612  AAGTKYDVSFLRNRNFDVVVYDEGHMLKNSMSERFNKLMKINAHFRLLLTGTPLQNNLKE 671

Query: 552  LAALVNFLMPGRF---------TIDQEIDFENQDEE-----QEEYIHDLHRRIQPFILRR 597
            L +L+ F+MP  F            Q+    + D+       E  I      ++PFILRR
Sbjct: 672  LMSLLEFIMPNLFVSKKDDLATVFKQKTRTSDADKGYNPLLAEHAIERAKTMMKPFILRR 731

Query: 598  LKKDVEKSLPSKTERILRVELSDVQTEYYKNILTK---NYSALTAGAKGGHFSL---LNI 651
             K  V K LP K   IL  E++++Q   Y+  + +   +   +  G K    S     N+
Sbjct: 732  KKDQVLKHLPRKHNHILHCEMTELQKTLYQQEIKQVMEHRRKIKEGVKMEKASRNVSKNL 791

Query: 652  MNELKKASNHPYLFDNA-EERVLQKF-------------GDGKMTRENV-------LRGL 690
            +  L+KAS HP LF +   ++++ K              G+ +  +E++       L  L
Sbjct: 792  IMALRKASIHPLLFRHIYNDKIISKMSKAIIAEPEYYENGNIEYIKEDMSYMTDFELHKL 851

Query: 691  I----------------MSSGKMVLLDQLLTRLKKDGH-RVLIFSQMVRMLDILGDYLSI 733
                             M+SGK+  L  +L ++    H +VL+FS   ++LDIL   LS 
Sbjct: 852  CCKFPSLYKFKLQSDEWMNSGKVEQLKSVLHKIIDIQHEKVLVFSLFTQVLDILEFVLST 911

Query: 734  KGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDW 793
              I F RLDG      R+  ID F   D+   VFLLST+AGG GINL+ A+ V+IFD  +
Sbjct: 912  LNIKFLRLDGQTQVNDRQSLIDRFYEDDTIP-VFLLSTKAGGFGINLVCANNVIIFDQSF 970

Query: 794  NPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 843
            NP  D QA  RAHR+GQ   V V  L+S+DT+EE++L  A+ K+ L+  I
Sbjct: 971  NPHDDRQAADRAHRVGQTKEVQVTTLISRDTIEEKILHLAKNKLALDTHI 1020

>Scas_549.4
          Length = 1079

 Score =  270 bits (689), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 170/523 (32%), Positives = 269/523 (51%), Gaps = 70/523 (13%)

Query: 376 LRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLS 435
           L ++Q T + W+  L+ +   GI+ DEMGLGKT+Q +AF++ L  +   NGP +IV P +
Sbjct: 304 LFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQIIAFLASLHHSGLLNGPVLIVCPAT 363

Query: 436 TMPAWLDTFEKWAPDLNCICY------MGNQK--SRDTIREYEFYTNP----------RA 477
            M  W +    W P L  I        M  +K  S + + +     NP          R+
Sbjct: 364 VMKQWCNELHHWWPPLRTIILHSTGSGMSTKKNFSEEELEQAMMNANPNELTCEDFQNRS 423

Query: 478 KGKKTMK--FNV-------------LLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAE 522
           K K +++  FN+             ++TTY  +     +L  + W +  +DE H+++N +
Sbjct: 424 KTKASLESTFNIQSLIDKVINDGHIIITTYVGLRIHSEQLLKVNWAYAVLDEGHKIRNPD 483

Query: 523 SSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRF----TIDQEI-------D 571
           S +  +    K  NR++++GTP+QNN+ EL +L +F+ PG+        Q+         
Sbjct: 484 SDISLTCKKIKTPNRIILSGTPIQNNLIELWSLFDFIYPGKLGTLPVFQQQFVMPINAGG 543

Query: 572 FEN----QDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYK 627
           + N    Q +   +    L   I P++LRR+K DV K LP K E +L  +L+  Q   Y 
Sbjct: 544 YANATNIQVQTGVKCATALRNLISPYLLRRVKSDVAKDLPEKKEMVLFCKLTQYQKNRYL 603

Query: 628 NILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVL 687
             L  N   LT   +GG   +L  ++ L+K  NHP L +  E +    +G+ K       
Sbjct: 604 EFLNSN--ELTQ-IRGGRRHVLYGIDILRKICNHPDLLEREERQYETDYGNPK------- 653

Query: 688 RGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKG-----INFQRLD 742
                 SGKM ++ QLL    K+GH+ L+F+Q  +MLDIL  ++  K      + + R+D
Sbjct: 654 -----RSGKMQVVKQLLLLWHKEGHKTLLFTQSRQMLDILEQFIQFKDSDLSVLKYLRMD 708

Query: 743 GTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAM 802
           GT   ++R+  +D FN+ D +  VFLL+TR GGLG+NL  A+ ++I+D DWNP  D+QA 
Sbjct: 709 GTSNISKRQGLVDQFNNEDYD--VFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDMQAR 766

Query: 803 ARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIIS 845
            RA RIGQK  V +YRL+   ++EE++  R   K  L   I++
Sbjct: 767 ERAWRIGQKREVSIYRLMVSGSIEEKIYHRQIFKQFLTNKILT 809

>ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH]
           (877337..880396) [3060 bp, 1019 aa]
          Length = 1019

 Score =  269 bits (687), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 187/537 (34%), Positives = 281/537 (52%), Gaps = 80/537 (14%)

Query: 375 ELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQN--GPHIIVV 432
           EL+D+Q TG+NW+  L+    + ILADEMGLGKT Q ++F+++L   + QN  GPH++VV
Sbjct: 470 ELKDYQQTGLNWINLLYQHNLSCILADEMGLGKTCQVISFLAYL---KEQNHTGPHLVVV 526

Query: 433 PLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTY 492
           P ST+  WL  F+K+ P L    Y G+Q+ R  +R+           +   +++ ++TTY
Sbjct: 527 PSSTLENWLREFKKFCPQLKIEPYYGSQQERAELRDI--------LEENDGQYDAIVTTY 578

Query: 493 EYILKDRAELGSIK-WQFMAV--DEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNI 549
                ++A++  +K  QF  V  DE H LKN+ S  +  L       R+L+TGTPLQNN+
Sbjct: 579 NLASGNKADVSFLKNRQFNVVIYDEGHMLKNSMSERFTKLMKIHANFRLLLTGTPLQNNL 638

Query: 550 KELAALVNFLMPGRFTIDQE-----------IDFENQDEE---QEEYIHDLHRRIQPFIL 595
           +EL +L+ F+MP  F   ++               N+D      +E I      ++PFIL
Sbjct: 639 RELMSLLEFIMPSLFVSKKDELAAVFKQRARTSDSNKDYNPLLAQEAIDRAKTIMKPFIL 698

Query: 596 RRLKKDVEKSLPSKTERILRVELSDVQTEYYK---NILTKNYSALTAGA---KGGHFSLL 649
           RR K  V K LP+K   I   +++  Q   Y     ++ ++   +  G      G  +L+
Sbjct: 699 RRRKDQVLKHLPAKHHHIEYCDMTPEQQAIYNREIRLVMEHRRMVRDGVLPTDAGERALV 758

Query: 650 ------NIMNELKKASNHPYLFDN---------AEERVLQK-----FGDGKMTRENV--- 686
                 N++  L+KA+ HP LF +           ER+L +      G+    RE++   
Sbjct: 759 AQSTSKNLIMALRKAAIHPLLFRHHYSDDRIAEMSERILAEPEYADSGNRDYIREDMSYM 818

Query: 687 ----LRGLI----------------MSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDI 726
               L  L                 M+SGK+  L  LL        + L+FS   ++LDI
Sbjct: 819 CDLELHRLCCRFPSLASFQLSEPTWMASGKVHRLQPLLRAAIARREKTLVFSLFTQVLDI 878

Query: 727 LGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTV 786
           L   LS  GI F RLDG+ P   R+  ID F++ D++  VFLLST+AGG GINL+ A+ V
Sbjct: 879 LELVLSSLGIAFLRLDGSTPVNDRQALIDRFHT-DTDVPVFLLSTKAGGFGINLVCANHV 937

Query: 787 VIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 843
           +IFD  +NP  D QA  RAHR+GQ   V V  LVS+ TVEE++L+ AR K+ L+ ++
Sbjct: 938 IIFDQSFNPHDDRQAADRAHRVGQTREVAVTTLVSRATVEEKILQLARHKLALDSSV 994

>YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase
           involved in transcription-coupled repair in some strain
           backgrounds, may have a role in chromatin remodeling,
           homolog of Cockayne syndrome B gene ERCC-6 [3258 bp,
           1085 aa]
          Length = 1085

 Score =  269 bits (688), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 175/526 (33%), Positives = 272/526 (51%), Gaps = 74/526 (14%)

Query: 376 LRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLS 435
           L ++Q T + W+  L+ +   GI+ DEMGLGKT+Q +AFI+ L  +    GP +IV P +
Sbjct: 297 LFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAALHHSGLLTGPVLIVCPAT 356

Query: 436 TMPAWLDTFEKWAPDLNCICY--MG-----NQK--------------SRDTIREYEFYTN 474
            M  W + F+ W P L  +    MG     +QK              S+ +   YE + N
Sbjct: 357 VMKQWCNEFQHWWPPLRTVILHSMGSGMASDQKFKMDENDLENLIMNSKPSDFSYEDWKN 416

Query: 475 PRAKGKKTMKF---------------NVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLK 519
              + KK ++                ++L+TTY  +     +L  +KWQ+  +DE H+++
Sbjct: 417 S-TRTKKALESSYHLDKLIDKVVTDGHILITTYVGLRIHSDKLLKVKWQYAVLDEGHKIR 475

Query: 520 NAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGR----------FTIDQE 569
           N +S +  +    K  NR++++GTP+QNN+ EL +L +F+ PG+          F I   
Sbjct: 476 NPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFVIPIN 535

Query: 570 ID-FENQDEEQEEYIHD----LHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTE 624
           I  + N    Q +  +     L   I P++LRR+K DV K LP K E +L  +L+  Q  
Sbjct: 536 IGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDLPQKKEMVLFCKLTKYQRS 595

Query: 625 YYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRE 684
            Y   L   +S+     + G  ++L  ++ L+K  NHP L D   +R    +GD K    
Sbjct: 596 KYLEFL---HSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDRDTKRHNPDYGDPK---- 648

Query: 685 NVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKG-----INFQ 739
                    SGKM ++ QLL    K G++ L+F+Q  +MLDIL +++S K      +N+ 
Sbjct: 649 --------RSGKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHLNYL 700

Query: 740 RLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADL 799
           R+DGT     R+  +D FN+   +  VFLL+TR GGLG+NL  A+ ++IFD DWNP  D+
Sbjct: 701 RMDGTTNIKGRQSLVDRFNNESFD--VFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDM 758

Query: 800 QAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIIS 845
           QA  RA RIGQK  V +YRL+   ++EE++  R   K  L   I++
Sbjct: 759 QARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILT 804

>Kwal_26.7123
          Length = 1081

 Score =  266 bits (680), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 183/545 (33%), Positives = 277/545 (50%), Gaps = 92/545 (16%)

Query: 376  LRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQN---GPHIIVV 432
            L+D+Q TGINW+  L+    + ILADEMGLGKT Q +AF+S+L    +QN   GPH++VV
Sbjct: 524  LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYL----KQNNEPGPHLVVV 579

Query: 433  PLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTY 492
            P ST+  WL  F K+ PDL    Y G+Q+ R  +R+     +         +++V++TTY
Sbjct: 580  PSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDG--------QYDVIVTTY 631

Query: 493  EYILKDRAELGSIK---WQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNI 549
                 ++ ++  +K   +  +  DE H LKN+ S  +  L   +   R+L+TGTPLQNN+
Sbjct: 632  NLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNL 691

Query: 550  KELAALVNFLMPGRFTIDQEIDF------------ENQDEE---QEEYIHDLHRRIQPFI 594
            KEL +L+ F+MP  F I ++ D              N+D      +E I      ++PFI
Sbjct: 692  KELMSLLEFIMPNLF-ISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKPFI 750

Query: 595  LRRLKKDVEKSLPSKTERILRVELSDVQTEYY----------KNILTKNYSALT------ 638
            LRR K  V K LP K  +I   E+SDVQ   Y          K +L +     +      
Sbjct: 751  LRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLREREEEGSAEEPRP 810

Query: 639  AGAKGGHFSLLNIMNELKKASNHPYLF--------------------------------- 665
                GG     N++  L+KA+ HP LF                                 
Sbjct: 811  TKKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQE 870

Query: 666  ------DNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTR-LKKDGHRVLIFS 718
                  D    R+  +F D  + +  +     M+SGK+  L ++L   ++    +VL+FS
Sbjct: 871  DMSYMNDFELHRLCTRFPDS-LAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFS 929

Query: 719  QMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGI 778
               +MLDIL   L+   INF RLDG+     R+  ID F+  D+   VF+LST+AGG GI
Sbjct: 930  LFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGGFGI 988

Query: 779  NLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMI 838
            NL+ A+ V+IFD  +NP  D QA  R+HR+GQ   V +  L++++++EE++L+ A+ K+ 
Sbjct: 989  NLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLA 1048

Query: 839  LEYAI 843
            L+  I
Sbjct: 1049 LDTYI 1053

>KLLA0E22726g complement(2018248..2021349) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1033

 Score =  265 bits (677), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 171/543 (31%), Positives = 270/543 (49%), Gaps = 70/543 (12%)

Query: 359 PRFEKLSVQPPFIKGGE----LRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAF 414
           P+    ++   F+  G+    L  +Q T + W+  L+ +G  GI+ DEMGLGKT+Q +AF
Sbjct: 244 PKISDANISEDFMVPGDIFPLLFPYQKTCVQWLCELYQQGCGGIIGDEMGLGKTIQIIAF 303

Query: 415 ISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICY------------------ 456
           ++ L  +R+ NGP ++V P + M  W + F  W P    +                    
Sbjct: 304 LATLHHSRKLNGPVLVVCPATVMKQWCNEFHTWWPPFRAVILHSIGAGMNKGTQIPEEEL 363

Query: 457 ----MGNQKSRDTIREYEFYTNPRA--KGKKTMK---------FNVLLTTYEYILKDRAE 501
               M +     T  +YE     R   + +K++K          ++++TTY  +      
Sbjct: 364 EKMLMTSNYGTFTYNDYEKKEKTRTSLESRKSVKKLLEKVITDGHIIITTYVGLRLHSEA 423

Query: 502 LGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMP 561
           L +++W +  +DE H+++N +S +  +    K  NR++++GTP+QNN+ EL +L +F+ P
Sbjct: 424 LLNVRWGYAILDEGHKIRNPDSDISLTCKQLKTQNRIILSGTPIQNNLTELWSLFDFVYP 483

Query: 562 GRF----TIDQEI-------DFENQDEEQEEYIHD----LHRRIQPFILRRLKKDVEKSL 606
           G+        Q+         + N    Q +  +     L   I P++LRR+K DV K L
Sbjct: 484 GKLGTLPVFQQQFANPINMGGYANASNIQVKTGYKCAVALRDLISPYLLRRVKSDVAKDL 543

Query: 607 PSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFD 666
           P K E +L  +L+  Q   Y   L   +S      + G   +L  ++ L+K  NHP L D
Sbjct: 544 PKKNEMVLFCKLTQYQKSKYLEFL---HSDELMKIRKGKRQVLYGIDILRKICNHPDLLD 600

Query: 667 NAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDI 726
                  +K  D     E+   G    SGKM ++ QLL      GH+ L+F+Q  +MLDI
Sbjct: 601 LKR----KKMND----YEDADYGNPARSGKMQVVKQLLLLWHSQGHKTLLFTQSRQMLDI 652

Query: 727 LGDYLSIKG-----INFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLM 781
           L +++S K      + F R+DGT     R+  +D FN+   +  VFLL+TR GGLGINL 
Sbjct: 653 LQEFISYKDPELSDLKFLRMDGTTNIGSRQSLVDKFNNEPYD--VFLLTTRVGGLGINLT 710

Query: 782 TADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEY 841
            A+ ++IFD DWNP  D+QA  RA RIGQK  V +YRL+   ++EE++  R   K  L  
Sbjct: 711 GANRIIIFDPDWNPSTDMQARERAWRIGQKREVTIYRLMIAGSIEEKIYHRQIFKQFLSN 770

Query: 842 AII 844
            I+
Sbjct: 771 KIL 773

>CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1, start by similarity
          Length = 1904

 Score =  268 bits (684), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 186/564 (32%), Positives = 286/564 (50%), Gaps = 81/564 (14%)

Query: 369  PFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNG-- 426
            P      LR +Q  GINW+AFL     +GIL D+MGLGKT+QT+  I+   + R++    
Sbjct: 1306 PVAIKATLRKYQQDGINWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRQEEYKL 1365

Query: 427  ---------PHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRA 477
                     P +IV P S    W + FE+++P L  + Y G    R  +R          
Sbjct: 1366 SGNIECRPLPSLIVCPPSLTGHWENEFEQYSPFLKIVVYAGGPSVRQPLR---------- 1415

Query: 478  KGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANR 537
              K+    ++++T+Y+    D   + S  + +  +DE H +KNA+S L +++   K  +R
Sbjct: 1416 --KQLSSADIIITSYDVARNDLDTISSYDYNYCVLDEGHLIKNAQSKLAKAVKLIKANHR 1473

Query: 538  MLITGTPLQNNIKELAALVNFLMPG----------RFT--IDQEIDFENQDEEQEE---Y 582
            +++TGTP+QNN+ EL +L +FLMPG          RF   I    + +   +EQE     
Sbjct: 1474 LILTGTPIQNNVVELWSLFDFLMPGFLGTEKSFQERFAKPIAASRNSKTSSKEQEAGALA 1533

Query: 583  IHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY-------KNILTKNYS 635
            +  LH+++ PF+LRRLK+DV   LP K  +    ELSD+Q + Y       KN++ K+  
Sbjct: 1534 LEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQKQLYEDFAKKQKNVVEKDIQ 1593

Query: 636  ALTAGAKGGHFSLLNIMNELKKASNHPYLF---DNAEERVLQKF-----GDGKMTRE--- 684
                     H  +   +  ++K  NHP L    D+ + + +Q +      D    R    
Sbjct: 1594 NTADVDSKQH--IFQALQYMRKLCNHPALVLSNDHPQLKQIQNYLKQTGCDLHDIRNAPK 1651

Query: 685  -NVLRGLIMSSG-------KMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYL---SI 733
               LR L+   G       K V  +QLLT      HR LIF Q+  MLD++ + L    +
Sbjct: 1652 LTALRTLLFECGIGEADMDKKVTGEQLLTGSVISQHRALIFCQLKDMLDMIENDLFKRYM 1711

Query: 734  KGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDW 793
              +++ RLDG+V    R+  +  FN   S D   LL+T+ GGLG+NL  ADTV+  + DW
Sbjct: 1712 PSVSYMRLDGSVDPRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDW 1770

Query: 794  NPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIIS-----LGV 848
            NP  DLQAM RAHR+GQK  V VYR+V+K T+EE+++   + KM +   +++     L  
Sbjct: 1771 NPMNDLQAMDRAHRLGQKKVVNVYRIVTKGTLEEKIMGLQKFKMNIASTVVNQQNSGLAS 1830

Query: 849  TDGNK----YTKKNEP--NAGELS 866
             D ++    +   N P  NAGE++
Sbjct: 1831 MDTHQLLDLFDTDNVPSNNAGEVA 1854

>CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, hypothetical start
          Length = 1126

 Score =  263 bits (673), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 185/541 (34%), Positives = 279/541 (51%), Gaps = 84/541 (15%)

Query: 376  LRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNG---PHIIVV 432
            L+D+Q TGINW+  L+    + ILAD+MGLGKT Q ++F+++L    +Q G   PH+IVV
Sbjct: 572  LKDYQQTGINWLNLLYHNQISCILADDMGLGKTCQVISFLAYL----KQIGQPSPHLIVV 627

Query: 433  PLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTY 492
            P ST+  WL  F+K+ P L    Y G Q+ R  +RE       R  GK    ++V++TTY
Sbjct: 628  PSSTLENWLREFQKFCPSLKIEPYYGTQQERADLREIL----ERNDGK----YDVIVTTY 679

Query: 493  EYILKDRAELGSIK---WQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNI 549
                 ++ ++  +K   +  +  DE H LKN+ S  +  L       R+L+TGTPLQNN+
Sbjct: 680  NLAAGNKYDVSFLKTRNFNVVVYDEGHMLKNSMSERFNKLMRIHANFRLLLTGTPLQNNL 739

Query: 550  KELAALVNFLMPGRFTIDQEI-------DFENQDEEQ-------EEYIHDLHRRIQPFIL 595
            KEL +L+ F+MP  F   +E          +  D+ +       ++ I      ++PFIL
Sbjct: 740  KELMSLLEFIMPNLFVSKKESLAAVFKQRAKTSDDNKGHNPLLAQQAITRAKTMMKPFIL 799

Query: 596  RRLKKDVEKSLPSKTERILRVELSDVQTEYYK---NILTKNYSALTAG---------AKG 643
            RR K  V K LP+K  R     ++D Q E Y     ++ ++   +  G         +K 
Sbjct: 800  RRRKDQVLKHLPAKHVRTSYCAMNDTQREIYNREVKLVMEHKQMIRDGTLPEDKKERSKI 859

Query: 644  GHFSLLNIMNELKKASNHPYLF----DNA----------EERVLQKFGDGKMTRENV--- 686
             + S  N++  L+KAS HP LF    D+A          +E    + G+ +  RE++   
Sbjct: 860  ENNSSKNLIMSLRKASIHPLLFRHIYDDAKIDKMCDAILDEPAYAENGNKEYIREDMSFM 919

Query: 687  ----LRGLI-----------------MSSGKMVLLDQLLTR-LKKDGHRVLIFSQMVRML 724
                L  L                  M+SGK+  L +LL   + K   +VLIF+   ++L
Sbjct: 920  TDFELHRLCCNFPNTLGDYQLKNDEWMNSGKVDALKKLLDDIINKKREKVLIFTLFTQVL 979

Query: 725  DILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTAD 784
            DIL   LS     F RLDG+     R+  ID F   D+   +F+LSTRAGG GINL+ A+
Sbjct: 980  DILEKVLSTLNYKFLRLDGSTQVNDRQTMIDKF-YDDNTIPIFMLSTRAGGFGINLVCAN 1038

Query: 785  TVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 844
             V+IFD  +NP  D QA  RAHR+GQ   V V  L++KD++EE++ + A+ K+ L+  + 
Sbjct: 1039 HVIIFDQSFNPHDDRQAADRAHRVGQTKEVTVTTLITKDSIEEKIFQLAKTKLALDSQVS 1098

Query: 845  S 845
            S
Sbjct: 1099 S 1099

>YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p family
            of DNA-dependent ATPases, involved in resistance to UV
            radiation [3396 bp, 1131 aa]
          Length = 1131

 Score =  261 bits (666), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 182/537 (33%), Positives = 277/537 (51%), Gaps = 80/537 (14%)

Query: 376  LRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLS 435
            L+D+Q TGINW+  L+    + ILAD+MGLGKT Q ++F ++L     + GPH++VVP S
Sbjct: 572  LKDYQQTGINWLNLLYQNKMSCILADDMGLGKTCQVISFFAYLK-QINEPGPHLVVVPSS 630

Query: 436  TMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYI 495
            T+  WL  F+K+AP L    Y G+ + R+ +R+       R  GK    ++V++TTY   
Sbjct: 631  TLENWLREFQKFAPALKIEPYYGSLQEREELRDIL----ERNAGK----YDVIVTTYNLA 682

Query: 496  LKDRAELGSIK---WQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKEL 552
              ++ ++  +K   +  +  DE H LKN+ S  +  L   +   R+L+TGTPLQNN+KEL
Sbjct: 683  AGNKYDVSFLKNRNFNVVVYDEGHMLKNSTSERFAKLMKIRANFRLLLTGTPLQNNLKEL 742

Query: 553  AALVNFLMPGRFTIDQEIDFE--------NQDEEQ-------EEYIHDLHRRIQPFILRR 597
             +L+ F+MP  F I ++  F+          D+ +       +E I      ++PFILRR
Sbjct: 743  MSLLEFIMPNLF-ISKKESFDAIFKQRAKTTDDNKNHNPLLAQEAITRAKTMMKPFILRR 801

Query: 598  LKKDVEKSLPSKTERILRVELSDVQTEYYK---NILTKNYSALTAG---------AKGGH 645
             K  V K LP K   I   EL+ +Q + Y     I+ ++   +  G         +K   
Sbjct: 802  RKDQVLKHLPPKHTHIQYCELNAIQKKIYDKEIQIVLEHKRMIKDGELPKDAKEKSKLQS 861

Query: 646  FSLLNIMNELKKASNHPYLFDNA-EERVLQKFGDGKMTR----ENVLRGLI--------- 691
             S  N++  L+KAS HP LF N   ++++ K  D  +      EN  +  I         
Sbjct: 862  SSSKNLIMALRKASLHPLLFRNIYNDKIITKMSDAILDEPAYAENGNKEYIKEDMSYMTD 921

Query: 692  ------------------------MSSGKMVLLDQLLTRLKKDGH-RVLIFSQMVRMLDI 726
                                    M SGK+  L +LL  +  D   +VLIFS   ++LDI
Sbjct: 922  FELHKLCCNFPNTLSKYQLHNDEWMQSGKIDALKKLLKTIIVDKQEKVLIFSLFTQVLDI 981

Query: 727  LGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTV 786
            L   LS     F RLDG+     R++ ID F   D +  +F+LST+AGG GINL+ A+ V
Sbjct: 982  LEMVLSTLDYKFLRLDGSTQVNDRQLLIDKFYE-DKDIPIFILSTKAGGFGINLVCANNV 1040

Query: 787  VIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 843
            +IFD  +NP  D QA  RAHR+GQ   V +  L++KD++EE++ + A+ K+ L+  I
Sbjct: 1041 IIFDQSFNPHDDRQAADRAHRVGQTKEVNITTLITKDSIEEKIHQLAKNKLALDSYI 1097

>AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH]
           (511520..514597) [3078 bp, 1025 aa]
          Length = 1025

 Score =  258 bits (659), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 174/554 (31%), Positives = 271/554 (48%), Gaps = 79/554 (14%)

Query: 375 ELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPL 434
           +L  +Q T + W+  L  +   GI+ DEMGLGKT+Q V+F++ L  + +  GP ++V P 
Sbjct: 262 KLFSYQKTCVQWLYELHQQNCGGIVGDEMGLGKTIQIVSFLASLHHSGKLKGPVLVVCPA 321

Query: 435 STMPAWLDTFEKWAPDLNCICY------MGNQKS-----------RDTIRE--YEFYTNP 475
           + M  W   F+ W P    +        M  +K            RD   E  YE Y N 
Sbjct: 322 TVMKQWCSEFQTWWPPFRAVILHSIGAGMITRKKMTEEQLEELLMRDESNEFSYEQYAN- 380

Query: 476 RAKGKKTMKF---------------NVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKN 520
             + KK ++                ++L+TTY  +      L  + W +  +DE H+++N
Sbjct: 381 LGRTKKQLEARRGIESLVQKVVDDGHILITTYLGLQIHSDLLLHVNWDYAVLDEGHKIRN 440

Query: 521 AESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRF----TIDQEI------ 570
            ++ +  +    +  +R++++GTP+QNN+ EL +L +F+ PG+        Q+       
Sbjct: 441 PDAGISLTCKRLRTPHRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFANPINA 500

Query: 571 -DFENQDEEQEEYIHD----LHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEY 625
             + N    Q +  +     L   I P++LRR+K DV K LP K E +L  +++  Q E 
Sbjct: 501 GGYANATNIQVQTGYKCAVALRDLISPYLLRRVKNDVAKDLPKKNEFVLFCKMTQFQKEK 560

Query: 626 YKNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTREN 685
           Y   L    S      K G   +L  ++ L+K  NHP L +    +    FGD +     
Sbjct: 561 YLQFLN---SEDMIKIKNGRRQVLYGIDILRKICNHPDLLERDFRKHEPSFGDPR----- 612

Query: 686 VLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLS-----IKGINFQR 740
                   SGKM ++ QLL   KK GH+ L+F+Q  +MLDIL  Y+S     + G+ + R
Sbjct: 613 -------RSGKMTVIKQLLLTWKKQGHKALLFTQSRQMLDILEAYISHKDPELAGLQYLR 665

Query: 741 LDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQ 800
           +DGT   A R+  +D FN+   +  +FLL+TR GGLG+NL  A+ ++IFD DWNP  DLQ
Sbjct: 666 MDGTTNIAHRQALVDRFNNGPYH--LFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDLQ 723

Query: 801 AMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEP 860
           A  RA RIGQK  V +Y L+   ++EE++  R   K  L   ++S       ++ K N  
Sbjct: 724 ARERAWRIGQKRDVTIYLLMVAGSIEEKIYHRQIFKQFLTNKVLS--DPKQKRFFKMN-- 779

Query: 861 NAGELSAILKFGAG 874
              EL  +  FG G
Sbjct: 780 ---ELHDLFSFGPG 790

>AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..161709)
            [5601 bp, 1866 aa]
          Length = 1866

 Score =  256 bits (655), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 175/531 (32%), Positives = 273/531 (51%), Gaps = 71/531 (13%)

Query: 369  PFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNG-- 426
            P      LR +Q  GINW+AFL     +GIL D+MGLGKT+QT+  I+   + R+++   
Sbjct: 1272 PVAIKATLRKYQQEGINWLAFLNHYHLHGILCDDMGLGKTLQTICIIASDQYLRQEDYKT 1331

Query: 427  ---------PHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRA 477
                     P +IV P S    W   FE++AP L  + Y G   +R  +R          
Sbjct: 1332 TKSVETRPLPSLIVCPPSLTGHWEQEFEQYAPFLTVLVYAGGPSTRYPLR---------- 1381

Query: 478  KGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANR 537
               K    ++++T+Y+    D   +    + +  +DE H +KN++S L +++ S +  +R
Sbjct: 1382 --GKLGDADIVVTSYDVARNDIDIISKHDYNYCVLDEGHIIKNSQSKLAKAVKSIRANHR 1439

Query: 538  MLITGTPLQNNIKELAALVNFLMPG----------RFT--IDQEIDFENQDEEQEE---Y 582
            +++TGTP+QNN+ EL +L +FLMPG          RF   I    + +   +EQE     
Sbjct: 1440 LILTGTPIQNNVVELWSLFDFLMPGFLGSEKAFQERFAKPIAASRNSKTSSKEQEAGALA 1499

Query: 583  IHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYK-------NILTKNY- 634
            +  LH+++ PF+LRRLK+DV   LP K  +    ELSD+Q + YK       NI+ ++  
Sbjct: 1500 LEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQRQLYKDFAKKQKNIVERDIE 1559

Query: 635  SALTAGAKGGHFSLLNIMNELKKASNHPYL--------FDNAEERVLQKFGD----GKMT 682
            + +   +K   F  L  M   +K  NHP L        ++  ++ + Q   D        
Sbjct: 1560 NTMELESKNHIFQALQYM---RKLCNHPSLVLSKDHPQYNQVQDYLSQTGMDIHDIAHAP 1616

Query: 683  RENVLRGLIMSSGKMVL-LDQLLTRLKKD-----GHRVLIFSQMVRMLDILGDYL---SI 733
            +   LR L++  G  V  +DQ    L         HR LIF Q+  MLD++ + L    +
Sbjct: 1617 KLGALRNLLLECGIGVQDVDQNSISLPSSENVISQHRALIFCQLKDMLDMIENDLFKKYL 1676

Query: 734  KGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDW 793
              + + RLDG+V S  R+  +  FN   S D   LL+T+ GGLG+NL  ADTV+  + DW
Sbjct: 1677 PSVTYMRLDGSVESRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFIEHDW 1735

Query: 794  NPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 844
            NP  DLQAM RAHR+GQK  V VYR+++K ++EE+++   + KM +   ++
Sbjct: 1736 NPMNDLQAMDRAHRLGQKKVVNVYRIITKGSLEEKIMGLQKFKMNIASTVV 1786

>KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1 transcriptional accessory
            protein, start by similarity
          Length = 1873

 Score =  254 bits (650), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 170/535 (31%), Positives = 269/535 (50%), Gaps = 79/535 (14%)

Query: 369  PFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNG-- 426
            P      LR +Q  G+NW+AFL     +GIL D+MGLGKT+QT+  I+   + R ++   
Sbjct: 1280 PVAIKATLRKYQQDGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRSEDYKK 1339

Query: 427  ---------PHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRA 477
                     P +I+ P S    W   F++++P LN + Y G    R  ++       P A
Sbjct: 1340 TQSEKTRPLPSLIICPPSLTGHWEQEFQQYSPTLNVLVYAGGPSVRYPLQGQV----PTA 1395

Query: 478  KGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANR 537
                    ++++T+Y+    D   L    + +  +DE H +KN++S L +++      +R
Sbjct: 1396 --------DIVVTSYDVARNDVDFLKKYDYNYCVLDEGHIIKNSQSKLAKAVKLINSNHR 1447

Query: 538  MLITGTPLQNNIKELAALVNFLMPG----------RFT--IDQEIDFENQDEEQEE---Y 582
            +++TGTP+QNN+ EL +L +FLMPG          RF   I    + +   +EQE     
Sbjct: 1448 LVLTGTPIQNNVVELWSLFDFLMPGFLGTEKMFQERFAKPIASSRNSKTSSKEQEAGALA 1507

Query: 583  IHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY-------KNILTKNYS 635
            +  LH+++ PF+LRRLK++V   LP K  +    ELSD+Q + Y       KN++ K+  
Sbjct: 1508 LEALHKQVLPFMLRRLKEEVLSDLPPKIIQDYYCELSDLQKQLYNDFVKKQKNVVEKDIE 1567

Query: 636  ALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGD------------GKMTR 683
                     H  +   +  ++K  NHP L  N+     Q+               G   +
Sbjct: 1568 NTAEVENKQH--IFQALQYMRKLCNHPSLVLNSSHPQFQQVQSYLSQTGMDLHDIGHAPK 1625

Query: 684  ENVLRGLIMSSG-----------KMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYL- 731
               L+ L++  G           K   +D ++++     HRVLIF Q+  MLD++ + L 
Sbjct: 1626 LEALKTLLLECGIGIQDVEKKSNKNPSIDNVISQ-----HRVLIFCQLKDMLDMVENDLL 1680

Query: 732  --SIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIF 789
               +  + F RLDG+V S  R+  +  FN   S D   LL+T+ GGLG+NL  ADTV+  
Sbjct: 1681 KKHLPSVTFMRLDGSVDSRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFV 1739

Query: 790  DSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 844
            + DWNP  DLQAM RAHR+GQK  V VYR+++K T+EE+++   + KM +   I+
Sbjct: 1740 EHDWNPMNDLQAMDRAHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTIV 1794

>YPL082C (MOT1) [5362] chr16 complement(398475..404078)
            Transcriptional Accessory Protein (TAF) involved in RNA
            polymerase II transcriptional repression through
            interaction with TATA-binding protein (TBP), member of
            the Snf2p family of DNA helicases [5604 bp, 1867 aa]
          Length = 1867

 Score =  253 bits (646), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 170/533 (31%), Positives = 271/533 (50%), Gaps = 73/533 (13%)

Query: 369  PFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNG-- 426
            P      LR +Q  G+NW+AFL     +GIL D+MGLGKT+QT+  I+   + R+++   
Sbjct: 1265 PIAIKATLRKYQQDGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRKEDYEK 1324

Query: 427  ---------PHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRA 477
                     P +I+ P S    W + F+++AP L  + Y G    R T+R       P+ 
Sbjct: 1325 TRSVESRALPSLIICPPSLTGHWENEFDQYAPFLKVVVYAGGPTVRLTLR-------PQL 1377

Query: 478  KGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANR 537
                    ++++T+Y+    D A L   ++ +  +DE H +KN++S L +++      +R
Sbjct: 1378 SDA-----DIIVTSYDVARNDLAVLNKTEYNYCVLDEGHIIKNSQSKLAKAVKEITANHR 1432

Query: 538  MLITGTPLQNNIKELAALVNFLMPG----------RFT--IDQEIDFENQDEEQEE---Y 582
            +++TGTP+QNN+ EL +L +FLMPG          RF   I    + +   +EQE     
Sbjct: 1433 LILTGTPIQNNVLELWSLFDFLMPGFLGTEKMFQERFAKPIAASRNSKTSSKEQEAGVLA 1492

Query: 583  IHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY-------KNILTKNY- 634
            +  LH+++ PF+LRRLK+DV   LP K  +    EL D+Q + Y       KN++ K+  
Sbjct: 1493 LEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELGDLQKQLYMDFTKKQKNVVEKDIE 1552

Query: 635  SALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGD----GKMTRENVLRGL 690
            ++  A  K   F  L  M   +K  NHP L  +     L +  D      +   +++   
Sbjct: 1553 NSEIADGKQHIFQALQYM---RKLCNHPALVLSPNHPQLAQVQDYLKQTGLDLHDIINAP 1609

Query: 691  IMSSGKMVLLDQLLTRLKKDG----------------HRVLIFSQMVRMLDILGDYLSIK 734
             +S+ + +L +  +     D                 HR LIF Q+  MLD++ + L  K
Sbjct: 1610 KLSALRTLLFECGIGEEDIDKKASQDQNFPIQNVISQHRALIFCQLKDMLDMVENDLFKK 1669

Query: 735  ---GINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDS 791
                + + RLDG++    R+  +  FN   S D   LL+T+ GGLG+NL  ADTV+  + 
Sbjct: 1670 YMPSVTYMRLDGSIDPRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEH 1728

Query: 792  DWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 844
            DWNP  DLQAM RAHRIGQK  V VYR+++K T+EE+++   + KM +   ++
Sbjct: 1729 DWNPMNDLQAMDRAHRIGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVV 1781

>Scas_664.9
          Length = 1859

 Score =  252 bits (644), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 173/533 (32%), Positives = 269/533 (50%), Gaps = 71/533 (13%)

Query: 369  PFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNG-- 426
            P      LR +Q  G+NW+AFL     +GIL D+MGLGKT+QT+  I+   + R ++   
Sbjct: 1260 PVAIKATLRKYQQDGVNWLAFLNKYRLHGILCDDMGLGKTLQTICIIASDQYLRAEDYKK 1319

Query: 427  ---------PHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRA 477
                     P +IV P S    W + FE++AP L  I Y G    R  +R+         
Sbjct: 1320 TNSVETRKLPSLIVCPPSLTGHWENEFEQYAPFLKIIVYAGGPSMRIPLRD--------- 1370

Query: 478  KGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANR 537
               +    ++++T+Y+    D + +    + +  +DE H +KNA+S L +++      +R
Sbjct: 1371 ---ELGSADIVITSYDVARNDLSIITKYDFNYCVLDEGHIIKNAQSKLAKAVKQISANHR 1427

Query: 538  MLITGTPLQNNIKELAALVNFLMPG----------RFT--IDQEIDFENQDEEQEE---Y 582
            +++TGTP+QNN+ EL +L +FLMPG          +F   I    + +   +EQE     
Sbjct: 1428 LILTGTPIQNNVVELWSLFDFLMPGFLGTEKMFQEKFAKPIAASRNSKTSSKEQEAGVLA 1487

Query: 583  IHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY-------KNILTKNYS 635
            +  LH+++ PF+LRRLK+DV   LP K  +    ELSD+Q + Y       KN++ K+  
Sbjct: 1488 LEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQKQLYQDFAKKQKNVVEKDIE 1547

Query: 636  ALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDG-KMT-----------R 683
              T      H  +   +  ++K  NHP L  +     L +  D  K T           +
Sbjct: 1548 NTTDTDNSQH--IFQALQYMRKLCNHPALVLSPNHPQLAQVQDYLKQTGIDLHDVINAPK 1605

Query: 684  ENVLRGLIMSSG-------KMVLLDQLLTRLKK-DGHRVLIFSQMVRMLDILGDYL---S 732
             N LR L+   G       +    +Q LT       HR LIF Q+  MLD++ + L    
Sbjct: 1606 LNALRTLLFECGIGEEDMERKSNPNQYLTGQNVISQHRALIFCQLKDMLDMVENDLFKRY 1665

Query: 733  IKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSD 792
            +  + + RLDG+V    R+  +  FN   S D   LL+T+ GGLG+NL  ADTV+  + D
Sbjct: 1666 MPSVTYMRLDGSVDPRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHD 1724

Query: 793  WNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIIS 845
            WNP  DLQAM RAHR+GQK  V VYR+++K T+EE+++   + KM +   +++
Sbjct: 1725 WNPMNDLQAMDRAHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVVN 1777

>Scas_548.4
          Length = 1054

 Score =  249 bits (635), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 178/536 (33%), Positives = 269/536 (50%), Gaps = 78/536 (14%)

Query: 376  LRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLS 435
            L+D+Q TGINW+  L+    + ILAD+MGLGKT Q ++F ++L     + GPH++VVP S
Sbjct: 496  LKDYQQTGINWLNLLYHNQMSCILADDMGLGKTCQVISFFAYLK-QINEPGPHLVVVPSS 554

Query: 436  TMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYI 495
            T+  WL  F+K+ P L    Y G+Q  R  +RE       R  G+    ++V++TTY   
Sbjct: 555  TLENWLREFQKFCPTLKIEPYYGSQNERADLREIL----ERTAGQ----YDVIVTTYNLA 606

Query: 496  LKDRAELGSIK---WQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKEL 552
              ++ ++  ++   +  +  DE H LKN+ S  +  L   +   R+L+TGTPLQNN++EL
Sbjct: 607  AGNKYDVSFLRNRQFNVVVYDEGHMLKNSMSERFNKLMRIQGNFRLLLTGTPLQNNLREL 666

Query: 553  AALVNFLMPGRFTIDQEI-------DFENQDEEQ-------EEYIHDLHRRIQPFILRRL 598
             +L+ F+MP  F   +E          +  D+ +       +E I      ++PFILRR 
Sbjct: 667  MSLLEFIMPALFISKKESLASVFKQRAKTTDDNKGHNPLLVQEAIERAKTMMKPFILRRR 726

Query: 599  KKDVEKSLPSKTERILRVELSDVQTEYY----KNILTKNYSALTAG--------AKGGHF 646
            K  V K LP+K  +I    + D+Q + Y    K ++      L           AK    
Sbjct: 727  KDQVLKHLPAKHHKIEYCIMQDLQRKIYDSEIKTVMEHKKMILDGTLPDDPKERAKIQSS 786

Query: 647  SLLNIMNELKKASNHPYLFDNAEERVL------------QKFGDGK----------MTRE 684
            S  N++  L+KA+ HP LF       L            Q   DG           MT  
Sbjct: 787  SSSNLIMTLRKAALHPLLFRTIYNDALIAKMSKAIINEPQYKVDGNIEFIKEDMSVMTDF 846

Query: 685  NVLRGLI----------------MSSGKMVLLDQLLTRLK-KDGHRVLIFSQMVRMLDIL 727
             + R  +                M+SGK+  L +LL  +  +   +VLIFS   ++LDIL
Sbjct: 847  ELHRLCLNFPNTLSRYQLKNKEWMNSGKVDTLCRLLKEIIFERKEKVLIFSLFTQVLDIL 906

Query: 728  GDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVV 787
               LS     F RLDG+     R+  ID F   D+   +F+LST+AGG GINL+ A+ V+
Sbjct: 907  ELVLSELNYKFLRLDGSTQVNDRQSLIDKFYEDDTIP-IFILSTKAGGFGINLVCANNVI 965

Query: 788  IFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 843
            IFD  +NP  D QA  RAHR+GQ   V +  L++KD++EE++ + A+ K+ L+  I
Sbjct: 966  IFDQSFNPHDDRQAADRAHRVGQTKEVNITTLITKDSIEEKIFQLAKNKLALDSHI 1021

>Scas_668.18
          Length = 875

 Score =  235 bits (599), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 155/481 (32%), Positives = 251/481 (52%), Gaps = 41/481 (8%)

Query: 398 ILADEMGLGKTVQTVAFISWLIFARRQNGPH-----IIVVPLSTMPAWLDTFEKW-APD- 450
           I+ADEMGLGKT+Q +A + W +  +   G       IIV P S +  W +   KW  P  
Sbjct: 309 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGT 367

Query: 451 LNCICYMGNQKS----RDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIK 506
           L+ +   G + S      T+ E   ++  +A G+  +K  VL+ +YE + ++  +L +  
Sbjct: 368 LSPLAVDGKKSSLASGNSTVAE-AVHSWAQATGRNIVK-PVLIISYETLRRNVDQLRNCD 425

Query: 507 WQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTI 566
              M  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL+NF  PG    
Sbjct: 426 VGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGT 485

Query: 567 DQEI------------DFENQDEE---QEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTE 611
             E             D ++ DEE    EE +  L   +  FI+RR    + K LP K E
Sbjct: 486 RSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLPCKYE 545

Query: 612 RILRVELSDVQTEYYKNIL-TKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEE 670
            ++ V L   Q + Y  +L +++ + +  G  G     L  +  LKK  NHP L +  EE
Sbjct: 546 HVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQ--PLKAIGVLKKLCNHPNLINLDEE 603

Query: 671 RVLQKFGDGKMTRENVLRG------LIMSSGKMVLLDQLLTRLKKDGH-RVLIFSQMVRM 723
             +  F D ++  E  ++G          SGK  +L++ L ++K +   ++++ S   + 
Sbjct: 604 --IDDFDDLEIPDEYNMQGSKSRDVQPQFSGKFAILERFLHKIKTESDDKIVLISNYTQT 661

Query: 724 LDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTA 783
           LD++      K  +  RLDGT+   +R+  +D FN P+  +F+FLLS++AGG GINL+ A
Sbjct: 662 LDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGA 721

Query: 784 DTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 843
           + +++ D DWNP AD QA+AR  R GQK    +YR +S  ++EE++ +R   KM L   +
Sbjct: 722 NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCV 781

Query: 844 I 844
           +
Sbjct: 782 V 782

>Kwal_34.16082
          Length = 726

 Score =  232 bits (591), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 151/479 (31%), Positives = 238/479 (49%), Gaps = 70/479 (14%)

Query: 376 LRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLS 435
           L ++Q T + W+  L+ +   GI+ DEMGLGKT+Q +AF++ L  + + +GP +IV P +
Sbjct: 263 LFNYQKTCVQWLYELFQQQCGGIIGDEMGLGKTIQIIAFLASLHHSGKLDGPVLIVCPAT 322

Query: 436 TMPAWLDTFEKWAPDLNCICYM---GNQKSRDTIRE----------------YEFYTNPR 476
            +  W   F  W P    +           +DTI E                Y+ Y + +
Sbjct: 323 VLRQWCKEFHTWWPPFRTVILHSIGAGMTQKDTISEEKLEELFMNSNPEELSYDAYMDSK 382

Query: 477 ----------AKGKKTMKF----NVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAE 522
                     A+ K   K     ++L+TTY  +      L +++W +  +DE H+++N +
Sbjct: 383 RTKSTLESGMARSKLINKVVSEGHILITTYVGLRIHADNLLNVRWSYAVLDEGHKIRNPD 442

Query: 523 SSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGR----------FTIDQEI-D 571
           + +  +    K  NR++++GTP+QNN+ EL +L +F+ PGR          F+I   +  
Sbjct: 443 ADISLTCKKLKTKNRIILSGTPIQNNLTELWSLFDFIYPGRLGTLPVFQQQFSIPINVGG 502

Query: 572 FENQDEEQEEYIHD----LHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYK 627
           + N    Q +  +     L   I P++LRR+K DV K LP K E +L  +L+  Q   Y 
Sbjct: 503 YANATNIQVQTGYKCAIALRNLISPYLLRRIKADVAKDLPKKNEMVLFCKLTQFQRRKYL 562

Query: 628 NILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVL 687
             L  N   LT   K G   +L  ++ L+K  NHP L +  +      +GD K       
Sbjct: 563 QFL--NSEDLTK-IKNGKRQVLFGIDILRKICNHPDLLEKDKRENESSYGDPK------- 612

Query: 688 RGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIK-----GINFQRLD 742
                 SGKM ++ QLL      GH+ L+F+Q  +MLDIL  ++S K      + + R+D
Sbjct: 613 -----RSGKMQVVKQLLRLWHSQGHKTLLFTQSRQMLDILEKFISYKDPELEDLTYLRMD 667

Query: 743 GTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQA 801
           GT     R+  +D FN+   +  VFLL+TR GGLG+NL  A+ ++IFD DWNP  D+QA
Sbjct: 668 GTTNIGSRQALVDSFNNGLYD--VFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQA 724

>KLLA0A03069g complement(271516..274203) similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54 DNA-dependent
           ATPase of the SNF2P family, start by similarity
          Length = 895

 Score =  230 bits (587), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 150/479 (31%), Positives = 249/479 (51%), Gaps = 36/479 (7%)

Query: 398 ILADEMGLGKTVQTVAFISWLIF-----ARRQNGPHIIVVPLSTMPAWLDTFEKW-AP-D 450
           I+ADEMGLGKT+Q +A + W +       RR     IIV P S +  W +  +KW  P  
Sbjct: 329 IMADEMGLGKTLQCLALM-WTMLKQGPQGRRSIDKCIIVCPSSLVNNWANEIDKWLGPGS 387

Query: 451 LNCICYMGNQKSRDTIREYEFYTN-PRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQF 509
           L+ +   G + S +     +  ++   A+G+  +K  VL+ +Y+ + ++  +L + +   
Sbjct: 388 LSSLAIDGKKSSLNNGNVADSVSHWASAQGRNIVK-PVLIISYDTLRRNVEQLKNCEVGL 446

Query: 510 MAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPG------- 562
           M  DE HRLKNA+S  + +L+S +   R++++GTP+QN++ E  AL+NF  PG       
Sbjct: 447 MLADEGHRLKNADSLTFTALDSIRCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGSRND 506

Query: 563 -----RFTIDQEIDFENQDEE---QEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERIL 614
                   I Q  D    DEE    ++ +  L   +  FI+RR    + K LP K E ++
Sbjct: 507 FRKNFELPILQSRDSLATDEEVTLGKDRLRQLSNIVSKFIIRRTNNILAKYLPCKYEHVI 566

Query: 615 RVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFD------NA 668
            + L+  Q   Y++ +     A+    KG     L  +  LKK  NHP L +       +
Sbjct: 567 FINLTPFQQSLYQHFIESR--AVKKIVKGDSNQPLKAIGLLKKLCNHPDLLELSEDIPGS 624

Query: 669 EERVLQKFGDGKMTRENVLRGLIMS--SGKMVLLDQLLTRLKKDGH-RVLIFSQMVRMLD 725
           EE +   +     +R +  R +I +  S K  +L + L ++K + + ++++ S   + LD
Sbjct: 625 EELIPDDYQSSVDSRTSRNRSVIQTAFSSKFSVLARFLYKIKTESNDKIVLISNYTQTLD 684

Query: 726 ILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADT 785
           ++            RLDGT+   +R+  +D FN P+  +F+FLLS++AGG GINL+ A+ 
Sbjct: 685 LIEKMCFSNHYGVLRLDGTMNINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANR 744

Query: 786 VVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 844
           +++ D DWNP AD QA+AR  R GQK    +YR +S  T+EE++ +R   KM L   ++
Sbjct: 745 LILLDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV 803

>AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH]
           complement(83368..86055) [2688 bp, 895 aa]
          Length = 895

 Score =  230 bits (586), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 159/487 (32%), Positives = 249/487 (51%), Gaps = 50/487 (10%)

Query: 398 ILADEMGLGKTVQTVAFISWLIFARRQNGP----HIIVVPLSTMPAWLDTFEKW-APD-L 451
           I+ADEMGLGKT+Q +A +  L+    Q  P     IIV P S +  W +   KW  PD L
Sbjct: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386

Query: 452 NCICYMGNQKS------RDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSI 505
           + +   G + S        ++R++       A+G+  +K  VL+ +YE + ++   L   
Sbjct: 387 SPLAIDGRKSSLSNGSVAQSVRQWAI-----AQGRNVVK-PVLIISYETLRRNVENLKGC 440

Query: 506 KWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPG--- 562
           K   M  DE HRLKN +S  + SL+S     R++++GTP+QN++ E  AL+NF  PG   
Sbjct: 441 KVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 500

Query: 563 ---RFTIDQEI------DFENQDEE---QEEYIHDLHRRIQPFILRRLKKDVEKSLPSKT 610
              +F  + EI      D +  D+E    E  +H+L + +  FI+RR    + K LP K 
Sbjct: 501 TRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKY 560

Query: 611 ERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEE 670
           E IL V LS +Q   Y++ +     A     KG     L  +  LKK  NHP L D  +E
Sbjct: 561 EHILFVNLSPMQKAIYEHFVRSREVAKLM--KGTGSQPLKAIGLLKKLCNHPDLLDLPDE 618

Query: 671 -----RVLQKFGDGKMTRENVLRG-------LIMSSGKMVLLDQLLTRLKKDGH-RVLIF 717
                 ++       MT  +  RG           S K  +L++ L ++K + + ++++ 
Sbjct: 619 IAGSTNLIPDDYQSAMTHNS--RGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLI 676

Query: 718 SQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLG 777
           S   + LD++            RLDGT+   +R+  +D FN P   +F+FLLS++AGG G
Sbjct: 677 SNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCG 736

Query: 778 INLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM 837
           INL+ A+ +++ D DWNP AD QA+AR  R GQK    +YR ++  ++EE++ +R   KM
Sbjct: 737 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKM 796

Query: 838 ILEYAII 844
            L   ++
Sbjct: 797 SLSSCVV 803

>Kwal_14.1537
          Length = 842

 Score =  224 bits (570), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 148/481 (30%), Positives = 234/481 (48%), Gaps = 40/481 (8%)

Query: 398 ILADEMGLGKTVQTVAFISWLIFARRQNGP----HIIVVPLSTMPAWLDTFEKWA----- 448
           I+ADEMGLGKT+Q +A +  L+    Q  P     IIV P S +  W +   KW      
Sbjct: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419

Query: 449 ---PDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSI 505
              P       + N      +R +       A+G+  +K  VL+ +YE + ++   L + 
Sbjct: 420 ASLPIDGKKSSLNNGTVAQAVRGWAL-----ARGRSVVK-PVLIISYETLRRNVEHLNNC 473

Query: 506 KWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFT 565
           +   +  DE HRLKNAES  + +L+S     R++++GTP+QN++ E  AL+NF  PG   
Sbjct: 474 EIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 533

Query: 566 IDQEI--DFEN----------QDEE---QEEYIHDLHRRIQPFILRRLKKDVEKSLPSKT 610
              E   +FEN           D E     E +  L   +  FI+RR    + K LP K 
Sbjct: 534 TRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKY 593

Query: 611 ERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLF----- 665
           E +L V L   Q   Y+ +L      L           L  +  LKK  NHP L      
Sbjct: 594 EHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQLPED 653

Query: 666 -DNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGH-RVLIFSQMVRM 723
            + +E+ + + + +  +++          SGK  +L++ L ++K +   +++I S   + 
Sbjct: 654 VEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQT 713

Query: 724 LDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTA 783
           LD++            RLDGT+   +R+  +D FN  +  +F+FLLS++AGG GINL+ A
Sbjct: 714 LDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGA 773

Query: 784 DTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 843
           + +++ D DWNP AD QA+AR  R GQK    +YR +   T+EE++ +R   KM L   +
Sbjct: 774 NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSLSSCV 833

Query: 844 I 844
           +
Sbjct: 834 V 834

>ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH]
           complement(1244005..1248465) [4461 bp, 1486 aa]
          Length = 1486

 Score =  224 bits (571), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 123/333 (36%), Positives = 189/333 (56%), Gaps = 38/333 (11%)

Query: 361 FEKLSVQ----PPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFIS 416
            EKLSV     PP ++G  LR +Q  G+NW+A L++   NGILADEMGLGKT+QT+A ++
Sbjct: 653 LEKLSVVDVPVPPLLRGT-LRTYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTIALLA 711

Query: 417 WLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPR 476
           +L   +   GPH+I+VP S +  W   F+++AP    + Y G+ + R            R
Sbjct: 712 YLACEKENWGPHLIIVPTSVLLNWEMEFKRFAPGFKVLSYYGSPQQR---------KEKR 762

Query: 477 AKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVAN 536
               K   F+V +T+Y+ ++ D+      KWQ+M +DEAH +KN +S+ +++L +F    
Sbjct: 763 RGWNKLDAFHVCITSYQLVVHDQHSFKRKKWQYMILDEAHNIKNFKSTRWQALLNFNTRR 822

Query: 537 RMLITGTPLQNNIKELAALVNFLMP------GRFTIDQEIDFENQ--------------- 575
           R+L+TGTPLQNNI EL +L+ FLMP      G+ +   ++D   Q               
Sbjct: 823 RLLLTGTPLQNNIAELWSLLYFLMPQTALENGKISGFADLDAFQQWFGKPVDKIIAANDS 882

Query: 576 --DEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKN 633
             D+E    +  LH+ ++P++LRRLK DVEK +P+K E IL   LS  Q   Y + +++ 
Sbjct: 883 EHDDETRRTVSKLHQVLRPYLLRRLKADVEKQMPAKYEHILYCRLSKRQRFLYDDFMSRA 942

Query: 634 YSALTAGAKGGHFSLLNIMNELKKASNHPYLFD 666
            +  T  A G   S++N + +L+K  NHP LF+
Sbjct: 943 QTKATL-ASGNFMSIINCLMQLRKVCNHPDLFE 974

 Score =  147 bits (371), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 99/154 (64%), Gaps = 1/154 (0%)

Query: 694  SGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRIS 753
             GK+  L  LL RLK++GHR LIF+QM ++LDIL  +L+  G  + RLDG      R+I 
Sbjct: 1216 CGKLQSLAVLLRRLKEEGHRALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQIL 1275

Query: 754  IDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNH 813
             + FN+ D    VF+LS+R+GGLGINL  ADTV+ +DSDWNP  D Q   R HRIGQ   
Sbjct: 1276 TERFNT-DPRITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1334

Query: 814  VMVYRLVSKDTVEEEVLERARKKMILEYAIISLG 847
            V +YR  S+ T+E  +L++A +K  L+  +I  G
Sbjct: 1335 VHIYRFASEHTIESNILKKANQKRQLDNIVIQKG 1368

>YGL163C (RAD54) [1826] chr7 complement(193711..196407)
           DNA-dependent ATPase of the Snf2p family, required for
           mitotic recombination and DNA repair of X-ray damage
           [2697 bp, 898 aa]
          Length = 898

 Score =  221 bits (562), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 152/481 (31%), Positives = 243/481 (50%), Gaps = 41/481 (8%)

Query: 398 ILADEMGLGKTVQTVAFISWLIFARRQNGPH-----IIVVPLSTMPAWLDTFEKW-APD- 450
           I+ADEMGLGKT+Q +A + W +  +   G       IIV P S +  W +   KW  P+ 
Sbjct: 332 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNT 390

Query: 451 LNCICYMGNQKSR---DTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKW 507
           L  +   G + S    +T      +   +A+G+  +K  VL+ +YE + ++  +L +   
Sbjct: 391 LTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVK-PVLIISYETLRRNVDQLKNCNV 449

Query: 508 QFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTID 567
             M  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL++F  PG     
Sbjct: 450 GLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSR 509

Query: 568 QEI--DFEN----------QDEE---QEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTER 612
            E   +FEN           D+E    E  +  L   +  FI+RR    + K LP K E 
Sbjct: 510 AEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEH 569

Query: 613 ILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERV 672
           ++ V L  +Q E Y N L K+          G    L  +  LKK  NHP L +  +E  
Sbjct: 570 VIFVNLKPLQNELY-NKLIKSREVKKVVKGVGGSQPLRAIGILKKLCNHPNLLNFEDEFD 628

Query: 673 LQKFGD--------GKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGH-RVLIFSQMVRM 723
            +   +        G   R+   +     S K  +L++ L ++K +   ++++ S   + 
Sbjct: 629 DEDDLELPDDYNMPGSKARDVQTK----YSAKFSILERFLHKIKTESDDKIVLISNYTQT 684

Query: 724 LDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTA 783
           LD++      K  +  RLDGT+   +R+  +D FN P+  +F+FLLS++AGG GINL+ A
Sbjct: 685 LDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGA 744

Query: 784 DTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 843
           + +++ D DWNP AD QA+AR  R GQK    +YR +S  T+EE++ +R   KM L   +
Sbjct: 745 NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCV 804

Query: 844 I 844
           +
Sbjct: 805 V 805

>CAGL0I04224g complement(369858..372686) highly similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54, start by
           similarity
          Length = 942

 Score =  220 bits (561), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 151/479 (31%), Positives = 245/479 (51%), Gaps = 37/479 (7%)

Query: 398 ILADEMGLGKTVQTVAFISWLIFARRQNGPH-----IIVVPLSTMPAWLDTFEKW-APD- 450
           I+ADEMGLGKT+Q +A + W +  +   G       IIV P S +  W +   KW  P+ 
Sbjct: 376 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNT 434

Query: 451 LNCICYMGNQKS--RDTIREYEFYTN-PRAKGKKTMKFNVLLTTYEYILKDRAELGSIKW 507
           L+ +   G + S         E   N  +A+G+  +K  VL+ +Y+ + ++  +L + + 
Sbjct: 435 LSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVK-PVLIISYDTLRRNVKQLQNTEV 493

Query: 508 QFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTID 567
             +  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL+NF  PG     
Sbjct: 494 GLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 553

Query: 568 QEI--DFE-------------NQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTER 612
            E   +FE             N  +  E+ +  L   +  FI+RR    + K LP K E 
Sbjct: 554 NEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEH 613

Query: 613 ILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERV 672
           ++ V L+  Q + Y N+L K+          G    L  +  LKK  NHP L    EE  
Sbjct: 614 VIFVNLTPFQKQVY-NMLIKSRDIKKVVKGDGGSQPLKAIGVLKKLCNHPDLIKLDEE-- 670

Query: 673 LQKFGDGKMTRENVL-----RGL-IMSSGKMVLLDQLLTRLKKDGH-RVLIFSQMVRMLD 725
           L  + D  +  +  +     R +    SGK  +L++ L ++K +   ++++ S   + LD
Sbjct: 671 LDNYNDLDIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLD 730

Query: 726 ILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADT 785
           ++      +     RLDGT+   +R+  +D FN P+  +F+FLLS++AGG GINL+ A+ 
Sbjct: 731 LIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANR 790

Query: 786 VVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 844
           +++ D DWNP AD QA+AR  R GQK    +YR +S  T+EE++ +R   KM L   ++
Sbjct: 791 LILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV 849

>CAGL0M01188g complement(132330..136682) similar to sp|Q05471
           Saccharomyces cerevisiae YDR334w, start by similarity
          Length = 1450

 Score =  223 bits (567), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 129/371 (34%), Positives = 202/371 (54%), Gaps = 45/371 (12%)

Query: 340 NRENSKILPQYSSNYTSQRPRFEKLSVQ---PPFIKGGELRDFQLTGINWMAFLWSKGDN 396
           + E S + P  ++N        + L+VQ    P +  G LR +Q  G+NW+A L++   N
Sbjct: 597 DNEKSDLFPADTTN--------DPLAVQDVPTPSLLRGTLRTYQKQGLNWLASLYNNNTN 648

Query: 397 GILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICY 456
           GILADEMGLGKT+QT++ +S+L   +   GPH+IVVP S +  W   F+++AP    + Y
Sbjct: 649 GILADEMGLGKTIQTISLLSYLACEKHNWGPHLIVVPTSVLLNWEMEFKRFAPGFKVLTY 708

Query: 457 MGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAH 516
            GN + R   R  + +  P A       F+V + +Y+ I++D+      KWQ+M +DEAH
Sbjct: 709 YGNPQQRKEKR--KGWNKPDA-------FHVCIVSYQLIVQDQHSFKRKKWQYMVLDEAH 759

Query: 517 RLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEID----- 571
            +KN  S+ +++L +F    R+L+TGTPLQNNI EL +L+ FLMP      Q++      
Sbjct: 760 NIKNFRSTRWQALLNFNTQRRILLTGTPLQNNIAELWSLLYFLMPQTVIDGQKVSGFADL 819

Query: 572 --FEN-----------------QDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTER 612
             F+                  QD E +  +  LH+ ++P++LRRLK DVEK +P K E 
Sbjct: 820 DAFQQWFGRPVDKLIETGGTYEQDNETKRTVEKLHQVLRPYLLRRLKADVEKQIPGKYEH 879

Query: 613 ILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERV 672
           I+  +LS  Q   Y + +++  +  T  A G   S++N + +L+K  NHP LF+    + 
Sbjct: 880 IVYCKLSKRQRFLYDDFMSRAQTKATL-ASGNFMSIVNCLMQLRKVCNHPDLFEVRPIKT 938

Query: 673 LQKFGDGKMTR 683
              FG+  + R
Sbjct: 939 SFLFGESVIAR 949

 Score =  147 bits (372), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 103/167 (61%), Gaps = 1/167 (0%)

Query: 690  LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQ 749
            L    GK+  L  LL +LK  GHR LIF+QM ++LDIL  +L+  G  + RLDG      
Sbjct: 1173 LQYDCGKLQKLAILLQQLKDGGHRALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIED 1232

Query: 750  RRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIG 809
            R+I  + FNS D    VF+LS+R+GGLGINL  ADTV+ +DSDWNP  D Q   R HRIG
Sbjct: 1233 RQILTERFNS-DPKITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIG 1291

Query: 810  QKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTK 856
            Q   V +YR VS+ T+E  +L++A +K  L+  II  G    + ++K
Sbjct: 1292 QTRDVHIYRFVSEHTIESNILKKANQKRQLDDVIIQKGEFTTDYFSK 1338

>AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH]
           complement(1426843..1431087) [4245 bp, 1414 aa]
          Length = 1414

 Score =  221 bits (562), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 122/333 (36%), Positives = 203/333 (60%), Gaps = 30/333 (9%)

Query: 363 KLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFAR 422
           +++++ P I    L+++QL G+NW+A L+ +G NGILADEMGLGKTVQ+++ ++ L  A 
Sbjct: 642 EITIEQPKILACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHL--AE 699

Query: 423 RQN--GPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGK 480
           R N  GP I+V P ST+  W++  +K+ PD   + Y GN   R  +R   F+     +  
Sbjct: 700 RYNIWGPFIVVTPASTLHNWVNEIQKFVPDFKILPYWGNGNDRKILR--RFWDRKHLRYS 757

Query: 481 KTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLI 540
           K   F+V++T+Y+ I+ D A L  +KWQ+M +DEA  +K+++SS +++L SF   NR+L+
Sbjct: 758 KDAPFHVMITSYQMIVSDAAYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLL 817

Query: 541 TGTPLQNNIKELAALVNFLMPGRFTIDQEI-DFENQDEEQ---------EEYIHDLHRRI 590
           TGTP+QN+++EL AL++F+MP  F    E  D+ ++D E          ++ +  LH  +
Sbjct: 818 TGTPIQNSMQELWALLHFIMPSLFDSHDEFNDWFSKDIESHAQSNTQLNQQQLRRLHMIL 877

Query: 591 QPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY---KNILTKNYSAL------TAGA 641
           +PF+LRR+KK+V+  L  K E  +  +L+  Q + Y   K+ ++ +Y A+      ++G 
Sbjct: 878 KPFMLRRIKKNVQSELGDKIEIDVMCDLTHRQAKLYQVLKSQVSASYDAIENAASNSSGD 937

Query: 642 KGGHFSL-----LNIMNELKKASNHPYLFDNAE 669
             G+ SL     +N + E +K  NHP LF+ A+
Sbjct: 938 DSGNMSLSDSKIMNTVMEFRKVCNHPDLFERAD 970

 Score =  153 bits (387), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 79/166 (47%), Positives = 107/166 (64%), Gaps = 1/166 (0%)

Query: 690  LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQ 749
             I  S K+  LD+LL RLK   HRVLI+ QM RM+D++ +YL+ +     RLDG+     
Sbjct: 1235 FITESAKLKKLDELLVRLKAGEHRVLIYFQMTRMMDLIEEYLTYRQYKHIRLDGSSKLED 1294

Query: 750  RRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIG 809
            RR  + H     S+ F+FLLSTRAGGLGINL +ADTV+ +DSDWNP  D QAM RAHR+G
Sbjct: 1295 RR-DLVHDWQTKSDIFIFLLSTRAGGLGINLTSADTVIFYDSDWNPTIDSQAMDRAHRLG 1353

Query: 810  QKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYT 855
            Q   V VYRL+ K T+EE + +RA++K  ++  ++     + N  T
Sbjct: 1354 QTKQVTVYRLLIKGTIEERMRDRAKQKEHVQQVVMEGKTKENNVQT 1399

>Scas_646.3*
          Length = 1456

 Score =  221 bits (562), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 129/376 (34%), Positives = 212/376 (56%), Gaps = 42/376 (11%)

Query: 322 ENATDIVKLAPEQVK-HFQNRENSKILPQYSSNYTSQR--PRFEKLSVQP---PFIKGGE 375
           E++ D V   PE +    +  +  ++LP  +    S++  P  ++LSV     P +  G 
Sbjct: 584 EDSDDFVMSEPESITPASETPDKGELLPNEAGAENSEQVVPNEQQLSVVDVPVPSLLRGT 643

Query: 376 LRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLS 435
           LR +Q  G+NW+A L++   NGILADEMGLGKT+QT++ +++L   ++  GPH+IVVP S
Sbjct: 644 LRTYQKQGLNWLASLFNNNTNGILADEMGLGKTIQTISLLAYLACEKQNWGPHLIVVPTS 703

Query: 436 TMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYI 495
            +  W   F+++ P L  + Y G+ + R   R  + +  P A       F+V + +Y+ +
Sbjct: 704 VLLNWEMEFKRFCPGLKVLTYYGSPQQRKEKR--KGWNKPDA-------FHVCIVSYQLV 754

Query: 496 LKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAAL 555
           ++D+      KWQ+M +DEAH +KN  S+ +++L +F    R+L+TGTPLQNN+ EL +L
Sbjct: 755 VQDQHSFKRKKWQYMVLDEAHNIKNFRSTRWQALLNFNTRRRLLVTGTPLQNNLAELWSL 814

Query: 556 VNFLMP----------------------GRFTIDQEIDF---ENQDEEQEEYIHDLHRRI 590
           + FLMP                      GR  +D+ I+      QD E ++ +  LH+ +
Sbjct: 815 LYFLMPQTVIDGKKVSGFADLDAFQQWFGR-PVDKLIETGAGYQQDAETKKTVSKLHQVL 873

Query: 591 QPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLN 650
           +P++LRRLK DVEK +P+K E I+   LS  Q   Y + ++++ +  T  A G   S++N
Sbjct: 874 RPYLLRRLKADVEKQMPAKYEHIVYCRLSKRQRFLYDDFMSRSQTKATL-ASGNFMSIVN 932

Query: 651 IMNELKKASNHPYLFD 666
            + +L+K  NHP LF+
Sbjct: 933 CLMQLRKVCNHPDLFE 948

 Score =  147 bits (372), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 75/167 (44%), Positives = 104/167 (62%), Gaps = 1/167 (0%)

Query: 690  LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQ 749
            L    GK+  L +LL  LK +GHR LIF+QM ++LD+L  +L+  G  + RLDG      
Sbjct: 1184 LQYDCGKLQKLAKLLQDLKDNGHRALIFTQMTKVLDVLERFLNYHGYIYMRLDGATKVED 1243

Query: 750  RRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIG 809
            R+I  + FN+ D    VF+LS+R+GGLGINL  ADTV+ +DSDWNP  D Q   R HRIG
Sbjct: 1244 RQILTERFNN-DPRVTVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIG 1302

Query: 810  QKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTK 856
            Q   V +YR VS+ T+E  +L++A +K  L+  +I  G    + +TK
Sbjct: 1303 QTRDVHIYRFVSEHTIESNILKKANQKRQLDNVVIQRGGFHYDYFTK 1349

>Scas_669.20
          Length = 1397

 Score =  220 bits (560), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 116/321 (36%), Positives = 191/321 (59%), Gaps = 17/321 (5%)

Query: 364 LSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARR 423
           ++++ P +    L+++QL G+NW+A L+ +G NGILADEMGLGKTVQ+++ ++ L     
Sbjct: 633 VTIEQPKMLACTLKEYQLKGLNWLASLYDQGINGILADEMGLGKTVQSISVLAHLAEKHN 692

Query: 424 QNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTM 483
             GP+++V P ST+  W++   K+ P    + Y GN   R  +R  +F+     +  K  
Sbjct: 693 IWGPYLVVTPASTLHNWVNEITKFVPQFKILPYWGNAADRKVLR--KFWDRKNLRYTKDS 750

Query: 484 KFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGT 543
            F+V++T+Y+ ++ D   L  +KWQ+M +DEA  +K+++SS +++L SF   NR+L+TGT
Sbjct: 751 PFHVMITSYQMVVSDVTYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGT 810

Query: 544 PLQNNIKELAALVNFLMPGRFTIDQEI------DFENQDEEQEEYIHD----LHRRIQPF 593
           P+QNN++EL AL++F+MP  F    E       D E+  E   +  H     LH  ++PF
Sbjct: 811 PIQNNMQELWALLHFIMPSLFDSHDEFSEWFAKDIESHAEANTQLNHQQLRRLHMILKPF 870

Query: 594 ILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNI-LTKNYSALTAGAKGGHFS----L 648
           +LRR+KK+V+  L  K E  +  +L+  Q + Y+ +  T NY A+   A    FS    L
Sbjct: 871 MLRRVKKNVQSELGDKIEIDVLCDLTQRQAKLYQVLKSTSNYDAIENAAGSDEFSSDQNL 930

Query: 649 LNIMNELKKASNHPYLFDNAE 669
           +N + + +K  NHP LF+ A+
Sbjct: 931 VNTVMQFRKVCNHPDLFERAD 951

 Score =  155 bits (391), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/167 (46%), Positives = 111/167 (66%), Gaps = 3/167 (1%)

Query: 690  LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQ 749
             I  S K+  LD+LL +LK++GHRVLI+ QM +M+D++ +YL+ +  N  RLDG+     
Sbjct: 1215 FITESAKLKKLDELLVQLKREGHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLED 1274

Query: 750  RRISIDHFNS-PDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRI 808
            RR  +  + + P+   FVFLLSTRAGGLGINL  ADTV+ +DSDWNP  D QAM RAHR+
Sbjct: 1275 RRDLVHDWQTKPEI--FVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRL 1332

Query: 809  GQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYT 855
            GQ   V VYRL+ + T+EE + +RA++K  ++  ++     + N  T
Sbjct: 1333 GQTRQVTVYRLLIRGTIEERMRDRAKQKEQVQQVVMEGKTQENNVKT 1379

>YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2p DNA
            helicase ATPase family [4545 bp, 1514 aa]
          Length = 1514

 Score =  220 bits (561), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 128/373 (34%), Positives = 208/373 (55%), Gaps = 43/373 (11%)

Query: 319  ATWENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQRPRFEKLSVQPPFIKGGELRD 378
            AT+E A D V    E      NR++ K + +  +    Q  +   + V  P +  G LR 
Sbjct: 646  ATFERAGDFVHTQNE------NRDDIKDVEE-DAETKVQEEQLSVVDVPVPSLLRGNLRT 698

Query: 379  FQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMP 438
            +Q  G+NW+A L++   NGILADEMGLGKT+QT++ +++L   +   GPH+IVVP S + 
Sbjct: 699  YQKQGLNWLASLYNNHTNGILADEMGLGKTIQTISLLAYLACEKENWGPHLIVVPTSVLL 758

Query: 439  AWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKD 498
             W   F+++AP    + Y G+ + R   R+   +  P A       F+V + +Y+ +++D
Sbjct: 759  NWEMEFKRFAPGFKVLTYYGSPQQRKEKRKG--WNKPDA-------FHVCIVSYQLVVQD 809

Query: 499  RAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNF 558
            +      +WQ+M +DEAH +KN  S+ +++L +F    R+L+TGTPLQNN+ EL +L+ F
Sbjct: 810  QHSFKRKRWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRLLLTGTPLQNNLAELWSLLYF 869

Query: 559  LMP----------------------GRFTIDQEIDFEN---QDEEQEEYIHDLHRRIQPF 593
            LMP                      GR  +D+ I+      QD+E ++ +  LH+ ++P+
Sbjct: 870  LMPQTVIDGKKVSGFADLDAFQQWFGR-PVDKIIETGQNFGQDKETKKTVAKLHQVLRPY 928

Query: 594  ILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMN 653
            +LRRLK DVEK +P+K E I+  +LS  Q   Y + +++  +  T  A G   S++N + 
Sbjct: 929  LLRRLKADVEKQMPAKYEHIVYCKLSKRQRFLYDDFMSRAQTKATL-ASGNFMSIVNCLM 987

Query: 654  ELKKASNHPYLFD 666
            +L+K  NHP LF+
Sbjct: 988  QLRKVCNHPNLFE 1000

 Score =  148 bits (374), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 75/167 (44%), Positives = 105/167 (62%), Gaps = 1/167 (0%)

Query: 690  LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQ 749
            L    GK+  L  LL +LK +GHR LIF+QM ++LD+L  +L+  G  + RLDG      
Sbjct: 1241 LQYDCGKLQKLAILLQQLKDNGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIED 1300

Query: 750  RRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIG 809
            R+I  + FN+ DS   VF+LS+R+GGLGINL  ADTV+ +DSDWNP  D Q   R HRIG
Sbjct: 1301 RQILTERFNT-DSRITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIG 1359

Query: 810  QKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTK 856
            Q   V +YR VS+ T+E  +L++A +K  L+  +I  G    + ++K
Sbjct: 1360 QTRDVHIYRFVSEHTIESNILKKANQKRQLDNVVIQEGDFTTDYFSK 1406

>KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471
            Saccharomyces cerevisiae YDR334w SWR1 DEAH-box protein,
            putative RNA helicase, hypothetical start
          Length = 1572

 Score =  218 bits (555), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 120/325 (36%), Positives = 188/325 (57%), Gaps = 34/325 (10%)

Query: 366  VQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQN 425
            V  P +  G LR +Q  G+NW+A L++   NGILADEMGLGKT+QT++ +++L   +   
Sbjct: 755  VPVPSLLRGTLRIYQKQGLNWLASLYNNKTNGILADEMGLGKTIQTISLLAYLACEKENW 814

Query: 426  GPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKF 485
            GPH+IVVP S +  W   F+++AP    + Y G+ + R   R  + +  P A       F
Sbjct: 815  GPHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRREKR--KGWNKPDA-------F 865

Query: 486  NVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPL 545
            +V +T+Y+ ++ D+      KWQ+M +DEAH +KN  S+ +++L +F    R+L+TGTPL
Sbjct: 866  HVCITSYQLVVHDQHSFKRKKWQYMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGTPL 925

Query: 546  QNNIKELAALVNFLMP------GRFTIDQEIDF----------------EN--QDEEQEE 581
            QNN+ EL +L+ FLMP      G+ +   ++D                 EN  QDEE ++
Sbjct: 926  QNNLAELWSLLYFLMPQTALENGKVSGFADLDAFQQWFGRPVDKIVETGENYEQDEETKK 985

Query: 582  YIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGA 641
             +  LH+ ++P++LRRLK DVEK +P K E I+   LS  Q   Y + +++  +  T  A
Sbjct: 986  TVSKLHQVLRPYLLRRLKADVEKQMPGKYEHIIYCRLSKRQRFLYDDFMSRAQTKETL-A 1044

Query: 642  KGGHFSLLNIMNELKKASNHPYLFD 666
             G   S++N + +L+K  NHP LF+
Sbjct: 1045 SGNFMSIINCLMQLRKVCNHPDLFE 1069

 Score =  156 bits (394), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 91/212 (42%), Positives = 121/212 (57%), Gaps = 10/212 (4%)

Query: 690  LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQ 749
            L    GK+  L QLL  LK +GHR LIF+QM ++LDIL  +L+  G  + RLDG      
Sbjct: 1305 LQYDCGKLQKLAQLLQNLKDNGHRALIFTQMTKVLDILEQFLNFHGYLYMRLDGATKIED 1364

Query: 750  RRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIG 809
            R+I  + FNS D    VF+LS+R+GGLGINL  ADTV+ +DSDWNP  D Q   R HRIG
Sbjct: 1365 RQILTERFNS-DPRITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIG 1423

Query: 810  QKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAIL 869
            Q   V +YR VS  T+E  +L++A +K  L+  +I  G    + +TK        LS   
Sbjct: 1424 QTRDVHIYRFVSDHTIESNILKKANQKRHLDNVVIQTGDFTTDYFTK--------LSVKD 1475

Query: 870  KFGAGNMFTATDNQKKLEDL-NLDDVLNHAED 900
              GA       D++  L+D  NL+ +L  AED
Sbjct: 1476 LLGAEAPEDIPDDKPLLQDQKNLNKLLAQAED 1507

>KLLA0F11814g complement(1089699..1092494) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54 required for
           mitotic diploid-specific recombination and repair and
           meiosis, start by similarity
          Length = 931

 Score =  214 bits (546), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 173/590 (29%), Positives = 274/590 (46%), Gaps = 101/590 (17%)

Query: 329 KLAPEQVKHFQNRENSKILPQYSSNYTSQ---RPRFEKLSVQPPFIK------------- 372
           K+ P Q +          LP  S     Q    P F+ +S++ P I              
Sbjct: 212 KVPPAQKQLVDQPTVKSALPPLSQELIGQITYSPLFDPVSIKDPLIMNKTENHKVSVIVD 271

Query: 373 ---GGELRDFQLTGINW-----MAFLWSKGDNG------------ILADEMGLGKTVQTV 412
                 LR  Q  G+ +     M  + +KGD              +LADEMGLGKT+ T+
Sbjct: 272 PLLSKTLRPHQREGVKFLYDCVMNMVHTKGDESMILERDDDIKGCLLADEMGLGKTLMTI 331

Query: 413 AFISWLIFAR-------RQNGPHI--------IVVPLSTMPAWLDTFEKWAPDLNCICYM 457
             I W +  +        Q G  +        IV P++ +  W   F+KW P +N I  +
Sbjct: 332 TLI-WTLLKQTPYPTIINQRGVTLAGEISKVLIVCPVTLIGNWKKEFKKWLP-MNRIGVL 389

Query: 458 G----NQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIK--WQFMA 511
                N  + D  +   F   PR        + VL+  YE +L  + EL + K     + 
Sbjct: 390 TLHSRNSPTEDKAQVRSFLKVPRT-------YQVLIVGYEKLLSIKDELQNEKRNLDLVI 442

Query: 512 VDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPG------RFT 565
            DE HRLKN +S + + L S  +  +++++GTP+QN+++E   +++F+ PG      RF 
Sbjct: 443 CDEGHRLKNKDSKILKVLQSLDIEKKIVLSGTPIQNDLEEFYTIIDFINPGILGSFGRFK 502

Query: 566 IDQEIDFE-----NQDEEQEEYIHDLHRRIQ------PFILRRLKKDVEKSLPSKTERIL 614
            +  +        N  + Q      L R  Q       FILRR  + +++ LP +T+ I+
Sbjct: 503 REYILPIARSRDVNAKQNQTLVEQGLLRSDQLIEITKRFILRRTNEILQQYLPPRTDLII 562

Query: 615 RVELSDVQTEYYKNILTK---NYSALTAGAKGGHFSLLN-IMNELKKASNHPYLFDNAEE 670
             + +  Q E +  ILT+   N+S +T  +  G  +L   I N  +     PY ++    
Sbjct: 563 FCKPTAEQVEAFHKILTEGQLNFSNMTFNSSLGLITLFKKICNSTRLIKTDPY-YEERLS 621

Query: 671 RVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLK-KDGHRVLIFSQMVRMLDILGD 729
           +V      GK T           SGK+ +L  LL  LK K   +V++ S   + LDI+  
Sbjct: 622 QVQTSSTSGKFT-----------SGKLRILLSLLHELKTKTDEKVVVISNYTQTLDIIEG 670

Query: 730 YLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIF 789
           + S +G    RLDG+  +  R   +  FN+ D + FVFLLS ++GG+G+NL+ A  +V+F
Sbjct: 671 HCSSEGYTSARLDGSTATKTRDQIVTSFNN-DPSIFVFLLSAKSGGVGLNLIGASRLVLF 729

Query: 790 DSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMIL 839
           D+DWNP  DLQAM+R HR GQ+    +YRLV+   ++E++L+R   K+ L
Sbjct: 730 DNDWNPSIDLQAMSRIHRDGQRRPCFIYRLVTTGCIDEKILQRQLMKIAL 779

>KLLA0E08965g complement(797861..802330) similar to sp|P53115
            Saccharomyces cerevisiae YGL150c INO80, hypothetical
            start
          Length = 1489

 Score =  217 bits (553), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 117/326 (35%), Positives = 197/326 (60%), Gaps = 23/326 (7%)

Query: 363  KLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFAR 422
            ++++  P +    L+++QL G+NW+A L+ +G NGILADEMGLGKTVQ+++ ++ L  A 
Sbjct: 733  EITIDQPKMLACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHL--AD 790

Query: 423  RQN--GPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGK 480
            R N  GP I+V P ST+  W++   ++ P    + Y GN   R T+R  +F+     +  
Sbjct: 791  RYNIWGPFIVVTPASTLHNWVNEISRFVPQFKILPYWGNANDRKTLR--KFWDRKHLRYG 848

Query: 481  KTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLI 540
            +   F+V++T+Y+ ++ D + L  +KWQ+M +DEA  +K+++SS +++L SF   NR+L+
Sbjct: 849  RDAPFHVMVTSYQMVVSDASYLQKMKWQYMILDEAQAIKSSQSSRWKTLLSFHCRNRLLL 908

Query: 541  TGTPLQNNIKELAALVNFLMPGR----------FTIDQEIDFENQDEEQEEYIHDLHRRI 590
            TGTP+QNN++EL AL++F+MP            F+ D E   E+  E  +E +  LH  +
Sbjct: 909  TGTPIQNNMQELWALLHFIMPSLFDSHDEFSDWFSKDIESHAESNTELNQEQLRRLHMVL 968

Query: 591  QPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY---KNILTKNYSALTAGAKGGHFS 647
            +PF+LRR+KK+V+  L  K E  +  +L+  Q + Y   K+ ++  Y A+   A     +
Sbjct: 969  KPFMLRRIKKNVQSELGDKIEIDVLCDLTFRQAKLYQVLKSQVSGGYDAIENAAGNDDVT 1028

Query: 648  ----LLNIMNELKKASNHPYLFDNAE 669
                L+N++ E +K  NHP LF+ A+
Sbjct: 1029 SDQKLVNLVMEFRKVCNHPDLFERAD 1054

 Score =  150 bits (380), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 106/156 (67%), Gaps = 3/156 (1%)

Query: 690  LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQ 749
             I  S K+  LD+LL +LK++ HRVLI+ QM +M+D++ +YL+ +     RLDG+     
Sbjct: 1314 FITESAKLKKLDELLVKLKEEDHRVLIYFQMTKMMDLMEEYLTYRQYTHIRLDGSSKLDD 1373

Query: 750  RRISIDHFNS-PDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRI 808
            RR  +  + + PD   F+FLLSTRAGGLGINL  ADTV+ +DSDWNP  D QAM RAHR+
Sbjct: 1374 RRDLVHDWQTKPDI--FIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRL 1431

Query: 809  GQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 844
            GQ   V VYRL+ + T+EE + +RA++K  ++  ++
Sbjct: 1432 GQTRQVTVYRLLIRGTIEERMRDRAKQKEHVQQVVM 1467

>YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of the
            Snf2p-like family of probable DNA helicases [4470 bp,
            1489 aa]
          Length = 1489

 Score =  217 bits (552), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 122/373 (32%), Positives = 209/373 (56%), Gaps = 27/373 (7%)

Query: 322  ENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQRP-RFEKLSVQPPFIKGGELRDFQ 380
            ENA++ +     + K F +  N+    +       Q P    +++++ P I    L+++Q
Sbjct: 651  ENASNALAETRAKAKQFDDHANAHEEEEEEDELNFQNPTSLGEITIEQPKILACTLKEYQ 710

Query: 381  LTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAW 440
            L G+NW+A L+ +G NGILADEMGLGKTVQ+++ ++ L       GP ++V P ST+  W
Sbjct: 711  LKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAENHNIWGPFLVVTPASTLHNW 770

Query: 441  LDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRA 500
            ++   K+ P    + Y GN   R  +R  +F+     +  K   F+V++T+Y+ ++ D  
Sbjct: 771  VNEISKFLPQFKILPYWGNANDRKVLR--KFWDRKNLRYNKNAPFHVMVTSYQMVVTDAN 828

Query: 501  ELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLM 560
             L  +KWQ+M +DEA  +K+++SS +++L SF   NR+L+TGTP+QN+++EL AL++F+M
Sbjct: 829  YLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNSMQELWALLHFIM 888

Query: 561  PGRFTIDQEI------DFENQDEE----QEEYIHDLHRRIQPFILRRLKKDVEKSLPSKT 610
            P  F    E       D E+  E      ++ +  LH  ++PF+LRR+KK+V+  L  K 
Sbjct: 889  PSLFDSHDEFNEWFSKDIESHAEANTKLNQQQLRRLHMILKPFMLRRVKKNVQSELGDKI 948

Query: 611  ERILRVELSDVQTEYY---KNILTKNYSAL-----------TAGAKGGHFSLLNIMNELK 656
            E  +  +L+  Q + Y   K+ ++ NY A+           +A   G   +L+N + + +
Sbjct: 949  EIDVLCDLTQRQAKLYQVLKSQISTNYDAIENAATNDSTSNSASNSGSDQNLINAVMQFR 1008

Query: 657  KASNHPYLFDNAE 669
            K  NHP LF+ A+
Sbjct: 1009 KVCNHPDLFERAD 1021

 Score =  155 bits (392), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 105/155 (67%), Gaps = 1/155 (0%)

Query: 690  LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQ 749
             I  S K+  LD+LL +LK +GHRVLI+ QM +M+D++ +YL+ +  N  RLDG+     
Sbjct: 1294 FITESAKLRKLDELLVKLKSEGHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLED 1353

Query: 750  RRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIG 809
            RR  + H    +   FVFLLSTRAGGLGINL  ADTV+ +DSDWNP  D QAM RAHR+G
Sbjct: 1354 RR-DLVHDWQTNPEIFVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLG 1412

Query: 810  QKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 844
            Q   V VYRL+ + T+EE + +RA++K  ++  ++
Sbjct: 1413 QTRQVTVYRLLVRGTIEERMRDRAKQKEQVQQVVM 1447

>CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces
            cerevisiae YGL150c INO80, hypothetical start
          Length = 1484

 Score =  215 bits (548), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 116/329 (35%), Positives = 197/329 (59%), Gaps = 24/329 (7%)

Query: 363  KLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFAR 422
            +++++ P +    L+++QL G+NW+A L+ +G NGILADEMGLGKTVQ+++ ++ L    
Sbjct: 709  EITIEQPKMLACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAEHH 768

Query: 423  RQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKT 482
               GP ++V P ST+  W++   K+ P    + Y G+   R  +R++    N R   K  
Sbjct: 769  NIWGPFLVVTPASTLHNWVNEISKFVPQFKILPYWGSANDRKVLRKFWDRKNLRYSEKSP 828

Query: 483  MKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITG 542
              F+V++T+Y+ ++ D + L  +KWQ+M +DEA  +K+++SS +++L SF   NR+L+TG
Sbjct: 829  --FHVMITSYQMVVADASYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTG 886

Query: 543  TPLQNNIKELAALVNFLMPGRFTIDQEI------DFENQDEE----QEEYIHDLHRRIQP 592
            TP+QNN++EL AL++F+MP  F    E       D E+  E      ++ +  LH  ++P
Sbjct: 887  TPIQNNMQELWALLHFIMPSLFDSHDEFNEWFSRDIESHAEGNSSLNQQQLRRLHMILKP 946

Query: 593  FILRRLKKDVEKSLPSKTERILRVELSDVQTEYY---KNILTKNYSAL-TAGAKGGHF-- 646
            F+LRR+KK+V+  L  K E  +  +L+  QT+ Y   K+ ++ NY A+  A A+G     
Sbjct: 947  FMLRRIKKNVQSELGDKIEIDVMCDLTQRQTKLYQVLKSQMSSNYDAIENAAAEGSDIAG 1006

Query: 647  ------SLLNIMNELKKASNHPYLFDNAE 669
                  S++N + + +K  NHP LF+ A+
Sbjct: 1007 GGNSDQSIINAVMQFRKVCNHPDLFERAD 1035

 Score =  157 bits (398), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 111/177 (62%), Gaps = 1/177 (0%)

Query: 690  LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQ 749
             I  S K+  LD+LL  LKK+ HRVLI+ QM +M+D++ +YL+ +  N  RLDG+     
Sbjct: 1290 FITESAKLKKLDELLVELKKNDHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLED 1349

Query: 750  RRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIG 809
            RR  + H    +   F+FLLSTRAGGLGINL  ADTV+ +DSDWNP  D QAM RAHR+G
Sbjct: 1350 RR-DLVHDWQTNPEIFIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLG 1408

Query: 810  QKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELS 866
            Q   V VYRL+ + T+EE + +RA++K  ++  ++     D N  T    P   +L+
Sbjct: 1409 QTKQVTVYRLLVRGTIEERMRDRAKQKEQVQQVVMEGKTKDTNIQTTHTRPEHEQLT 1465

>Kwal_55.20143
          Length = 1494

 Score =  215 bits (548), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 117/327 (35%), Positives = 186/327 (56%), Gaps = 34/327 (10%)

Query: 364 LSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARR 423
           + V  P +  G LR +Q  G+NW+A L++   NGILADEMGLGKT+QT++ +++L   + 
Sbjct: 659 VDVPTPSLLRGTLRIYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTISLLAYLACEKH 718

Query: 424 QNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTM 483
             GPH+I+VP S +  W   F+++AP    + Y G+ + R   R  + +  P A      
Sbjct: 719 NWGPHLIIVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRKEKR--KGWNRPDA------ 770

Query: 484 KFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGT 543
            F+V +T+Y+ ++ D+      KWQ+M +DEAH +KN  S+ +++L +F    R+L+TGT
Sbjct: 771 -FHVCITSYQLVVHDQHSFKRKKWQYMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGT 829

Query: 544 PLQNNIKELAALVNFLMP----------------------GRFT--IDQEIDFENQDEEQ 579
           PLQNN+ EL +L+ FLMP                      GR    I Q  +   QDEE 
Sbjct: 830 PLQNNLAELWSLLYFLMPQTAGTNGGIQGFADLEAFQQWFGRPVDKIIQTGEGYAQDEET 889

Query: 580 EEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA 639
            + +  LH+ ++P++LRRLK DVEK +P+K E ++   LS  Q   Y + +++  +  T 
Sbjct: 890 RKTVTKLHQVLRPYLLRRLKADVEKQMPAKHEHVVYCRLSKRQRFLYDDFMSRAQTKETL 949

Query: 640 GAKGGHFSLLNIMNELKKASNHPYLFD 666
            + G   S++N + +L+K  NHP LF+
Sbjct: 950 SS-GNFMSIINCLMQLRKVCNHPDLFE 975

 Score =  145 bits (365), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 72/158 (45%), Positives = 99/158 (62%), Gaps = 1/158 (0%)

Query: 690  LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQ 749
            L    GK+  L  LL  LK  GHR LIF+QM ++LD+L  +L+  G  + RLDG     +
Sbjct: 1212 LQYDCGKLQKLATLLRDLKNGGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEE 1271

Query: 750  RRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIG 809
            R+I  + FN+ D+    F+LS+R+GGLGINL  ADTV+ +DSDWNP  D Q   R HRIG
Sbjct: 1272 RQILTERFNT-DNRITAFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIG 1330

Query: 810  QKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLG 847
            Q   V +YR VS+ T+E  +L++A +K  L+  +I  G
Sbjct: 1331 QTRDVHIYRFVSEHTIESNILKKANQKRQLDNVVIQRG 1368

>Kwal_27.11388
          Length = 1334

 Score =  213 bits (542), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 121/353 (34%), Positives = 205/353 (58%), Gaps = 25/353 (7%)

Query: 363 KLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFAR 422
           ++++  P +    L+++QL G+NW+A L+ +G NGILADEMGLGKTVQ+++ ++ L    
Sbjct: 581 EITIDQPKLLTCTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAENY 640

Query: 423 RQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKT 482
              GP I+V P ST+  W++   K+ PD   + Y GN   R  +R   F+   + +  K 
Sbjct: 641 NIWGPFIVVTPASTLHNWVNEISKFLPDFKILPYWGNGNDRKILR--RFWDRKQFRYGKD 698

Query: 483 MKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITG 542
             F+V++T+Y+ ++ D A L  +KWQ+M +DEA  +K+++SS +++L SF   NR+L+TG
Sbjct: 699 APFHVMVTSYQMVVSDAAYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTG 758

Query: 543 TPLQNNIKELAALVNFLMPGRF-TIDQEIDFENQDEEQ---------EEYIHDLHRRIQP 592
           TP+QNN++EL AL++F+MP  F + D+  D+ ++D E          ++ +  LH  ++P
Sbjct: 759 TPIQNNMQELWALLHFIMPSLFDSHDEFSDWFSKDIESHAQSNTKLNQQQLRRLHMILKP 818

Query: 593 FILRRLKKDVEKSLPSKTERILRVELSDVQTEYY---KNILTKNYSALTAGAKGGHFS-- 647
           F+LRR+KK+V+  L  K E  +  +L+  Q + Y   K+ ++  Y A+   A     S  
Sbjct: 819 FMLRRIKKNVQSELGEKIEIDVMCDLTRRQHKLYQVLKSQMSAAYDAIENAAGSDEASSD 878

Query: 648 --LLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMV 698
             ++N + + +K  NHP LF+  + R    F D   +      G I+  G M+
Sbjct: 879 QNIVNTVMQFRKVCNHPDLFEREDVRSPFAFTDFGRS------GSILREGGMI 925

 Score =  149 bits (377), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 105/156 (67%), Gaps = 3/156 (1%)

Query: 690  LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQ 749
             I  S K+  LD+LL  LKK+ HRVLI+ QM +M+D++ +YLS +     RLDG+     
Sbjct: 1165 FITESTKLKKLDELLVNLKKNDHRVLIYFQMTKMMDLMEEYLSFRQYKHIRLDGSSKLED 1224

Query: 750  RRISIDHFNS-PDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRI 808
            RR  +  + + P+   F+FLLSTRAGGLGINL  ADTV+ +DSDWNP  D QAM RAHR+
Sbjct: 1225 RRDLVHDWQTKPEI--FIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRL 1282

Query: 809  GQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 844
            GQ   V VYRL+ + T+EE + +RA++K  ++  ++
Sbjct: 1283 GQTRQVTVYRLLIRGTIEERMRDRAKQKEQVQQVVM 1318

>Scas_718.40
          Length = 926

 Score =  203 bits (517), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 154/497 (30%), Positives = 253/497 (50%), Gaps = 60/497 (12%)

Query: 398 ILADEMGLGKTVQTVAFISWLI--------FARRQNGPHI--------IVVPLSTMPAWL 441
           +LADEMGLGKT+ T+  I  L+         A  Q+G  +        +V P++ +  W 
Sbjct: 305 LLADEMGLGKTLMTITLIWTLLKQSPSLKNIACSQSGVPLHGLCRKILVVCPVTLIGNWK 364

Query: 442 DTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAE 501
             F KW  +LN I  +    SR+T    +       + ++T  F VL+  YE +L    E
Sbjct: 365 REFAKWL-NLNRIGIL-TLSSRNTPEMDKTAVKNFLRVQRT--FQVLVIGYEKLLSVSEE 420

Query: 502 LGSIK--WQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFL 559
           L   +     +  DE HRLKN  S +   L + ++  ++L++GTP+QN++ E   +++FL
Sbjct: 421 LHGSRDLIDLLICDEGHRLKNGSSKVLNVLKNLEIKRKILLSGTPIQNDLNEFYTIIDFL 480

Query: 560 MPG----------RFT--IDQEIDFENQDEE--------QEEYIHDLHRRIQPFILRRLK 599
            PG          RF   I +  D EN+  E        + + + D+ R+   F LRR  
Sbjct: 481 NPGILGSYPYFKKRFIAPITRGRDTENRHNEDIIELGEGRSKEMIDITRK---FTLRRTN 537

Query: 600 KDVEKSLPSKTERILRVELSDVQTEYYKNILTK---NYSALTAGAKGGHFSLLNIMNELK 656
             + K LP KT+ IL  + +  Q   + +IL++   +++ L+  +  G  +L       K
Sbjct: 538 AILSKYLPPKTDIILFCKPTQSQLLAFNDILSRSRIDFANLSFNSSLGLITLF------K 591

Query: 657 KASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLK--KDGHRV 714
           K  N P L  +      +   DG + +E   R L  +SGK+ +L  LL ++K   +  +V
Sbjct: 592 KICNSPTLIGDDSYYQSKIRPDG-VIQERYDRSL--NSGKLKILMTLLEKIKGNTNNEKV 648

Query: 715 LIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAG 774
           +I S   + LDI+ + ++   +   RLDG+ P+ QR   ++ FN  + + F FLLS ++G
Sbjct: 649 VIVSNYTQTLDIIQNLMNSAQMVSCRLDGSTPAKQRDSIVNTFNR-NPSIFAFLLSAKSG 707

Query: 775 GLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERAR 834
           G+G+NL+ A  +++FD+DWNP  DLQAM+R HR GQK H  +YRL++   ++E++L+R  
Sbjct: 708 GVGLNLIGASRLILFDNDWNPSIDLQAMSRIHRDGQKKHCYIYRLITTGCIDEKILQRQL 767

Query: 835 KKMILEYAIISLGVTDG 851
            K  L    +    T G
Sbjct: 768 MKHSLSKKFLDSSYTTG 784

>Scas_520.5
          Length = 863

 Score =  202 bits (513), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 113/283 (39%), Positives = 169/283 (59%), Gaps = 32/283 (11%)

Query: 367 QPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNG 426
           QP  +K   L+ +QL G+NW+  L+  G NGILAD+MGLGKT+Q++A +++ I+     G
Sbjct: 262 QPSMLKNCVLKPYQLEGLNWLITLYENGLNGILADDMGLGKTIQSIALLAF-IYEMDTKG 320

Query: 427 PHIIVVPLSTMPAWLDTFEKWAPDLNCICYM--GNQKSRDTIREYEFYTNPRAKGKKTMK 484
           P +I  PLST+  W++ FEK+APDL  + Y   G +  R+ +    F        KKT  
Sbjct: 321 PFLIAAPLSTVDNWMNEFEKFAPDLPVLKYYHPGGKNERNKLMRNFF--------KKTNG 372

Query: 485 FNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTP 544
             +++T+YE I++D   + S +W+F+ VDE HRLKN    L + L     +NR+L+TGTP
Sbjct: 373 TGIVVTSYEIIIRDADYIMSKQWKFLIVDEGHRLKNVNCRLIQELKRINTSNRLLLTGTP 432

Query: 545 LQNNIKELAALVNFLMPGRFTIDQEI-----DFEN--------------QDEEQEEYIHD 585
           LQNN+ EL +L+NF+MP  FT D EI     DF++               +E Q+  I +
Sbjct: 433 LQNNLAELWSLLNFIMPDIFT-DFEIFNKWFDFKDLEMESNSSKLNKVINEELQKNLISN 491

Query: 586 LHRRIQPFILRRLKKDVEKS-LPSKTERILRVELSDVQTEYYK 627
           LH  ++PF+LRRLKK V  + LP K E ++   L+ +Q ++YK
Sbjct: 492 LHTILKPFLLRRLKKTVLANILPPKREYVVNCPLTPIQKKFYK 534

 Score =  163 bits (413), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 80/161 (49%), Positives = 106/161 (65%)

Query: 687 LRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVP 746
           L+ L+ SSGK+  L +L+  L   GH++LIFSQ V MLD+L D+  +  +   R+DGT+ 
Sbjct: 643 LQELLESSGKLKTLQRLVIPLIAKGHKILIFSQFVNMLDLLEDWCDLNSLAAFRIDGTID 702

Query: 747 SAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAH 806
           +  R+  +  FN   +   VFLLSTRA GLG+NL+ ADTVV+FDSDWNPQ DLQAM R H
Sbjct: 703 NESRKEQLSKFNDKKNKHMVFLLSTRAAGLGVNLVGADTVVLFDSDWNPQVDLQAMDRCH 762

Query: 807 RIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLG 847
           RIGQ   V+VYR    +T+E  +L RA  K  LE  +I +G
Sbjct: 763 RIGQTKPVIVYRFCCDNTLEHVILTRAANKRKLERLVIQMG 803

>AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH]
           complement(295808..298519) [2712 bp, 903 aa]
          Length = 903

 Score =  202 bits (514), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 137/479 (28%), Positives = 237/479 (49%), Gaps = 63/479 (13%)

Query: 398 ILADEMGLGKTVQTVAFISWLIF---ARRQNGPH--------------IIVVPLSTMPAW 440
           +LADEMGLGKT  T+A I W +     R  + P               ++V P++ +  W
Sbjct: 295 LLADEMGLGKTCMTIALI-WTLLKQHPRPSSVPCSQLGVALQGICQKVLVVCPVTLIGNW 353

Query: 441 LDTFEKWAPDLNCICYMG------NQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEY 494
              F KW P +N I  +        +K ++ +R +        + ++T  + VL+  YE 
Sbjct: 354 KKEFIKWLP-MNRIGILTLSSKNTPEKDKNDVRNF-------LRVQRT--YQVLILGYEK 403

Query: 495 ILKDRAEL--GSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKEL 552
           +L   +EL     K   +  DE HRLKN+ S + + L   ++  ++++TGTP+QN++ E 
Sbjct: 404 LLNVFSELDQAKSKLDLLICDEGHRLKNSSSKILKCLTDLEIERKVILTGTPIQNDLNEF 463

Query: 553 AALVNFLMPGRFT------------IDQEIDFENQDEEQ-----EEYIHDLHRRIQPFIL 595
             ++NF+ PG               I +  D  N+  +Q     E    DL    + FIL
Sbjct: 464 YTIINFINPGILGTFAHFKRVYITPITRARDVNNKHNDQIVSLGESRSQDLIEITKKFIL 523

Query: 596 RRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNEL 655
           RR    +   LP +T+ ++  + +  Q + +  +L          +      L+ +    
Sbjct: 524 RRTSSIIADYLPPRTDIVVFCKPTQHQLDAFNQVLVGTRVDFQNMSFNSSLGLITL---F 580

Query: 656 KKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRL--KKDGHR 713
           KK  N P L   + +   Q   +G      + +    +SGK+ +L  LL ++  + D  +
Sbjct: 581 KKICNSPSLV--SSDSYFQSKVNGGTPALRIAQS--TTSGKLKVLMSLLHQIAHRSDNEK 636

Query: 714 VLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRA 773
           V++ S   + LDI+G+ +S   +++ RLDG+ P+ +R   ++ FN   +  F FLLS ++
Sbjct: 637 VVVISNYTQTLDIIGNLMSSASLSYLRLDGSTPAKERDAIVNDFNRSQTI-FGFLLSAKS 695

Query: 774 GGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLER 832
           GG+G+NL+ A  +++FD+DWNP  DLQAM+R HR GQK    +YRLV+   ++E++ +R
Sbjct: 696 GGVGLNLVGASRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCIDEKIFQR 754

>YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for
           mitotic diploid-specific recombination and repair and
           for meiosis [2775 bp, 924 aa]
          Length = 924

 Score =  200 bits (509), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 149/479 (31%), Positives = 244/479 (50%), Gaps = 64/479 (13%)

Query: 398 ILADEMGLGKTVQTVAFISWLI----FARRQNGPH------------IIVVPLSTMPAWL 441
           +LAD+MGLGKT+ ++  I  LI    FA + +               ++V P++ +  W 
Sbjct: 309 LLADDMGLGKTLMSITLIWTLIRQTPFASKVSCSQSGIPLTGLCKKILVVCPVTLIGNWK 368

Query: 442 DTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAE 501
             F KW  +L+ I  +    SR++    +       K ++T  + VL+  YE +L    E
Sbjct: 369 REFGKWL-NLSRIGVL-TLSSRNSPDMDKMAVRNFLKVQRT--YQVLIIGYEKLLSVSEE 424

Query: 502 LGSIK--WQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFL 559
           L   K     +  DE HRLKN  S +  +L S  +  ++L+TGTP+QN++ E   +++F+
Sbjct: 425 LEKNKHLIDMLVCDEGHRLKNGASKILNTLKSLDIRRKLLLTGTPIQNDLNEFFTIIDFI 484

Query: 560 MPG----------RFTI------------DQEIDFENQDEEQEEYIHDLHRRIQPFILRR 597
            PG          RF I            ++E+  E  +E  +E I    R    FILRR
Sbjct: 485 NPGILGSFASFKRRFIIPITRARDTANRYNEEL-LEKGEERSKEMIEITKR----FILRR 539

Query: 598 LKKDVEKSLPSKTERILRVELSDVQTEYYKNILTK---NYSALTAGAKGGHFSLLNIMNE 654
               +EK LP KT+ IL  +    Q   +K+IL     ++  LT  +  G  +LL     
Sbjct: 540 TNAILEKYLPPKTDIILFCKPYSQQILAFKDILQGARLDFGQLTFSSSLGLITLL----- 594

Query: 655 LKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDG-HR 713
            KK  N P L     +   +       ++++  R L  +SGK+ +L  LL  ++K    +
Sbjct: 595 -KKVCNSPGLV--GSDPYYKSHIKDTQSQDSYSRSL--NSGKLKVLMTLLEGIRKGTKEK 649

Query: 714 VLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRA 773
           V++ S   + LDI+ + +++ G++  RLDG++P+ QR   +  FN  +   F FLLS ++
Sbjct: 650 VVVVSNYTQTLDIIENLMNMAGMSHCRLDGSIPAKQRDSIVTSFNR-NPAIFGFLLSAKS 708

Query: 774 GGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLER 832
           GG+G+NL+    +++FD+DWNP  DLQAM+R HR GQK    +YRLV+   ++E++L+R
Sbjct: 709 GGVGLNLVGRSRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCIDEKILQR 767

>YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the
           Snf2/Rad54 subfamily of NTP-dependent DNA helicases
           [2562 bp, 853 aa]
          Length = 853

 Score =  198 bits (504), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 111/284 (39%), Positives = 164/284 (57%), Gaps = 32/284 (11%)

Query: 367 QPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNG 426
           QP  +K   L+ +QL G+NW+  L+  G NGILADEMGLGKTVQ++A +++ I+     G
Sbjct: 213 QPRLLKNCILKPYQLEGLNWLITLYENGLNGILADEMGLGKTVQSIALLAF-IYEMDTKG 271

Query: 427 PHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRD-TIREYEFYTNPRAKGKKTMKF 485
           P ++  PLST+  W++ F K+APDL  + Y G    ++ + +   F+      G      
Sbjct: 272 PFLVTAPLSTLDNWMNEFAKFAPDLPVLKYYGTNGYKERSAKLKNFFKQHGGTG------ 325

Query: 486 NVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPL 545
            +++T+YE IL+D   + S  W+F+ VDE HRLKN    L + L     +NR+L+TGTPL
Sbjct: 326 -IVITSYEIILRDTDLIMSQNWKFLIVDEGHRLKNINCRLIKELKKINTSNRLLLTGTPL 384

Query: 546 QNNIKELAALVNFLMPGRFTIDQEI-----DFEN----------------QDEEQEEYIH 584
           QNN+ EL +L+NF+MP  F  D EI     DF++                 DE Q+  I 
Sbjct: 385 QNNLAELWSLLNFIMPDIFA-DFEIFNKWFDFDSLNLGSGSNSEALNKLINDELQKNLIS 443

Query: 585 DLHRRIQPFILRRLKKDVEKS-LPSKTERILRVELSDVQTEYYK 627
           +LH  ++PF+LRRLKK V  + LP K E I+   ++  Q ++YK
Sbjct: 444 NLHTILKPFLLRRLKKVVLANILPPKREYIINCPMTSAQEKFYK 487

 Score =  165 bits (418), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 80/161 (49%), Positives = 110/161 (68%)

Query: 687 LRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVP 746
           L  L+ +SGK+ +L +L+  L  +GH+VLI+SQ V MLD++ D+  +      R+DG+V 
Sbjct: 595 LETLLKTSGKLQILQKLIPPLISEGHKVLIYSQFVNMLDLIEDWCDLNSFATFRIDGSVN 654

Query: 747 SAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAH 806
           +  R+  ++ FNS      +FLLSTRA GLGINL+ ADTVV+FDSDWNPQ DLQAM R H
Sbjct: 655 NETRKDQLEKFNSSKDKHNIFLLSTRAAGLGINLVGADTVVLFDSDWNPQVDLQAMDRCH 714

Query: 807 RIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLG 847
           RIGQ++ V+VYRL   +T+E  +L RA  K  LE  +I +G
Sbjct: 715 RIGQESPVIVYRLCCDNTIEHVILTRAANKRNLERMVIQMG 755

>CAGL0M01958g complement(238113..240875) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54, hypothetical
           start
          Length = 920

 Score =  196 bits (499), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 148/496 (29%), Positives = 237/496 (47%), Gaps = 62/496 (12%)

Query: 398 ILADEMGLGKTVQTVAFISWLI----FARRQNGPH------------IIVVPLSTMPAWL 441
           ILAD+MGLGKT+ T+  I  L+    FA +                 +IV P++ +  W 
Sbjct: 311 ILADDMGLGKTLMTITLIWTLLKQTPFASKVQCSQLGVPLSGMISKVVIVCPVTLIGNWK 370

Query: 442 DTFEKWAPDLNCICYMG----NQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILK 497
             F+KW   LN I  +     N    D I    F    R      + +  +LT  E +LK
Sbjct: 371 REFKKWL-GLNRIGILTLNPKNNVDMDKISVRNFIKVNRTYQVLILGYEKVLTVQEELLK 429

Query: 498 DRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVN 557
            + +L       +  DE HRLKN  S + + L S  +  ++++TGTP+QN++ E   +++
Sbjct: 430 QKDKL-----DLLICDEGHRLKNGASKILKVLKSLDIDKKVILTGTPIQNDLNEFFTIID 484

Query: 558 FLMPGRF------------TIDQEIDFENQ-----DEEQEEYIHDLHRRIQPFILRRLKK 600
           F+ PG               I +  D  N+      E+ EE  + L    + FILRR   
Sbjct: 485 FVNPGVLGTYASFKKLYINPISRARDINNKFNTKVIEQGEEKSNQLIEFTKRFILRRSNN 544

Query: 601 DVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKA-- 658
            + K LP KT+ IL    +  Q + +++I+      +          L+N+M ++  +  
Sbjct: 545 ILSKFLPPKTDIILFCRPTIEQIKAFRDIIENVRVDMNNITFNTSLGLINLMKKVCNSPS 604

Query: 659 --SNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDG--HRV 714
              N PY   N +  +                    SSGK+ +L +LL  +K      +V
Sbjct: 605 LLCNDPYYQSNVDSNIFTVSNKSN------------SSGKLTVLLELLLEIKATSPMEKV 652

Query: 715 LIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAG 774
           +I S   + LDI+   ++   ++  RLDG  P+ QR + ++ FN+ + N F FLLS +AG
Sbjct: 653 VIVSNYTQSLDIIQGLMNSNQLSNCRLDGATPAKQRDMLVNTFNN-NPNIFGFLLSAKAG 711

Query: 775 GLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERAR 834
           G+G+NL+ A  +V+FD+DWNP  DLQAM+R HR GQK    +YRL++   ++E++L+R  
Sbjct: 712 GVGLNLIGASRLVLFDNDWNPAVDLQAMSRIHREGQKRPCYIYRLITTGCIDEKILQRQL 771

Query: 835 KKMILEYAIISLGVTD 850
            K  L    +S   +D
Sbjct: 772 MKHNLTRKFLSSNTSD 787

>Kwal_27.10513
          Length = 900

 Score =  196 bits (497), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 144/491 (29%), Positives = 247/491 (50%), Gaps = 75/491 (15%)

Query: 398 ILADEMGLGKTVQTVAFISWLIFAR---------RQNGPHI--------IVVPLSTMPAW 440
           +LADEMGLGKT+ T+  + W +  +          QNG  +        +V P++ +  W
Sbjct: 295 LLADEMGLGKTLMTITLV-WTLLKQTPIPSKANSSQNGISLQGLCNKILVVCPVTLIGNW 353

Query: 441 LDTFEKWAPDLNCICYM------GNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEY 494
              F KW  ++N I  +        +K + T+R +        + ++T  + VL+  YE 
Sbjct: 354 KREFSKWL-NVNRIGILTLSSKSNAEKDKLTVRNF-------LRVQRT--YQVLVIGYEK 403

Query: 495 ILKDRAEL--GSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKEL 552
           +L    EL     K   +  DE HRLKN +S   ++++S +V  ++++TGTP+QN++ E 
Sbjct: 404 LLSVTEELLEAKSKIDLVICDEGHRLKNGQSKTLKAISSLEVPRKIMLTGTPIQNDLAEF 463

Query: 553 AALVNFL---MPGRFT---------IDQEIDFENQ-----DEEQEEYIHDLHRRIQPFIL 595
             + +FL   + G F+         I +  D  N+      E+  +   +L    + F L
Sbjct: 464 FTIADFLNDGILGTFSKFKRDFINPITRARDLNNKHNNLIQEKGRDKTQELIEITKNFTL 523

Query: 596 RRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTK---NYSALTAGAKGGHFSLLNIM 652
           RR  + + K LPSKT+ +L  + +  Q + ++  L+    ++S LT  +  G  +L    
Sbjct: 524 RRTAETISKFLPSKTDVVLFCKPTSGQLDAFRKTLSAAQLDFSRLTFNSSLGLITLF--- 580

Query: 653 NELKKASNHPYLF--DNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKK- 709
              KK  N P L   D+     ++   + K++  +        SGK+ +L  LL  L+K 
Sbjct: 581 ---KKICNSPSLISQDSYYLETIKPNSEVKISAPD--------SGKLRVLMALLDNLRKL 629

Query: 710 -DGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFL 768
               +V+I S   + LDI+ + +    ++F RLDG+  +  R   ++ FN+  S  F FL
Sbjct: 630 SPQEKVVIVSNYTQTLDIIQNMICSNSLSFTRLDGSTANKDRDKIVNSFNTVPS-IFAFL 688

Query: 769 LSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEE 828
           LS ++GG+G+NL+ A  +++FD+DWNP  DLQAM+R HR GQK    +YRL++   ++E+
Sbjct: 689 LSAKSGGMGLNLIGASRLILFDNDWNPAIDLQAMSRIHRDGQKRECYIYRLLTTGCIDEK 748

Query: 829 VLERARKKMIL 839
           + +R   K  L
Sbjct: 749 IFQRQLAKTSL 759

>Sklu_1582.2 , Contig c1582 197-1048
          Length = 283

 Score =  164 bits (415), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 110/162 (67%), Gaps = 5/162 (3%)

Query: 690 LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQ 749
           L+ +SGK+ +L QL+ +L  +GH+VLIFSQ V MLD++ D+  +      R+DG++ +  
Sbjct: 29  LLQTSGKLQILQQLVPKLINEGHKVLIFSQFVNMLDLIEDWCELNDFQACRIDGSMDNEV 88

Query: 750 RRISIDHFNS----PDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARA 805
           R+  I  FNS      +ND VFLLSTRAGGLGINL  AD+VVIFDSDWNPQ DLQAM R 
Sbjct: 89  RQEQIGKFNSKTTDSHAND-VFLLSTRAGGLGINLTAADSVVIFDSDWNPQVDLQAMDRT 147

Query: 806 HRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLG 847
           HRIGQ   V+VYRL   +TVE  +L RA  K  LE  +I +G
Sbjct: 148 HRIGQDRPVIVYRLCCDNTVEHVILTRAVSKRKLEKLVIQMG 189

>KLLA0C05368g 481598..486415 some similarities with sgd|S0005717
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1605

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 89/147 (60%), Gaps = 3/147 (2%)

Query: 713  RVLIFSQMVRMLDILGDYLSIK-GINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLST 771
            +++IFSQ     +ILG ++    G+NF R DG++ S+QR   I+ F   D+N  V L+S 
Sbjct: 1448 KLVIFSQFTMFFEILGHFIKKNLGLNFLRYDGSMSSSQRSACIESFYQ-DNNYRVMLISM 1506

Query: 772  RAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 831
            +AG  G+ L  A+ V++ D  WNP  + QAM R HRI Q+  V V+RL+ K +VE+ ++E
Sbjct: 1507 KAGNSGLTLTCANHVILADPFWNPFVEEQAMDRCHRISQEREVYVHRLLIKMSVEDRIVE 1566

Query: 832  -RARKKMILEYAIISLGVTDGNKYTKK 857
             + +KK ++  A+    + + NK  +K
Sbjct: 1567 LQNKKKTLVNLAMDPTQIREVNKLGRK 1593

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 75/361 (20%), Positives = 147/361 (40%), Gaps = 88/361 (24%)

Query: 380  QLTGINWMAFLW-SKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPH--------II 430
            Q  G+ W+  +  S    G+LAD+MGLGKTVQ++A +         N P         ++
Sbjct: 923  QRQGLRWLVSMEKSSKRGGLLADDMGLGKTVQSLALL-------MANKPEPKSAIKTTLV 975

Query: 431  VVPLSTMPAWLDTFE-KWAPDLNC--ICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNV 487
            V P++ +  W D    K   D+N   + + G + +    R +          K   ++++
Sbjct: 976  VAPVAVLRVWKDEVAVKIKKDVNVKVVIFGGGENNSSKFRSW----------KDLAEYDI 1025

Query: 488  LLTTYEYILKDRAELGSIKW-----------------------------------QFMAV 512
            +L +Y+ +  +  +   + W                                   +F  V
Sbjct: 1026 VLVSYQTLASEFKKHWPLSWKNGEHQPDVHAVDLKLMNQVKSSDEYFSPFYRNDSEFYRV 1085

Query: 513  --DEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFL-MP-----GRF 564
              DEA  +KN ++   ++  +     R  ++GTP+QNNI EL +L+ FL +P      +F
Sbjct: 1086 ILDEAQNIKNKKTQAAKACCTISSTFRWALSGTPIQNNIGELYSLIRFLRIPPYNKEAKF 1145

Query: 565  ------TIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKKDVEK-----SLPSKTERI 613
                   ++ +  ++  D E++  +  +   ++  +LRR K           LP K  + 
Sbjct: 1146 HSDIGAVLNTKKPYDYNDSERQRAMKKVQVLLRAIMLRRTKTSQIDGKPILQLPEKHLKE 1205

Query: 614  LRVELSDVQTEYYKNILTKNYSAL-----TAGAKGGHFSLLNIMNELKKASNHPYLFDNA 668
               +L   + E+Y+ + +K+         +   +G + S+L ++  L++A  H  L    
Sbjct: 1206 SANKLEGDELEFYQALESKSRDKAKKMLESKQKQGAYSSILTLLLRLRQACLHSELVKIG 1265

Query: 669  E 669
            E
Sbjct: 1266 E 1266

>CAGL0K07766g 770935..773427 highly similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 DNA repair
           protein, start by similarity
          Length = 830

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 107/223 (47%), Gaps = 43/223 (19%)

Query: 359 PRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDN----GILADEMGLGKTVQTVAF 414
           P++E      P   G +L  FQL G++WM    S+ D+    G+LADEMG+GKT+QT+A 
Sbjct: 208 PKYEPHRAPQPADMGVKLLPFQLEGLHWML---SQEDSIYNGGVLADEMGMGKTIQTIA- 263

Query: 415 ISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTN 474
              L+   R   P ++V P   +  W +  E              Q +   +  Y ++  
Sbjct: 264 ---LLMNDRSKKPSLVVAPTVALMQWKNEIE--------------QHTNGALSTYIYHGA 306

Query: 475 PRAKGKKTMK-FNVLLTTYEYI-----------------LKDRAELGSIKWQFMAVDEAH 516
            R      +K  +V+LTTY  +                 +K+++ L +I +    +DEAH
Sbjct: 307 SRTINIHDLKDIDVILTTYSVLESVFRKQNYGFRRKNGLVKEKSLLHNIDFYRAILDEAH 366

Query: 517 RLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFL 559
            +K+  S+   ++N+ K   R  ++GTPLQN I E+ +L+ FL
Sbjct: 367 NIKDRTSNTSRAVNALKTQKRWCLSGTPLQNRIGEMYSLIRFL 409

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 92/185 (49%), Gaps = 3/185 (1%)

Query: 673 LQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRV--LIFSQMVRMLDILGDY 730
           L+ F    +     ++G   SS K+  L + L +L+     V  ++FSQ   MLD++   
Sbjct: 637 LESFKKQSIVSRLNMKGTWRSSTKIEALVEELYKLRSPVKTVKSIVFSQFTSMLDLVEWR 696

Query: 731 LSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFD 790
           L   G    +L G++   QR  +I +F      + VFL+S +AGG+ +NL  A  V I D
Sbjct: 697 LKRAGFQTVKLQGSMSPTQRDQTIKYFMDNIECE-VFLVSLKAGGVALNLCEASQVFILD 755

Query: 791 SDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTD 850
             WNP  + Q+  R HRIGQ   V + R   +D++E  ++E   KK  + +A I+     
Sbjct: 756 PWWNPSVEWQSGDRVHRIGQYRPVKITRFCIEDSIEARIIELQEKKANMIHATINQDEAA 815

Query: 851 GNKYT 855
            N+ T
Sbjct: 816 INRLT 820

>ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH]
           (100332..102572) [2241 bp, 746 aa]
          Length = 746

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/227 (29%), Positives = 109/227 (48%), Gaps = 39/227 (17%)

Query: 359 PRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWS--KGDNGILADEMGLGKTVQTVAFIS 416
           P ++ +    P      L  FQL G++WMA   +  +   G+LADEMG+GKTVQ    IS
Sbjct: 125 PAYKPIRAAQPAGLTVPLLPFQLEGLHWMALQENNERYRGGVLADEMGMGKTVQ---MIS 181

Query: 417 WLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPR 476
            L+ A +  GP ++V P   +  W +  +K         Y G       +R   F+   R
Sbjct: 182 LLLHANK--GPTLVVAPTVALIQWKNEIDK---------YTGG-----ALRSLVFHGPGR 225

Query: 477 -AKGKKTMKFNVLLTTYEY-----------------ILKDRAELGSIKWQFMAVDEAHRL 518
            A  ++    +V+LTTY                   ++++++ L ++ +  + +DEAH +
Sbjct: 226 SAVSEELAAADVVLTTYAVLESVYRKQTQGFRRKAGVVREQSPLHAVDFYRVVLDEAHNI 285

Query: 519 KNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFT 565
           K+  S    S+N+ +   R  +TGTPLQN I E+ +L+ FL    FT
Sbjct: 286 KDRSSGTARSVNALRAVRRWCLTGTPLQNRIGEMYSLIRFLDIEPFT 332

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/167 (33%), Positives = 89/167 (53%), Gaps = 5/167 (2%)

Query: 687 LRGLIMSSGKMVLLDQLLTRLKKDGHRV--LIFSQMVRMLDILGDYLSIKGINFQRLDGT 744
           L+G   SS K+  L + L  L+     +  ++FSQ   MLD++   L   G    +L G+
Sbjct: 567 LQGNWRSSTKIEALLEELYNLRSSTRTIKSIVFSQFTSMLDLVEWRLKRAGFQTAKLQGS 626

Query: 745 VPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMAR 804
           +   QR  +I++F   + +  VFL+S +AGG+ +NL  A  V I D  WNP  + Q+  R
Sbjct: 627 MTPTQRAETINYFMD-NVHCEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDR 685

Query: 805 AHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDG 851
            HRIGQ   V + R   +D++E  ++E   KK  + +A  +LG  +G
Sbjct: 686 VHRIGQHRPVKITRFCIEDSIESRIIELQEKKANMIHA--TLGQDEG 730

>Scas_591.10
          Length = 772

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 115/230 (50%), Gaps = 48/230 (20%)

Query: 351 SSNYTSQR-PRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKG--DNGILADEMGLGK 407
           SS Y + R P+ E +S++        L  FQL G++W+     +G    G+LADEMG+GK
Sbjct: 148 SSPYVAIRAPQPEGMSIK--------LLPFQLEGLHWL-IQQEEGIFKGGVLADEMGMGK 198

Query: 408 TVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIR 467
           T+QT+A    L+       P ++V P   +  W +                NQ +   ++
Sbjct: 199 TIQTIA----LLMNDLTKRPSLVVAPTVALMQWKNEI--------------NQHTDGKLK 240

Query: 468 EYEFYTNPRAKGKKTM-KFNVLLTTYEY-----------------ILKDRAELGSIKWQF 509
            Y F+   +    KT+ +++V+LTTY                   ++K+ + L +I++  
Sbjct: 241 VYMFHGTSKNIDIKTLSEYDVVLTTYAVLESVFRKQNYGFKRKHGVVKELSVLHNIEFYR 300

Query: 510 MAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFL 559
           + +DEAH +K+ +S+   ++N+ K   R  +TGTPLQN I E+ +L+ FL
Sbjct: 301 VILDEAHNIKDRQSNTARAVNNLKTQKRWCLTGTPLQNRIGEMYSLIRFL 350

 Score = 86.3 bits (212), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 86/161 (53%), Gaps = 3/161 (1%)

Query: 687 LRGLIMSSGKMVLLDQLLTRLKKDGHRV--LIFSQMVRMLDILGDYLSIKGINFQRLDGT 744
           ++G   SS K+  L + L +L+     +  ++FSQ   MLD++   L   G    +L G+
Sbjct: 593 MKGTWQSSTKIEALVEELYKLRSPVRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGS 652

Query: 745 VPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMAR 804
           +   QR  +I +F +    + VFL+S +AGG+ +NL  A  V I D  WNP  + Q+  R
Sbjct: 653 MSPTQRDETIKYFMNNIECE-VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDR 711

Query: 805 AHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIIS 845
            HRIGQ   V + R   +D++E  ++E   KK  + +A I+
Sbjct: 712 VHRIGQFRPVKITRFCIEDSIESRIIELQEKKANMIHATIN 752

>Kwal_23.3660
          Length = 768

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 104/206 (50%), Gaps = 9/206 (4%)

Query: 647 SLLNIMNELKKASNHPYLFDNAEERVLQKFGDGK-----MTRENVLRGLIMSSGKMVLLD 701
           S L  + +L     H  L  +  +  L+  G G      ++R N+ +G   SS K+  L 
Sbjct: 545 SFLENLEKLTCPVCHIALSIDLSQPALEFAGSGNKKQSIVSRLNI-QGSWRSSTKIEALV 603

Query: 702 QLLTRLKKDGHRV--LIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNS 759
           + L  L+ D   +  ++FSQ   MLD++   L   G    +L G++   QR  +I +F  
Sbjct: 604 EELYNLRSDRRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPTQRDQTIKYFMD 663

Query: 760 PDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRL 819
            +++  VFL+S +AGG+ +NL  A  V I D  WNP  + Q+  R HRIGQ   V + R 
Sbjct: 664 -NTHCEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQYRPVKITRF 722

Query: 820 VSKDTVEEEVLERARKKMILEYAIIS 845
             +D++E  ++E   KK  + +A I+
Sbjct: 723 CIEDSIESRIIELQEKKANMIHATIN 748

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 99/204 (48%), Gaps = 37/204 (18%)

Query: 375 ELRDFQLTGINWM-AFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVP 433
           +L  FQL G++W+ +   S  + G+LADEMG+GKT+QT+A    L+       P ++V P
Sbjct: 161 KLLPFQLEGLHWLISQEHSVYNGGVLADEMGMGKTIQTIA----LLMNDVTKKPSLVVAP 216

Query: 434 LSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMK-FNVLLTTY 492
              +  W +  E              Q +   ++ + F+   R       K  +VLLTTY
Sbjct: 217 TVALMQWKNEIE--------------QHTGGKLKTHIFHGANRTSNVGEFKDVDVLLTTY 262

Query: 493 EY-----------------ILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVA 535
                              + K+ + L ++ +  + +DEAH +K+ +S+  +++NS    
Sbjct: 263 AVLESVFRKQNYGFKRKSGVYKEPSVLHNMNFYRVILDEAHNIKDRQSNTAKAVNSLLTE 322

Query: 536 NRMLITGTPLQNNIKELAALVNFL 559
            +  +TGTPLQN I E+ +L+ FL
Sbjct: 323 KKWCLTGTPLQNRIGEMYSLIRFL 346

>YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision
           repair protein involved in G2 repair of inactive genes,
           component of the nucleotide excision repair factor four
           (NEF4, Rad7p-Rad16p) ATP-dependent damage recognition
           complex, has DNA helicase domain of Snf2p family [2373
           bp, 790 aa]
          Length = 790

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 110/236 (46%), Gaps = 46/236 (19%)

Query: 358 RPRFEKLSVQPPFIKGG---------ELRDFQLTGINWM-AFLWSKGDNGILADEMGLGK 407
           R  F  L   PP++            +L  FQL G++W+ +   S    G+LADEMG+GK
Sbjct: 157 RNVFTDLKNAPPYVPQRSKQPDGMTIKLLPFQLEGLHWLISQEESIYAGGVLADEMGMGK 216

Query: 408 TVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIR 467
           T+QT+A    L+       P ++V P   +  W +  E              Q ++  ++
Sbjct: 217 TIQTIA----LLMNDLTKSPSLVVAPTVALMQWKNEIE--------------QHTKGQLK 258

Query: 468 EYEFYTNPRAKGKKTMK-FNVLLTTYEYI-----------------LKDRAELGSIKWQF 509
            Y ++   R    K ++ ++V+LTTY  +                  K  + L +I +  
Sbjct: 259 IYIYHGASRTTDIKDLQGYDVVLTTYAVLESVFRKQNYGFRRKNGLFKQPSVLHNIDFYR 318

Query: 510 MAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFT 565
           + +DEAH +K+ +S+   ++N+ K   R  ++GTPLQN I E+ +L+ FL    FT
Sbjct: 319 VILDEAHNIKDRQSNTARAVNNLKTQKRWCLSGTPLQNRIGEMYSLIRFLNINPFT 374

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 86/161 (53%), Gaps = 3/161 (1%)

Query: 687 LRGLIMSSGKMVLLDQLLTRLKKDGHRV--LIFSQMVRMLDILGDYLSIKGINFQRLDGT 744
           + G   SS K+  L + L +L+ +   +  ++FSQ   MLD++   L   G    +L G+
Sbjct: 611 MSGKWQSSTKIEALVEELYKLRSNKRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGS 670

Query: 745 VPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMAR 804
           +   QR  +I +F +    + VFL+S +AGG+ +NL  A  V I D  WNP  + Q+  R
Sbjct: 671 MSPTQRDETIKYFMNNIQCE-VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDR 729

Query: 805 AHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIIS 845
            HRIGQ   V + R   +D++E  ++E   KK  + +A I+
Sbjct: 730 VHRIGQYRPVKITRFCIEDSIEARIIELQEKKANMIHATIN 770

>KLLA0B09240g complement(810178..812580) similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 nucleotide
           excision repair protein, start by similarity
          Length = 800

 Score = 87.0 bits (214), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 100/206 (48%), Gaps = 37/206 (17%)

Query: 379 FQLTGINWMAFLW-SKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTM 437
           FQL G++W+     S  + G+LADEMG+GKT+QT+A    L+ +     P ++V P   +
Sbjct: 197 FQLEGLHWLQQQEESDYNGGVLADEMGMGKTIQTIA----LLMSDITRKPSLVVAPTVAL 252

Query: 438 PAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMK-FNVLLTTYEYI- 495
             W +  E              Q +   +  Y ++   R       K  +V+LTTY  + 
Sbjct: 253 MQWKNEIE--------------QHTNKKLSVYMYHGANRTNNLGDFKDVDVILTTYAVLE 298

Query: 496 ----------------LKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRML 539
                           +K+++ L SI +  + +DEAH +K+  S+  +++NS +   R  
Sbjct: 299 SVYRKQVYGFKRKAGTVKEKSLLHSINFYRVILDEAHNIKDRTSNTAKAVNSLQTKKRWC 358

Query: 540 ITGTPLQNNIKELAALVNFLMPGRFT 565
           ++GTPLQN I E+ +L+ FL    FT
Sbjct: 359 LSGTPLQNRIGEMYSLIRFLNIEPFT 384

 Score = 86.7 bits (213), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 83/155 (53%), Gaps = 3/155 (1%)

Query: 693 SSGKMVLLDQLLTRLKKDGHRV--LIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQR 750
           SS K+  L + L  L+ D   +  ++FSQ   MLD++   L   G    +L G++   QR
Sbjct: 627 SSTKIEALVEELYNLRSDKRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPTQR 686

Query: 751 RISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQ 810
             +I +F   + +  VFL+S +AGG+ +NL  A  V I D  WNP  + Q+  R HRIGQ
Sbjct: 687 DQTIKYF-MENIHCEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQ 745

Query: 811 KNHVMVYRLVSKDTVEEEVLERARKKMILEYAIIS 845
              V + R   +D++E  ++E   KK  + +A I+
Sbjct: 746 FRPVKITRFCIEDSIESRIIELQEKKASMIHATIN 780

>Kwal_14.1868
          Length = 1357

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 73/131 (55%), Gaps = 2/131 (1%)

Query: 707  LKKDGHRVLIFSQMVRMLDILGDYLSIK-GINFQRLDGTVPSAQRRISIDHFNSPDSNDF 765
            LK    ++++FSQ     D+L  ++    G  + R DG++ S  R  +I+ F        
Sbjct: 1190 LKSKTEKIIVFSQFTTFFDLLQHFIRKDLGAQYLRYDGSMDSQSRAATIEEFYR-SLERR 1248

Query: 766  VFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTV 825
            + L+S +AG  G+ L  A+ V++ D  WNP  + QAM R +RI Q   V V+RL+ K++V
Sbjct: 1249 ILLISMKAGNAGLTLTCANHVILIDPFWNPFVEEQAMDRCYRISQTRDVQVHRLLVKNSV 1308

Query: 826  EEEVLERARKK 836
            E+ +LE  +KK
Sbjct: 1309 EDRILELQKKK 1319

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 90/398 (22%), Positives = 165/398 (41%), Gaps = 79/398 (19%)

Query: 332  PEQVKHFQNRENSKILPQYSSNYTSQRPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLW 391
            P Q+ +  N +++  L +      +     E   + PP +    L   Q  G++W+  + 
Sbjct: 632  PLQLSNIYNIQDNDSLHELLEGLKTAETEIEGEELTPPEMTIN-LMKHQRQGLHWLLTVE 690

Query: 392  -SKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAW---LDTFEKW 447
             S    G+LAD+MGLGKTVQ +A +            ++IV P++ +  W   + T  K 
Sbjct: 691  KSNRKGGLLADDMGLGKTVQAIALMLANKSGVENCKTNLIVAPVAVLRVWQAEVKTKVKK 750

Query: 448  APDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYI------------ 495
               L  + Y G   ++  +  Y          +  ++ +V+L +Y+ +            
Sbjct: 751  TSGLKVLIYGGGNGAK--VENY----------RSLLRHDVVLVSYQTLASELKKHWPARL 798

Query: 496  --------------------LKDRAELGS------IKWQFMAVDEAHRLKNAESSLYESL 529
                                LK+R E  S       K+  + +DEA  +KN ++   ++ 
Sbjct: 799  SEDSEEAKITDIPDLKALNSLKERKEYWSPFYCNESKFYRIILDEAQNIKNKKTQSAKAC 858

Query: 530  NSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEI-------------DFENQD 576
             +     R  ++GTP+QNNI EL +L+ FL    +  +Q+              D+++ D
Sbjct: 859  CTLDATYRWALSGTPMQNNIMELYSLIRFLKISPYKREQKFKLDIGNPLGKATNDYDSHD 918

Query: 577  EEQEEYIHDLHRRIQPFILRRLK--KDVEKSLPSKTERILRVE---LSDVQTEYYKNILT 631
             +Q   I  +   ++  +LRR K  K   K +    E+I+      L   + ++Y ++  
Sbjct: 919  RQQA--IKKVQVLLRAIMLRRTKDSKIDGKPILELPEKIITNREDVLQGAELQFYSDLEA 976

Query: 632  KNYSA----LTAGAKGGHFSLLNIMNELKKASNHPYLF 665
            KN       L   AKG + S+L ++  L++A  HP L 
Sbjct: 977  KNQKKVEKLLNNRAKGSYSSILTLLLRLRQACCHPELV 1014

>AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH]
            complement(608865..613607) [4743 bp, 1580 aa]
          Length = 1580

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 81/133 (60%), Gaps = 3/133 (2%)

Query: 713  RVLIFSQMVRMLDILGDYLS-IKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLST 771
            ++++FSQ     DIL  ++  +  +++ R DGT+    R   I+ F   + N+ + L+S 
Sbjct: 1420 KLIVFSQFTTFFDILQFFIKKVLNVSYLRYDGTMNGNVRASVIERFYR-EKNERLLLISM 1478

Query: 772  RAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 831
            +AG  G+ L  A+ V++ D  WNP  + QAM R +RI Q+  V ++RL+ K+T+E+ ++E
Sbjct: 1479 KAGNSGLTLTCANHVILVDPFWNPYVEEQAMDRCYRISQQREVYIHRLLLKNTIEDRIVE 1538

Query: 832  -RARKKMILEYAI 843
             + RK+ ++E A+
Sbjct: 1539 LQNRKRTLVENAM 1551

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 81/376 (21%), Positives = 151/376 (40%), Gaps = 88/376 (23%)

Query: 380  QLTGINWMAFL-WSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMP 438
            Q  G+ W+     SK   G+LAD+MGLGKTVQ +A +     A      +++V P++ + 
Sbjct: 900  QRQGLYWLLKTESSKFKGGLLADDMGLGKTVQAIALMLANRSADSTCKTNLVVGPVAVLR 959

Query: 439  AWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTM-KFNVLLTTYEYILK 497
             W D                 ++++ ++  Y  +   + +  K M  ++V+L +Y+ +  
Sbjct: 960  VWHDEINTKV----------KKQAQFSVMIYGGFGGKKVENFKAMHNYDVVLVSYQTLAV 1009

Query: 498  D------------------RAELGSIK-----------WQ----------FMAVDEAHRL 518
            +                    E+ SIK           W            + +DEA  +
Sbjct: 1010 EFKKHWPARLQGTSENGGQLPEVASIKAMNSMKLRNEYWSPFFSDDSNFYRIILDEAQNI 1069

Query: 519  KNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEI-------- 570
            KN ++   ++  +     R  ++GTP+QNNI EL +L+ FL    +  +Q+         
Sbjct: 1070 KNKQTQAAKACCTLNGTYRWALSGTPIQNNILELYSLLRFLRIAPYNREQKFKEDIGNAL 1129

Query: 571  -----DFENQDEEQEEYIHDLHRRIQPFILRRLKKDVEKS-----LPSKTERILRVELSD 620
                 DF++ D ++   +  +   ++  +LRR K           LP+K  R     L  
Sbjct: 1130 LSRGGDFDSMDTKRA--LKKVRVLLRAIMLRRAKTSQINGQPILELPAKHIRKKEDILDG 1187

Query: 621  VQTEYYKNILTKNYSALTAGA------KGGHFSLLNIMNELKKASNHPYLFDNAEERVLQ 674
               E+YK++  ++ +A+ A A           ++L ++  L++A  H  L          
Sbjct: 1188 QDLEFYKSL--EHETAIQARALLNERKASSSSNILTLLLRLRQACCHQELV--------- 1236

Query: 675  KFGDGKMTRENVLRGL 690
            K G  K     V+ G+
Sbjct: 1237 KLGKAKAIGTRVVNGM 1252

>CAGL0G09493g complement(902228..906454) similar to tr|Q08562
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1408

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 89/349 (25%), Positives = 150/349 (42%), Gaps = 80/349 (22%)

Query: 380  QLTGINWMAFL-WSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNG----PHIIVVPL 434
            Q  G+ W+     SK   G+LAD+MGLGKTVQ +A    L+ A R +      ++IV P+
Sbjct: 737  QRLGLQWLLNAETSKRKGGLLADDMGLGKTVQAIA----LMLANRSSNESKKTNLIVAPV 792

Query: 435  STMPAW---LDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTT 491
            S +  W   ++T  K + D N   Y G    +   R ++  +N          F+V+L +
Sbjct: 793  SVLRVWKGEIETKIKESSDFNSAIYGGVNGIK--FRSWDKLSN----------FDVILVS 840

Query: 492  YEYI---------------------LKDRAELGSIK-----WQ----------FMAVDEA 515
            Y+ +                     + D   + S+K     W            + +DE 
Sbjct: 841  YQTLANELKKHWPERLKTDSKQLPPVPDIKAMNSLKTKNEYWSPFYSDDSTFYRIILDEG 900

Query: 516  HRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFL-MP-----GRFTIDQE 569
              +KN ++   ++  +     R +++GTP+QNN++EL +L+ FL +P      RF  D  
Sbjct: 901  QNIKNMKTQAAKACCTVNSVYRWILSGTPIQNNMEELYSLIRFLRIPPYNRHERFQQDIG 960

Query: 570  IDFEN-----QDEEQEEYIHDLHRRIQPFILRRLKKDVEKS-----LPSKTERILRVELS 619
              F N       E +++ I  +   ++  +LRR K D         LP K          
Sbjct: 961  RPFSNLKQNYDSESRKQAIKKVRVLLRAIMLRRSKTDKIDGVPILELPPKNVNAQETTFK 1020

Query: 620  DVQTEYYKNILTKNYS----ALTAGAKGGHFSLLNIMNELKKASNHPYL 664
            D + E+YK +  KN       L +  +G + S+L ++  L++A  HP L
Sbjct: 1021 DDELEFYKALEHKNKQLAKKLLESKVQGNYSSVLTLLLRLRQACCHPEL 1069

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 82/148 (55%), Gaps = 3/148 (2%)

Query: 708  KKDGHRVLIFSQMVRMLDILGDYLSIK-GINFQRLDGTVPSAQRRISIDHFNSPDSNDFV 766
            K D  +++IFSQ    LD+L   L+ +  I+  +  G + +  R   I  F S + +  V
Sbjct: 1247 KSDSEKIIIFSQFTTFLDLLEHILATRLKISCLKYTGDMNAKVRSEIISRFYS-EEDKRV 1305

Query: 767  FLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVE 826
             L+S +AG  G+ L  A+ VVI D  WNP  + QA  R +RI Q   V V+RL  K++VE
Sbjct: 1306 LLISMKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTREVTVHRLFIKNSVE 1365

Query: 827  EEVLERAR-KKMILEYAIISLGVTDGNK 853
            + +LE  + K+ +++ A+ +  + D NK
Sbjct: 1366 DRILELQKLKRDMVDAAMDAKKIKDINK 1393

>Scas_721.100
          Length = 1137

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 74/136 (54%), Gaps = 6/136 (4%)

Query: 711  GHRVLIFSQMVRMLDILGDYLS----IKGINFQRLDGTVPSAQRRISIDHFNSPD-SNDF 765
            G +V+IFSQ    LDIL D L            + DG +   +R   +  F   D S   
Sbjct: 980  GEQVVIFSQFSSYLDILEDELKEAFPTDVAKIYKFDGRLSLKERSTVLQDFQIKDLSRQK 1039

Query: 766  VFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTV 825
            + LLS +AGG+G+NL  A    + D  W+P  + QA+ R HRIGQ N+V V R + ++++
Sbjct: 1040 ILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRIHRIGQTNNVKVVRFIIENSI 1099

Query: 826  EEEVLE-RARKKMILE 840
            EE++L  + RK+ I E
Sbjct: 1100 EEKMLRIQERKRTIGE 1115

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 76/303 (25%), Positives = 133/303 (43%), Gaps = 68/303 (22%)

Query: 397 GILADEMGLGKTVQTVAFISWLIFAR---------------RQNGPHI---------IVV 432
           GIL+DEMGLGKT+ T+A I    +                 R+  PH+         IVV
Sbjct: 502 GILSDEMGLGKTISTLALILSCPYDSEVVDKKLFKGEEDDIRETQPHLKPYASKTTLIVV 561

Query: 433 PLSTMPAWLDTFEKW--APDLNCICYMGNQKSRDTIREYEFYT-NPRAKGKKTMKFNVLL 489
           P+S +  W   F K   + D+    Y G   S  ++++    T NP           V++
Sbjct: 562 PMSLLNQWNTEFNKANNSSDMRSEIYYGGNVS--SLKKLLTKTHNPPT---------VVI 610

Query: 490 TTYEYI----------------LKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFK 533
           TTY  +                ++  + L S+ +  + +DE H ++N  +   +++    
Sbjct: 611 TTYGIVQSEWSKIFKKQNIGAEIQSSSGLFSVDFYRIVIDEGHTIRNRTTLTSKAIMDLT 670

Query: 534 VANRMLITGTPLQNNIKELAALVNFL------MPGRFTIDQEIDFENQDEEQEEYIHDLH 587
              + ++TGTP+ N + +L +LV FL        G + +     FEN++ +Q   +  ++
Sbjct: 671 SKCKWVLTGTPIINRLDDLYSLVRFLKLEPWSQIGYWKMFVSTPFENKNFKQAFDV--VN 728

Query: 588 RRIQPFILRRLK--KDVEK----SLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGA 641
             ++P +LRR K  KD++      LP K   + R++LS  Q   YK +L +   ++  G 
Sbjct: 729 AILEPVLLRRTKQMKDIDGKPLVELPPKEVIVERLKLSKAQNAVYKYLLDRAEQSVILGL 788

Query: 642 KGG 644
             G
Sbjct: 789 ARG 791

>YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded
            DNA-dependent ATPase of the Snf2p family of DNA
            helicases, member of the RAD6 epistasis group, involved
            in error-free DNA repair [3510 bp, 1169 aa]
          Length = 1169

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 80/157 (50%), Gaps = 6/157 (3%)

Query: 693  SSGKMVLLDQL-LTRLKKDGHRVLIFSQMVRMLDILGDYL----SIKGINFQRLDGTVPS 747
            SS    LL +L L +    G +V+IFSQ    LDIL   L    S       + DG +  
Sbjct: 993  SSKITALLKELQLLQDSSAGEQVVIFSQFSTYLDILEKELTHTFSKDVAKIYKFDGRLSL 1052

Query: 748  AQRRISIDHFNSPD-SNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAH 806
             +R   +  F   D S   + LLS +AGG+G+NL  A    + D  W+P  + QA+ R H
Sbjct: 1053 KERTSVLADFAVKDYSRQKILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRLH 1112

Query: 807  RIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 843
            RIGQ N V V R + +D++EE++L    KK  +  A+
Sbjct: 1113 RIGQTNSVKVMRFIIQDSIEEKMLRIQEKKRTIGEAM 1149

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 81/338 (23%), Positives = 140/338 (41%), Gaps = 76/338 (22%)

Query: 397 GILADEMGLGKTVQTVAFISWL----------IF-----ARRQNGPH------------- 428
           GIL+DEMGLGKTV   + +             +F     A   N P              
Sbjct: 528 GILSDEMGLGKTVAAYSLVLSCPHDSDVVDKKLFDIENTAVSDNLPSTWQDNKKPYASKT 587

Query: 429 -IIVVPLSTMPAWLDTFEKW--APDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKF 485
            +IVVP+S +  W + F K   +PD+    Y G   S          +      K     
Sbjct: 588 TLIVVPMSLLTQWSNEFTKANNSPDMYHEVYYGGNVS----------SLKTLLTKTKTPP 637

Query: 486 NVLLTTYEYILKD----------------RAELGSIKWQFMAVDEAHRLKNAESSLYESL 529
            V+LTTY  +  +                 + L S+ +  + +DE H ++N  +   +++
Sbjct: 638 TVVLTTYGIVQNEWTKHSKGRMTDEDVNISSGLFSVNFYRIIIDEGHNIRNRTTVTSKAV 697

Query: 530 NSFKVANRMLITGTPLQNNIKELAALVNFLM--PGR----FTIDQEIDFENQDEEQEEYI 583
            + +   + ++TGTP+ N + +L +LV FL   P R    +       FE+++ +Q   +
Sbjct: 698 MALQGKCKWVLTGTPIINRLDDLYSLVKFLELDPWRQINYWKTFVSTPFESKNYKQAFDV 757

Query: 584 HDLHRRIQPFILRRLKKDVEKS------LPSKTERILRVELSDVQTEYYKNILTKNYSAL 637
             ++  ++P +LRR K+  +K       LP K   I R+  S  Q   YK +L K   ++
Sbjct: 758 --VNAILEPVLLRRTKQMKDKDGKPLVELPPKEVVIKRLPFSKSQDLLYKFLLDKAEVSV 815

Query: 638 TAGAKGGHF-----SLLNIMNELKKASNHPYLFDNAEE 670
            +G   G       ++L  +  L++   HP L  + +E
Sbjct: 816 KSGIARGDLLKKYSTILVHILRLRQVCCHPGLIGSQDE 853

>Scas_674.12d
          Length = 1323

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 68/128 (53%), Gaps = 2/128 (1%)

Query: 710  DGHRVLIFSQMVRMLDILGDYLS-IKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFL 768
            D  +++IFSQ     DI   +L  +  + + +  G + + QR   I  F    +N+ + L
Sbjct: 1164 DTEKIIIFSQFTSFFDIFQHFLEKLLKVPYLKYTGAMTAQQRADVITKFYR-QANERILL 1222

Query: 769  LSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEE 828
            +S +AG  G+ L  A+ V+I D  WNP  + QA  R +RI Q   V V+RL  KD+VE+ 
Sbjct: 1223 ISMKAGNSGLTLTCANHVIIVDPFWNPYVEEQAQDRCYRISQTREVHVHRLFIKDSVEDR 1282

Query: 829  VLERARKK 836
            + E   KK
Sbjct: 1283 IAELQEKK 1290

 Score = 73.6 bits (179), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 85/349 (24%), Positives = 147/349 (42%), Gaps = 82/349 (23%)

Query: 380 QLTGINWMAFL-WSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNG----PHIIVVPL 434
           Q  G++W+  +  SK   G+LAD+MGLGKTVQ +A    L+ A R        ++IV P+
Sbjct: 654 QKIGLHWLLNVEASKKKGGLLADDMGLGKTVQGIA----LMLANRSKDQACKTNLIVAPV 709

Query: 435 STMPAW---LDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTT 491
           + +  W   L+T  K   + +   Y G  K               A  K+  +++ ++ +
Sbjct: 710 AVLRVWGGELETKIKKEANFSAFIYGGGDK--------------LATWKELSEYDAIMVS 755

Query: 492 YEYIL------------KDRAELGSI------------------------KWQFMAVDEA 515
           Y  +             KD+ +L +I                         +  + +DE 
Sbjct: 756 YPTLAIEFKKHWPASLGKDQKQLPAIPQLAAMNSLKKKDEYFSPFFCNESTFYRIILDEG 815

Query: 516 HRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFL-MPG-----RFTIDQE 569
             +KN ++   ++  S     R + +GTP+QN++ EL +L+ FL +P      RF  D  
Sbjct: 816 QNIKNKKTRAAKACCSLDATYRWVFSGTPIQNSMDELYSLIRFLRIPPYHREERFMADIG 875

Query: 570 IDFENQ-----DEEQEEYIHDLHRRIQPFILRRLKKDVEKS-----LPSKTERILRVELS 619
             F  +     D ++++ I  +   +   +LRR K D+        LP K   I    L 
Sbjct: 876 RPFLRKNGNYDDFDRKQAIKKVQVLLSAIMLRRSKSDMIDGKPLLELPPKQIEIDSAALE 935

Query: 620 DVQTEYYKNILTKNYS----ALTAGAKGGHFSLLNIMNELKKASNHPYL 664
             + E+Y ++  KN       L   AKG + S+L ++  L++A  H  L
Sbjct: 936 GDELEFYTDLEAKNRKLAERLLKRKAKGNYSSVLTLLLRLRQACVHSEL 984

>CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces
            cerevisiae YLR032w RAD5, hypothetical start
          Length = 1151

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 72/138 (52%), Gaps = 5/138 (3%)

Query: 711  GHRVLIFSQMVRMLDILGDYL----SIKGINFQRLDGTVPSAQRRISIDHFNSPD-SNDF 765
            G +V++FSQ    LDIL   L    S   +   + DG +   +R   ++ F   D +   
Sbjct: 993  GEQVVVFSQFSSYLDILESQLNEVYSSNKLKVYKFDGRLSLKERTAVLEDFKVKDYAVQK 1052

Query: 766  VFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTV 825
            V LLS +AGG+G+NL  A    + D  W+P  + QA+ R HRIGQ N V V R V   ++
Sbjct: 1053 VLLLSLKAGGVGLNLTCASYAFMMDPWWSPSMEDQAIDRIHRIGQTNSVKVIRFVIDGSI 1112

Query: 826  EEEVLERARKKMILEYAI 843
            EE++L    +K  L  A+
Sbjct: 1113 EEKMLRIQDRKRTLGEAM 1130

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 73/311 (23%), Positives = 129/311 (41%), Gaps = 75/311 (24%)

Query: 395 DNGILADEMGLGKTVQTVAFI----------SWLIFARRQNG------------------ 426
           + GIL+DEMGLGKT+  ++ +          S  +F +  +                   
Sbjct: 507 NGGILSDEMGLGKTISALSLVLMRPKDEHTTSQSLFHQESSNLSSDDVIEIKEPERSYAY 566

Query: 427 -PHIIVVPLSTMPAWLDTFEKWAPDLNCIC---YMGNQKSRDTIREYEFYTNPRAKGKKT 482
              +I+VP+S +  W D F+K   +    C   Y GN  S  ++             K+ 
Sbjct: 567 KTTLIIVPMSLLTQWRDEFDKVNNNAGLTCELYYGGNVSSLKSLL-----------IKRK 615

Query: 483 MKFNVLLTTYEYILKDRAELG----------------SIKWQFMAVDEAHRLKNAESSLY 526
               V+LTTY  +  +  +L                 SI++  + +DE H ++N  +   
Sbjct: 616 NPPTVVLTTYGIVQNEWTKLSKDGTNIRSLGRTSGIFSIEFFRIILDEGHTIRNKSTITS 675

Query: 527 ESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQ------DEEQE 580
           +++       R ++TGTP+ N + +L +LV FL    ++   +I +  Q      +E   
Sbjct: 676 KAVLELSSKYRWILTGTPIINRLDDLYSLVKFLKLEPWS---QIGYWKQFITNPFEERNF 732

Query: 581 EYIHDLHRRI-QPFILRRLK--KDVEKS----LPSKTERILRVELSDVQTEYYKNILTKN 633
           +   D+   I +P +LRR K  KD + +    LP K   I +++LS  Q   Y+  L + 
Sbjct: 733 KQAFDVVNAIMEPVLLRRTKQMKDTDGNPLVQLPPKEIVIEKLQLSKKQKLIYEEFLQRA 792

Query: 634 YSALTAGAKGG 644
                +G + G
Sbjct: 793 EKTFRSGLQSG 803

>Kwal_47.17771
          Length = 972

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 79/160 (49%), Gaps = 10/160 (6%)

Query: 694 SGKMVLLDQLLTRLKK-----DGHRVLIFSQMVRMLDIL----GDYLSIKGINFQRLDGT 744
           S K   +  L+T LK+      G ++++FSQ    LDI+        S       + DG 
Sbjct: 793 SSKSSKIQSLITSLKRLQDACPGEQIVVFSQFSSFLDIIETEISSCFSKSTTKVYKFDGR 852

Query: 745 VPSAQRRISIDHFNSPDSNDF-VFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMA 803
           +   +R   +  F   D     + LLS +AGG+G+NL  A    + D  W+P  + QA+ 
Sbjct: 853 LSMKERSKVLQDFAVKDMTRLKILLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAID 912

Query: 804 RAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 843
           R HRIGQ N+V V R + + ++EE++L    +K  L  A+
Sbjct: 913 RIHRIGQVNNVKVVRFIIEHSIEEKMLRIQERKRTLGEAV 952

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 86/337 (25%), Positives = 138/337 (40%), Gaps = 74/337 (21%)

Query: 397 GILADEMGLGKTVQTVAFI------------------------------SWLIFAR-RQN 425
           GILADEMGLGKT+  +A I                               W   ++   +
Sbjct: 336 GILADEMGLGKTISILAMILTVPSDSSYGKEKLREASESPDPEISVLGSQWSGGSKPYAS 395

Query: 426 GPHIIVVPLSTMPAWLDTFEKWAPDLNCIC---YMGNQKSRDTIREYEFYTNPRAKGKKT 482
           G  ++VVP+S +  W   FEK +      C   Y GN  S  ++         + K   T
Sbjct: 396 GTTLVVVPMSLLSQWQQEFEKASSSKEATCEIYYGGNTSSLKSLL-------TKTKSPPT 448

Query: 483 MKFNVLLTTYEYIL--------------KDRAELGSIKWQFMAVDEAHRLKNAESSLYES 528
               VL+TTY  +                D + L S+++  + +DE H ++N  +    S
Sbjct: 449 ----VLITTYGTVQHEWSRLLNKNGQMDTDVSGLFSVEFFRIVIDEGHTIRNRNTRTSRS 504

Query: 529 LNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFT-IDQEIDFENQDEEQEEY--IHD 585
           L   K     ++TGTP+ N + +L +LV F+    ++ I     F +   E++ Y    D
Sbjct: 505 LMDLKSTRSWILTGTPIINRLDDLYSLVKFMRLEPWSQIGYWKTFVSDPFEKKNYKAAFD 564

Query: 586 LHRRI-QPFILRRLK--KDVEK----SLPSKTERILRVELSDVQTEYYKNILTKNYSALT 638
           +   I +P ILRR K  +DV+      LP K   I +V  +  +   YK  L K  S++ 
Sbjct: 565 IVSSILEPVILRRTKGMRDVDGKRLVELPPKEVIIEKVAFNKNEDALYKYFLNKAESSVK 624

Query: 639 AGAKGGHF-----SLLNIMNELKKASNHPYLFDNAEE 670
            G   G       ++L  +  L++   H  L  + +E
Sbjct: 625 EGLDRGDLLKKYSTILVHILRLRQVCCHADLLGSQDE 661

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
            complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/176 (33%), Positives = 84/176 (47%), Gaps = 7/176 (3%)

Query: 668  AEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDG--HRVLIFSQMVRMLD 725
             E R L K  D     E V       S K+V L + L  L+      +V++FSQ    LD
Sbjct: 883  VESRYLLKLEDINGKLEPVPYSNTKKSSKIVALIRHLKHLQDTSANEQVVVFSQFSSYLD 942

Query: 726  ILGDYL----SIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDF-VFLLSTRAGGLGINL 780
            IL + L    +       + DG +   +R   +  F         V LLS +AGG+G+NL
Sbjct: 943  ILENELRQSFASDICEIYKFDGRLDLKERSNVLAKFTEKSLVKMKVLLLSLKAGGVGLNL 1002

Query: 781  MTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKK 836
              A    I D  W+P  + QAM R HRIGQ N V +YR + ++++EE++L    KK
Sbjct: 1003 TCASHAFIMDPWWSPGMEDQAMDRIHRIGQSNTVKIYRFIVENSIEEKMLRIQEKK 1058

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 82/332 (24%), Positives = 145/332 (43%), Gaps = 70/332 (21%)

Query: 397 GILADEMGLGKTVQTVAFISWL------IFARRQNGPHI--------------------- 429
           GILADEMGLGKT+  +A I+ +      +    Q  P +                     
Sbjct: 456 GILADEMGLGKTISILALITMVPSDTKHLLTTAQEKPPVGHLSLELGISTVKPYTASTTL 515

Query: 430 IVVPLSTMPAWLDTFEKW--APDLNC-ICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFN 486
           IVVP+S +P W + F +      L C + Y GN  +  T+             K+    +
Sbjct: 516 IVVPMSLLPQWRNEFVRVNDGNGLYCEVYYAGNVSNLRTLLV-----------KQKSPPS 564

Query: 487 VLLTTYEYILKDRAELG------------SIKWQFMAVDEAHRLKNAESSLYESLNSFKV 534
           V+LTTY  +  + ++L             S+++  + +DE H ++N  +   +++ +   
Sbjct: 565 VVLTTYGVVQTEWSKLQQFDYEASNEGLFSVEFFRIILDEGHNIRNRTTKTSKAVMALTS 624

Query: 535 ANRMLITGTPLQNNIKELAALVNFL-MPGRFTIDQEIDFENQDEEQEEY---IHDLHRRI 590
             + ++TGTP+ N + +L +L+ F+       ID    F +   E+++Y   +  +   +
Sbjct: 625 RRKWVLTGTPIMNRLDDLFSLIKFMNFEPWCKIDYWRQFVSDPFEKKDYSSALEVIQAVM 684

Query: 591 QPFILRRLK--KDVEKS----LPSKTERILRVELSDVQTEYYKNILTK-NYSALTAGAKG 643
            P +LRR K  KD + +    LP K   I  +  SD +   YK  L+K  +S   + A+G
Sbjct: 685 GPILLRRTKNMKDEDGNPLVQLPPKEVVIEMIRFSDTEAGLYKYFLSKAEHSVKESLARG 744

Query: 644 GHFS-----LLNIMNELKKASNHPYLFDNAEE 670
                    LL+I+  L++   H  L  + +E
Sbjct: 745 DLLKKYSTILLHIL-RLRQVCCHFKLLGSQDE 775

>YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in
            silencing, member of Snf2p DNA-dependent ATPase family
            [4860 bp, 1619 aa]
          Length = 1619

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 77/134 (57%), Gaps = 5/134 (3%)

Query: 713  RVLIFSQMVRMLDILGDYLSIKGINFQRLD--GTVPSAQRRISIDHFNSPDSNDFVFLLS 770
            +++IFSQ     +IL  +L  K +NF  L   G++ +AQRR  + +    D    + L+S
Sbjct: 1463 KIIIFSQFTTFFEILEHFLKNK-LNFPYLKYIGSM-NAQRRSDVINEFYRDPEKRILLIS 1520

Query: 771  TRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVL 830
             +AG  G+ L  A+ VVI D  WNP  + QA  R +RI Q   V V++L  KD+VE+ + 
Sbjct: 1521 MKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTKKVQVHKLFIKDSVEDRIS 1580

Query: 831  E-RARKKMILEYAI 843
            E + RKK +++ A+
Sbjct: 1581 ELQKRKKEMVDSAM 1594

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 87/369 (23%), Positives = 156/369 (42%), Gaps = 70/369 (18%)

Query: 380  QLTGINWMAFLW-SKGDNGILADEMGLGKTVQTVAFISWLIFARR----QNGPHIIVVPL 434
            Q  G++W+  +  S    G+LAD+MGLGKT+Q +A    L+ A R    +   ++IV P+
Sbjct: 947  QRLGLHWLLQVENSAKKGGLLADDMGLGKTIQAIA----LMLANRSEESKCKTNLIVAPV 1002

Query: 435  STMPAW---LDTFEKWAPDLNCICYMGNQKS-----RDTIR------EYEFYTNPRAK-- 478
            S +  W   L+T  K         + G+        RD  R       Y+   N   K  
Sbjct: 1003 SVLRVWKGELETKVKKRAKFTTFIFGGSGNGKVKHWRDLARYDAVLVSYQTLANEFKKHW 1062

Query: 479  -----GKKTM--------KFNVLLTTYEY----ILKDRAELGSIKWQFMAVDEAHRLKNA 521
                 G++            N L T+ EY       D        +  + +DE   +KN 
Sbjct: 1063 PKKLDGEQNQLPAVPHIQALNRLKTSNEYYSPFFCNDST------FYRILLDEGQNIKNK 1116

Query: 522  ESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFL-MP-----GRFTID------QE 569
             +   ++  +     R +++GTP+QN++ EL +L+ FL +P      RF +D      + 
Sbjct: 1117 NTRASKACCTINGMYRWVLSGTPIQNSMDELYSLIRFLRIPPYHKEQRFKLDIGRFFQRN 1176

Query: 570  IDFENQDEEQEEYIHDLHRRIQPFILRRLKKDVEKS-----LPSKTERILRVELSDVQTE 624
              ++  +E+++  +  +   +   +LRR K D         LP K   +    L   + +
Sbjct: 1177 KQYQYDNEDRKNALRKVRVLLNAIMLRRSKADKIDGKPLLELPPKIVEVDESRLKGEELK 1236

Query: 625  YYKNILTKNYS----ALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERVL-QKFGDG 679
            +Y  + +KN +     L    +G + S+L ++  L++A  H  L    E++    K  +G
Sbjct: 1237 FYTALESKNQALAKKLLNNSTRGSYSSVLTLLLRLRQACCHSELVVMGEKKAEGTKVANG 1296

Query: 680  KMTRENVLR 688
            K   ++ LR
Sbjct: 1297 KSFEDDWLR 1305

>KLLA0F17479g complement(1601287..1604631) similar to sp|P32849
            Saccharomyces cerevisiae YLR032w RAD5 DNA helicase, start
            by similarity
          Length = 1114

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 74/134 (55%), Gaps = 6/134 (4%)

Query: 711  GHRVLIFSQMVRMLDILG----DYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDF- 765
            G ++++FSQ    LDIL      +L    +   + DG +   +R   ++ F+  D +   
Sbjct: 957  GEQIIVFSQFSSFLDILEIELRSHLPRDQVIIYKFDGRLDMKERTRILEQFHDKDLSCIK 1016

Query: 766  VFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTV 825
            + LLS + GG+G+NL  A    + D  W+P  + QA+ R HRIGQ+  V V R +  ++V
Sbjct: 1017 LLLLSLKTGGVGLNLTCASRAFMMDPWWSPGMEDQAIDRIHRIGQQQTVKVVRFIIDNSV 1076

Query: 826  EEEVLE-RARKKMI 838
            EE++L  + RK+M+
Sbjct: 1077 EEKMLRIQERKRML 1090

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 80/308 (25%), Positives = 135/308 (43%), Gaps = 76/308 (24%)

Query: 395 DNGILADEMGLGKTVQTVAFISWLIF---------------------------ARRQNGP 427
           + GILADEMGLGKT+  +A I    +                            R     
Sbjct: 478 NGGILADEMGLGKTISALALICTASYDEAHEKKIESTKKPSMKEMSSQVDSSPLRHSQHK 537

Query: 428 H--------IIVVPLSTMPAWLDTFEKWAPDLN--CICYMGNQKSRDTIREYEFYT-NPR 476
           H        +IVVP+S +  W   FEK   DL   C  Y GN      I++   Y   P 
Sbjct: 538 HDTYAYRTTLIVVPMSLLNQWQSEFEKANKDLKKRCEIYYGN-----NIKDLRAYVLGPN 592

Query: 477 AKGKKTMKFNVLLTTY-----EYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNS 531
           A        +V++TTY     EY     + L ++ +  + +DE H ++N  +   +++ +
Sbjct: 593 AP-------SVIITTYGIIQSEYGRTSTSGLFNVVFFRIILDEGHTIRNRSTRTSKAVIA 645

Query: 532 FKVANRMLITGTPLQNNIKELAALVNFL---------MPGRFTIDQEIDFENQDEEQEEY 582
            + + + ++TGTP+ N + +L +LV FL            R+     + FE  +  Q   
Sbjct: 646 LRSSRKWILTGTPIINRLDDLFSLVQFLNLEPWSHINYWKRYV---SVPFEKGNYAQAFD 702

Query: 583 IHDLHRRIQPFILRRLK--KDVEK----SLPSKTERILRVELSDVQTEYYKNILTKNYSA 636
           +  ++  ++P +LRR K  KDV+     SLP K   + +++LS  +   Y+++L    ++
Sbjct: 703 V--INAVLEPVLLRRTKNMKDVDGKPLVSLPPKEVIVEKLQLSSSEKRVYQSMLEDAENS 760

Query: 637 LTAG-AKG 643
           +  G AKG
Sbjct: 761 VKEGLAKG 768

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 83/359 (23%), Positives = 154/359 (42%), Gaps = 73/359 (20%)

Query: 397 GILADEMGLGKTVQTVAFISWLI--------------------FARRQNGPH-----IIV 431
           G+LADEMGLGKT+ T+A IS +                     +  + + P+     +IV
Sbjct: 496 GLLADEMGLGKTISTLAMISMVPCDTDPVEEKNKRENEIGMNDYGYKSDKPYASKTTLIV 555

Query: 432 VPLSTMPAWLDTFEKW--APDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLL 489
           VP+S +  W   FEK    P+ +C  Y G  ++ + I       NP           ++L
Sbjct: 556 VPMSLLFQWQKEFEKANNNPNAHCEIYYGG-RAGNLITLLTKTKNPPT---------IIL 605

Query: 490 TTYEYI--------------LKDRAELGSIKWQF--MAVDEAHRLKNAESSLYESLNSFK 533
           T+Y  I              ++  A +G    +F  + +DE H ++N  +   +++    
Sbjct: 606 TSYGVIQSEWSKLPRCNNNRIEQGAAIGLFSVEFFRIVIDEGHSIRNRTTRTSKAVMDLS 665

Query: 534 VANRMLITGTPLQNNIKELAALVNFL------MPGRFTIDQEIDFENQDEEQEEYIHDLH 587
            + + ++TGTP+ N + +L +LV F+        G +       FE ++ +Q   +  + 
Sbjct: 666 SSRKWVLTGTPIINRLDDLFSLVKFMKLEPWSQIGYWKSFVSGPFEKKNYKQAFDV--VS 723

Query: 588 RRIQPFILRRLK--KDVEK----SLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGA 641
             ++P +LRR K  KD+      +LP K   I +V+ +  +   YK  L K  +++    
Sbjct: 724 SVLEPVLLRRTKQMKDINGKPLVTLPLKEIVIEKVKFNTSEDILYKFFLNKAENSVKESL 783

Query: 642 KGGHF-----SLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSG 695
             G       ++L  +  L++   H  L  + +E   +     KM ++ V    ++S+G
Sbjct: 784 ARGDLLKKYSTILVHILRLRQVCCHIELLGSRDEND-EDLSKNKMIQDKVDVSSVLSTG 841

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 84/157 (53%), Gaps = 7/157 (4%)

Query: 694  SGKMVLLDQLLTRLKKD--GHRVLIFSQMVRMLDILGDYL----SIKGINFQRLDGTVPS 747
            S K+  L + L +L++   G +V++FSQ    LDIL + L    S       + DG +  
Sbjct: 951  SSKICSLLKHLKQLQETCPGEQVVVFSQFSSYLDILENELTSSFSKADAKIYKFDGRLNL 1010

Query: 748  AQRRISIDHFNSPDSNDFVFLLSTR-AGGLGINLMTADTVVIFDSDWNPQADLQAMARAH 806
              R   +D F + D +    LL +  AGG+G+NL  A    + D  W+P  + QA+ R H
Sbjct: 1011 KDRSRVLDTFATKDLSKLKILLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAIDRVH 1070

Query: 807  RIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 843
            RIGQ+++V + R + ++++EE++L    +K  L  A+
Sbjct: 1071 RIGQESNVKIIRFIMENSIEEKMLSIQDRKRTLGEAV 1107

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 77/162 (47%), Gaps = 6/162 (3%)

Query: 710  DGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLL 769
            D  +V+++SQ    L ++G  L +  I  + L     +A    +I++F    S     LL
Sbjct: 1378 DPPQVILYSQKTEYLKVIGKVLKLYHI--EHLACLSNTANVGETINNFKRQPSVT-CLLL 1434

Query: 770  STRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEV 829
            + +  G G+NL+ A  + + D   N   +LQAM R +RIGQ     V+  + ++TVEE +
Sbjct: 1435 NVKTLGAGLNLINAKHIFLLDPILNNSDELQAMGRNNRIGQDEETFVWNFMIRNTVEENI 1494

Query: 830  LERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILKF 871
            L   R K ILE          G+KY +  +    E S   KF
Sbjct: 1495 L---RYKCILEERKRKEKSKKGDKYDEAQDETDNEESDDAKF 1533

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 95/216 (43%), Gaps = 52/216 (24%)

Query: 397 GILADEMGLGKTVQTVAFI---------SWLIFARRQN------GPHIIVVPLSTMPAWL 441
           G+LA+EMGLGKT++ ++ I         S   F   +N         +I+ P + +  WL
Sbjct: 387 GVLAEEMGLGKTIEILSLILLNRRKLKDSEATFIDDENRTITKTKTTLIICPNAILKQWL 446

Query: 442 DTFEKWAPDLNCICYMG-NQKSRD--TIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKD 498
           +  E  A  L    Y G N+  +D  T+ E           ++  ++++++T+Y  I  +
Sbjct: 447 EEIELHANSLKWYTYRGYNEIMKDCKTVDE---------AVQQLCQYDIIVTSYNIIATE 497

Query: 499 --RAE---------LGSIKWQF---MAVDEAHRLKNAESSLYESLNSFKVANRML----- 539
              AE         L S K+ +   +A+ + +R+   E  +  S +++      L     
Sbjct: 498 VHHAEFNRSIRSRRLKSPKYDYSSPLALMQFYRIILDEVQMLRSSSTYSAKCTSLLHRIH 557

Query: 540 ---ITGTPLQNNIKELAALVNFLMPGRFTIDQEIDF 572
              ++GTP+Q NI     ++++L    F    E+DF
Sbjct: 558 TWGVSGTPIQ-NIYNFRMIMSYLKLHPFC--DEVDF 590

>Scas_573.9
          Length = 1502

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 713  RVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTR 772
            ++L++SQ    L +LG  L+   I  + L     S+     I  F S  SN    LL+ +
Sbjct: 1333 QILLYSQSANFLKVLGKILTKNDI--EHLTCLSNSSTIGKKIARFKS-QSNITCLLLNVK 1389

Query: 773  AGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 831
              G G+NL+ A  + + D   N   +LQAM R +RIGQK    V+ L+  ++VEE + +
Sbjct: 1390 TLGAGLNLLNARHIFLLDPIINHSDELQAMNRNNRIGQKYETYVWNLIINNSVEENIFK 1448

 Score = 38.1 bits (87), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 56/116 (48%), Gaps = 24/116 (20%)

Query: 397 GILADEMGLGKTVQTVAFISWLIFAR----------------RQNGPHIIVVPLSTMPAW 440
           G+L++EMGLGKT++ +A I  ++  R                R+    +IV P + +  W
Sbjct: 371 GLLSEEMGLGKTIEVLALI--MLNKRDVIKEDSFIDDQNKTIRRTNLTLIVCPNAILTQW 428

Query: 441 LDTFEKWAPDLNCICYMGNQKSRDTIREYEFYT-NPRAKGKKTMKFNVLLTTYEYI 495
           ++       +L    YMG+  +R      +F T N +    +  ++++++T+Y+ +
Sbjct: 429 INETNAHTENLKIFHYMGSLATR-----IQFDTDNIQEILDRLSEYDIIITSYDIV 479

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 67/130 (51%), Gaps = 10/130 (7%)

Query: 713  RVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRIS--IDHFNSPDSNDFVFLLS 770
            ++L++SQ    + ++   LS+  IN    +       R +   I  F    S+    LL+
Sbjct: 1299 QILMYSQSFDFMKVVSQVLSLHNIN----NICCLQNNRNVGDMIARFKKT-SDITCLLLN 1353

Query: 771  TRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVL 830
             R+ G G+NL+ A  + + D   N   ++QAM+R +RIGQ+    V+  + ++TVEE ++
Sbjct: 1354 IRSLGAGLNLLNARHIFLLDPILNVNEEIQAMSRNNRIGQRQETYVWNFMLENTVEESIM 1413

Query: 831  ERARKKMILE 840
               R K +LE
Sbjct: 1414 ---RYKCVLE 1420

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 52/122 (42%), Gaps = 22/122 (18%)

Query: 391 WSKGDNGILADEMGLGKTVQTVAFISW----------LIFARR------QNGPHIIVVPL 434
           +  G  G+LA+EMGLGKT++ +A I            L F         +    +IV P 
Sbjct: 346 YEVGAKGVLAEEMGLGKTLEILALICINKRKYKADEPLDFVSESGKVISKCSTTLIVCPG 405

Query: 435 STMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYT-NPRAKGKKTMKFNVLLTTYE 493
           S +  W+D  +   P +    Y G    +      EF   N     +K  ++++++T+Y 
Sbjct: 406 SILKQWIDEMQSTHPAIKIYHYGGFIAVKK-----EFACDNINTIVQKLSQYDIVITSYN 460

Query: 494 YI 495
            +
Sbjct: 461 VV 462

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 69/138 (50%), Gaps = 11/138 (7%)

Query: 707  LKKDGHR----VLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDS 762
            L+K+ H+    ++IFS     L IL   L+   +   R       A+   ++D F   D 
Sbjct: 1343 LEKEPHKKNPQIVIFSSHSAFLSILSTLLTAHNVTHARPLRNTKFAK---AVDTFRK-DP 1398

Query: 763  NDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSK 822
            N    LL+  +   G+ L+ A  +++ +   +   + QA++R HRIGQK+   V+  + +
Sbjct: 1399 NCTCLLLNVHSQSTGLTLVNARHLILLEPIMDSSTEAQAISRIHRIGQKDVTYVWNFMVR 1458

Query: 823  DTVEEEVLERARKKMILE 840
            +TVEE ++   + K +LE
Sbjct: 1459 NTVEESIM---KYKAVLE 1473

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 57/117 (48%), Gaps = 26/117 (22%)

Query: 397 GILADEMGLGKTVQTVAFISWLI---------FAR-------RQNGPHIIVVPLSTMPAW 440
           G+LADEMGLGKT++ +  IS  +         F         R+   ++IV P S +  W
Sbjct: 353 GVLADEMGLGKTIEILTLISTNVRNLSNESSSFVSPINEKEVRRVKTNLIVCPESILQQW 412

Query: 441 LDTFE----KWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTM-KFNVLLTTY 492
           +D  +    K   D     Y G +K+R+     +F T+  A+  + M +++V++ +Y
Sbjct: 413 IDEIDLHINKKVSDFKVFHYEGFEKTRN-----KFNTDSPAEIVELMSQYDVVICSY 464

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 61/128 (47%), Gaps = 6/128 (4%)

Query: 713  RVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTR 772
            +++I+SQ   +L+I+   L    I F      V +  +   ++ F + D      LL T+
Sbjct: 1359 QIVIYSQYAELLEIVAHVLKQNSIKFLTTTKNVRNFAK--VVETFKA-DPEITCLLLDTK 1415

Query: 773  AGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLER 832
                G+ L+ A  V + +   N   + QA+ R HRIGQ +   V+  +  +TVE  +L  
Sbjct: 1416 RQASGLTLINATHVFLLEPIVNNSTEFQAINRIHRIGQTSETYVWHFMLLNTVEHSIL-- 1473

Query: 833  ARKKMILE 840
             R K ILE
Sbjct: 1474 -RYKSILE 1480

>Kwal_14.1287
          Length = 1518

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 52/117 (44%), Gaps = 17/117 (14%)

Query: 743  GTVPSAQRRISIDHFNSPDSNDF--------------VFLLSTRAGGLGINLMTADTVVI 788
            G +    ++ SI H N+  S  F                LL+      G+ L+ A  V I
Sbjct: 1344 GLLSKVLKQHSIQHCNTAGSGKFSKIVEKFKKNPEVTCLLLNVTRQATGLTLVNATHVFI 1403

Query: 789  FDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIIS 845
             D   N   +LQA+ R HRIGQ     V+  V ++TVE+ ++   R K +LE  I S
Sbjct: 1404 MDPIMNTSDELQAINRTHRIGQTRETYVWNFVVRNTVEQNIV---RLKGVLEERIAS 1457

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 18/69 (26%)

Query: 393 KGDNGILADEMGLGKTVQTVAFISWLIFARRQNGP----------------HIIVVPLST 436
           K   G+L++EMGLGKT++ +A +  L+  R  NG                 ++IV P S 
Sbjct: 351 KHAKGVLSEEMGLGKTLEILALM--LVHKRTINGAPTFLSDSKKTILKTATNLIVCPDSI 408

Query: 437 MPAWLDTFE 445
           +  W+D  E
Sbjct: 409 LQQWIDEVE 417

>Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement
          Length = 1006

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 71/165 (43%), Gaps = 35/165 (21%)

Query: 356  SQRPRFEKLSVQPPFIKGGELRDFQLT---------GINWMAFLW-SKGDNGILADEMGL 405
            S R   E L      I+G EL   +LT         G++W+  +  S    G+LAD+MGL
Sbjct: 856  SLRNLLEGLKQHETEIEGEELTPEELTVNLLKHQRRGLHWLLNVEKSNKRGGLLADDMGL 915

Query: 406  GKTVQTVAFISWLIFARRQN----GPHIIVVPLSTMPAW---LDTFEKWAPDLNCICYMG 458
            GKTVQ +A    L+ A R        ++IV P++ +  W   + T  K         Y G
Sbjct: 916  GKTVQAIA----LMIANRSELESCKTNLIVAPVAVLRVWQAEIQTKIKKNATFKAFIYGG 971

Query: 459  NQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELG 503
            N K    +  Y          K  ++++ +L +Y+ +  +   +G
Sbjct: 972  NNK----VVSY----------KDLLRYDAVLVSYQTLASELKNIG 1002

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 48/102 (47%), Gaps = 17/102 (16%)

Query: 753  SIDHFNSP--------------DSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQAD 798
            SI HFN+               DS+    L++ +    G+ L  A  V++ +     +  
Sbjct: 1324 SISHFNTEFGQDLAKEAELFKRDSSITCLLMNPKWCSRGLKLTNATHVILMEPMSEGRIQ 1383

Query: 799  LQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILE 840
             QA+ R HRIGQ     V+ L++++T EE  L   + +M+LE
Sbjct: 1384 EQAVERIHRIGQGKDTFVWHLMTRNTAEESTL---KYRMLLE 1422

>ADL273C [1468] [Homologous to ScYOR204W (DED1) - SH; ScYPL119C
           (DBP1) - SH] (225070..226941) [1872 bp, 623 aa]
          Length = 623

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 67/145 (46%), Gaps = 9/145 (6%)

Query: 696 KMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISID 755
           + VLLD L      DG   L+F +  RM D L D+L ++ ++   + G    A+R  ++ 
Sbjct: 390 RSVLLDLLAA---SDGGLTLVFVETKRMADALTDFLIMQNLSATAIHGDRTQAERERALA 446

Query: 756 HFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKN-HV 814
            F +  +N    L++T     G+++     V+ +D   +    +  + R  R G      
Sbjct: 447 FFRTGRAN---VLVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGLAT 503

Query: 815 MVYRLVSKDTVEE--EVLERARKKM 837
             +   +K+ V+E  ++LE A +++
Sbjct: 504 AFFNRGNKNVVKELVDILEEANQEV 528

>KLLA0A05203g complement(462167..463474) highly similar to sp|P38719
           Saccharomyces cerevisiae YHR169w DBP8, start by
           similarity
          Length = 435

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 56/139 (40%), Gaps = 5/139 (3%)

Query: 700 LDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNS 759
           L Q+LT  K      +IF       +IL   L    +    L   +P  +R  S+  F +
Sbjct: 245 LYQILTSEKYVKSSCIIFVNRTVTAEILRRTLKSLDVRVTSLHSQMPQQERTNSVQRFRA 304

Query: 760 PDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRL 819
             +     L++T     G+++   + VV +D   NP   +    R  R G+    + + +
Sbjct: 305 QAAR---VLIATDVASRGLDIPIVELVVNYDIPGNPDTFIHRAGRTARAGRHGESLCF-V 360

Query: 820 VSKDTVEEEVL-ERARKKM 837
             KD    E + ER  KKM
Sbjct: 361 TEKDIQRVEAIEERINKKM 379

>Sklu_2273.4 YHR169W, Contig c2273 4981-6288
          Length = 435

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 54/138 (39%), Gaps = 3/138 (2%)

Query: 700 LDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNS 759
           L Q+LT    +    +IF       +IL   L    +    L   +P  +R  S+  F  
Sbjct: 247 LYQILTSEDYENSSAIIFVNRTVTAEILRRTLKGLDVRVASLHSQMPQQERTNSLHRFR- 305

Query: 760 PDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRL 819
             +N    L++T     G+++ +   VV +D   NP   +    R  R G+    + +  
Sbjct: 306 --ANAARVLIATDVASRGLDIPSVALVVNYDIPANPDTFIHRAGRTARAGRSGESICFVT 363

Query: 820 VSKDTVEEEVLERARKKM 837
               T  E + ER  KKM
Sbjct: 364 QRDITRIESIEERINKKM 381

>Kwal_56.24760
          Length = 433

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 56/139 (40%), Gaps = 5/139 (3%)

Query: 700 LDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNS 759
           L Q+LT         +IF       +IL   L    +    L   +P  +R  S+  F +
Sbjct: 244 LYQILTSAAYIDSSAIIFVNRTVTAEILRRTLKQLDVRVASLHSQMPQQERTNSLHRFRA 303

Query: 760 PDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRL 819
              N    L++T     G+++ T   VV +D   NP   +    R  R G+K   + + +
Sbjct: 304 ---NAARVLIATDVASRGLDIPTVQLVVNYDISANPDTFIHRAGRTARAGRKGESICF-V 359

Query: 820 VSKDTVEEEVL-ERARKKM 837
             +D    + + ER  KKM
Sbjct: 360 AQRDVSRIQAIEERINKKM 378

>CAGL0L03047g 350035..352182 similar to sp|P36120 Saccharomyces
           cerevisiae YKR024c DBP7 RNA helicase, start by
           similarity
          Length = 715

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 51/113 (45%), Gaps = 6/113 (5%)

Query: 711 GHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDS----NDFV 766
           G  V + S+  ++L  + D   + GI   +L G++    R +++ HF + DS       +
Sbjct: 439 GDSVRVLSKGNKILPSIKDE-ELPGIICYKLHGSLSQQMRTMTLKHF-ATDSEQTKGKHL 496

Query: 767 FLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRL 819
            L  T     G++L    TV+ FD  +  +  L  + R  R G+    +++ L
Sbjct: 497 ILFCTDVASRGLDLPDVSTVIEFDPPFAVEDHLHRIGRTARAGRSGEALLFLL 549

>AFR082C [3274] [Homologous to ScYKR024C (DBP7) - SH]
           (576175..578307) [2133 bp, 710 aa]
          Length = 710

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 44/100 (44%), Gaps = 6/100 (6%)

Query: 738 FQRLDGTVPSAQRRISIDHFNSPDS---NDFVFLLSTRAGGLGINLMTADTVVIFDSDWN 794
           F +L G++P A R  ++ HF+S  +      + L  T     G++L    TV+  D  + 
Sbjct: 467 FYKLHGSLPQAVRVATLRHFSSDAAATRGKHLVLFCTDVASRGLDLPRVSTVIEMDPPFA 526

Query: 795 PQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERAR 834
            +  L  + R  R G     +++ L  +   EE  +E  R
Sbjct: 527 VEDHLHRIGRTARAGVAGESLLFLLPGE---EEGYMEHIR 563

>KLLA0F10505g complement(966736..969174) some similarities with
           sp|P21372 Saccharomyces cerevisiae YBR237w PRP5 pre-mRNA
           processing RNA-helicase, hypothetical start
          Length = 812

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 62/141 (43%), Gaps = 7/141 (4%)

Query: 699 LLDQLLTRL---KKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISID 755
           LL +L  RL   + +  + +IF    ++ D+L D L + GI    +    PSA+R  ++ 
Sbjct: 485 LLKRLSDRLALHRGEDEKTIIFVGSQQLCDLLYDELLLNGITTFPIHAGKPSAERLRNLQ 544

Query: 756 HFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVM 815
            F   D+     L+ T     G+N+     V+I+++       +  + R  R G  N V 
Sbjct: 545 KFKETDNG---ILICTEVLSRGLNVPEVSLVIIYNAAKTIAQYVHTVGRTGR-GTNNGVA 600

Query: 816 VYRLVSKDTVEEEVLERARKK 836
           +  ++  +     +L +  K+
Sbjct: 601 LSFVMVDELASAYILVKCMKE 621

>CAGL0L02915g complement(340834..342687) highly similar to sp|P06634
           Saccharomyces cerevisiae YOR204w DED1 ATP-dependent RNA
           helicase, start by similarity
          Length = 617

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 66/152 (43%), Gaps = 10/152 (6%)

Query: 714 VLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRA 773
            LIF +  RM D L D+L ++  +   + G    A+R  ++  F S  +N    L++T  
Sbjct: 405 TLIFVETKRMADQLTDFLIMQNFSATAIHGDRSQAERERALAAFRSGRAN---ILVATAV 461

Query: 774 GGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEE---EVL 830
              G+++     V+ +D   +    +  + R  R G       +     + + +   E+L
Sbjct: 462 AARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGVATAFFNRDNNNIVKGLYEIL 521

Query: 831 ERARKKM--ILEYAI--ISLGVTDGNKYTKKN 858
           E A +++   LE  +  +S   +  N+ T+ N
Sbjct: 522 EEANQEIPPFLEDCLREVSFSRSGSNRSTRGN 553

>YHR169W (DBP8) [2456] chr8 (442180..443475) Essential nucleolar RNA
           helicase required for biogenesis of 40S ribosomal
           subunits [1296 bp, 431 aa]
          Length = 431

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 60/141 (42%), Gaps = 9/141 (6%)

Query: 700 LDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNS 759
           L QLLT  + +    +IF       +IL   L    +    L   +P  +R  S+  F  
Sbjct: 243 LYQLLTCEEYENKTAIIFVNRTMTAEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFR- 301

Query: 760 PDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQ---AMARAHRIGQKNHVMV 816
             +N    L++T     G+++ T + VV +D   +P   +      ARA RIG     + 
Sbjct: 302 --ANAARILIATDVASRGLDIPTVELVVNYDIPSDPDVFIHRSGRTARAGRIGDAISFVT 359

Query: 817 YRLVSKDTVEEEVLERARKKM 837
            R VS+    + + +R  KKM
Sbjct: 360 QRDVSRI---QAIEDRINKKM 377

>Scas_588.16
          Length = 693

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 5/60 (8%)

Query: 690 LIMSSGKMVLLDQLLTRL---KKD--GHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGT 744
           LI +SGK  +  QLL +L   +KD    +VL+ S  ++ LDIL  +L  + +  +R+ GT
Sbjct: 122 LINTSGKFKVFQQLLFKLLDKEKDEVSKKVLLISHSIKELDILEGFLLGQKVRIKRISGT 181

>CAGL0I02354g 209279..210592 highly similar to sp|P38719
           Saccharomyces cerevisiae YHR169w DBP8, hypothetical
           start
          Length = 437

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 56/138 (40%), Gaps = 5/138 (3%)

Query: 700 LDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNS 759
           L QLLT         +IF       ++L   L    +    L   +P  +R  S+  F  
Sbjct: 250 LYQLLTCESYANSTAIIFVNRTTAAEVLRRTLKALDVRVASLHSQMPQQERTNSMHRFR- 308

Query: 760 PDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRL 819
             +N    L++T     G+++ T + V+ +D   +P   +    R  R G+K   + + +
Sbjct: 309 --ANAARVLIATDVASRGLDIPTVELVINYDIPSDPDTFIHRSGRTARAGRKGDAISF-I 365

Query: 820 VSKDTVEEEVLERARKKM 837
             +D    E +E AR  M
Sbjct: 366 TQRDVSRIEAIE-ARINM 382

>Scas_713.57
          Length = 962

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%)

Query: 1283 PTGPSKKRQRKPANHSKSMTPEITSSEPANGPPSKRMKALPKGPAALINNTRLSPNSPTP 1342
            P  P K R+    +H  S++ E +SS   N   +K + A+     A  +    SP SP+P
Sbjct: 764  PHHPDKNRKEGTTDHRDSVSTERSSSVSGNNVVTKALNAVGLRSRASSSVAATSPRSPSP 823

Query: 1343 PLKSK 1347
            P+  K
Sbjct: 824  PIHIK 828

>YPR179C (HDA3) [5593] chr16 complement(893791..895758) Protein of
           unknown function, has low similarity to uncharacterized
           C. albicans Orf6.8425p [1968 bp, 655 aa]
          Length = 655

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 97/235 (41%), Gaps = 44/235 (18%)

Query: 614 LRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKK-------ASNHPYLFD 666
           L   +S  Q E    I++ +YS +    +  H+    I+  +K         + HPYL  
Sbjct: 33  LPTTMSLYQKELTDQIVSLHYSDILRYFETSHYKEDVILESMKTMCLNGSLVATHPYL-- 90

Query: 667 NAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDI 726
                ++  +    +   +V   L  +SGK  +L  L+  +++      I  +  R +D+
Sbjct: 91  -----LIDHYMPKSLITRDVPAHLAENSGKFSVLRDLINLVQEYETETAIVCRPGRTMDL 145

Query: 727 LGDYLSIKGINFQRLDG-TVPSAQRRISIDHFNSPDSNDF---VFLLSTRAGGLGINLMT 782
           L   L    ++ +R DG ++ S Q+           +NDF   V L S+     GIN   
Sbjct: 146 LEALLLGNKVHIKRYDGHSIKSKQK-----------ANDFSCTVHLFSSE----GINFTK 190

Query: 783 A--------DTVVIFDSDWN-PQADLQAMA--RAHRIGQKNHVMVYRLVSKDTVE 826
                    D ++  D+  +  Q D+Q +   +  R G + +  + RLV+ ++++
Sbjct: 191 YPIKSKARFDMLICLDTTVDTSQKDIQYLLQYKRERKGLERYAPIVRLVAINSID 245

>YDR088C (SLU7) [940] chr4 complement(618491..619639) Pre-mRNA
           splicing factor affecting 3' splice site choice,
           required for the second catalytic step of splicing [1149
           bp, 382 aa]
          Length = 382

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 5/51 (9%)

Query: 175 DFHGIDIVIN-----HRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDE 220
           D H +    N     H+ K  +E+ + ++K VPDLN+ K N   L++ TD+
Sbjct: 115 DSHSLSFCRNCGEAGHKEKDCMEKPRKMQKLVPDLNSQKNNGTVLVRATDD 165

>Sklu_2436.4 YDR459C, Contig c2436 10516-11610 reverse complement
          Length = 364

 Score = 31.2 bits (69), Expect = 6.1,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 10/76 (13%)

Query: 1027 NLKEILDE-----LIADGT-LPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILE-KLE 1079
            N+KE L        I  G+ LP+K+ + Y ETY+E+M     C+    KN K +++ K+E
Sbjct: 290  NIKEFLGNNFFMWFIPIGSNLPLKTPKGYPETYEEIMGP---CIERMSKNYKALIQHKIE 346

Query: 1080 KHATAYRAKLKSGEIK 1095
            K     + +++  +++
Sbjct: 347  KGEYVNKLRIQGDKVQ 362

>CAGL0J06908g complement(659917..661731) similar to sp|P24784
           Saccharomyces cerevisiae YPL119c DBP1 or sp|P06634
           Saccharomyces cerevisiae YOR204w, hypothetical start
          Length = 604

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 50/112 (44%), Gaps = 6/112 (5%)

Query: 698 VLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHF 757
            LLD L+  +  DG   L+F +  RM D L D+L ++      + G    A+R  ++  F
Sbjct: 385 ALLDILINEI--DG-LTLVFVETKRMADQLTDFLIVQNFKATAIHGDRTQAERERALHAF 441

Query: 758 NSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIG 809
            +  +N    L++T     G+++     V+ +D   +    +  + R  R G
Sbjct: 442 RNGIAN---ILVATAVAARGLDIPNVTNVINYDLPTDIDDYVHRIGRTGRAG 490

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 43,889,516
Number of extensions: 1920794
Number of successful extensions: 8624
Number of sequences better than 10.0: 205
Number of HSP's gapped: 8540
Number of HSP's successfully gapped: 280
Length of query: 1442
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1328
Effective length of database: 12,649,657
Effective search space: 16798744496
Effective search space used: 16798744496
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 68 (30.8 bits)