Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER163C23222912131e-171
CAGL0L11748g2362347062e-94
Sklu_879.22332306913e-92
Scas_576.42372246741e-89
KLLA0C11649g2382286038e-79
AFR184C2182314751e-59
KLLA0A03531g732131643.2
CAGL0H05071g111044624.9
Sklu_2324.8545140625.8
YLR086W (SMC4)141842617.3
Scas_715.28d9555578.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER163C
         (229 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER163C (YER163C) [1591] chr5 complement(503079..503777) Member ...   471   e-171
CAGL0L11748g complement(1252608..1253318) similar to sp|P32656 S...   276   2e-94
Sklu_879.2 YER163C, Contig c879 312-1013 reverse complement           270   3e-92
Scas_576.4                                                            264   1e-89
KLLA0C11649g complement(1005591..1006307) similar to sp|P32656 S...   236   8e-79
AFR184C [3376] [Homologous to ScYER163C - NSH] (772555..773211) ...   187   1e-59
KLLA0A03531g 320828..323026 similar to sp|P06103 Saccharomyces c...    29   3.2  
CAGL0H05071g 486899..490231 similar to sp|Q12749 Saccharomyces c...    28   4.9  
Sklu_2324.8 YFR051C, Contig c2324 10790-12427 reverse complement       28   5.8  
YLR086W (SMC4) [3501] chr12 (302244..306500) Subunit of condensi...    28   7.3  
Scas_715.28d                                                           27   8.2  

>YER163C (YER163C) [1591] chr5 complement(503079..503777) Member of
           the ChaC-like protein family, has moderate similarity to
           uncharacterized C. albicans Orf6.7p [699 bp, 232 aa]
          Length = 232

 Score =  471 bits (1213), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 229/229 (100%), Positives = 229/229 (100%)

Query: 1   MTNDNSGIWVLGYGSLIYKPPSHYTHRIPAIIHGFARRFWQSSTDHRGTPANPGRVATLI 60
           MTNDNSGIWVLGYGSLIYKPPSHYTHRIPAIIHGFARRFWQSSTDHRGTPANPGRVATLI
Sbjct: 1   MTNDNSGIWVLGYGSLIYKPPSHYTHRIPAIIHGFARRFWQSSTDHRGTPANPGRVATLI 60

Query: 61  PYEDIIRQTAFLKNVNLYSESAPIQDPDDLVTIGVVYYIPPEHAQEVREYLNVREQNGYT 120
           PYEDIIRQTAFLKNVNLYSESAPIQDPDDLVTIGVVYYIPPEHAQEVREYLNVREQNGYT
Sbjct: 61  PYEDIIRQTAFLKNVNLYSESAPIQDPDDLVTIGVVYYIPPEHAQEVREYLNVREQNGYT 120

Query: 121 LHEVEVHLETNREHEAELGEALEQLPRHNKSGKRVLLTSVYIGTIDNEAFVGPETVDETA 180
           LHEVEVHLETNREHEAELGEALEQLPRHNKSGKRVLLTSVYIGTIDNEAFVGPETVDETA
Sbjct: 121 LHEVEVHLETNREHEAELGEALEQLPRHNKSGKRVLLTSVYIGTIDNEAFVGPETVDETA 180

Query: 181 KVIAVSHGPSGSNYEYLAKLEQALAQMPIMKERGRITDHYLTALLETVN 229
           KVIAVSHGPSGSNYEYLAKLEQALAQMPIMKERGRITDHYLTALLETVN
Sbjct: 181 KVIAVSHGPSGSNYEYLAKLEQALAQMPIMKERGRITDHYLTALLETVN 229

>CAGL0L11748g complement(1252608..1253318) similar to sp|P32656
           Saccharomyces cerevisiae YER163c, start by similarity
          Length = 236

 Score =  276 bits (706), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 174/234 (74%), Gaps = 9/234 (3%)

Query: 1   MTNDNSGIWVLGYGSLIYKPPSHYTHRIPAIIHGFARRFWQSSTDHRGTPANPGRVATLI 60
           MT +  GIWVLGYGSLIYKPP HYTHRIPA+I+GF RRFWQSS DHRGTP +PGRV TLI
Sbjct: 1   MTVEKCGIWVLGYGSLIYKPPPHYTHRIPAVIYGFMRRFWQSSVDHRGTPDSPGRVVTLI 60

Query: 61  PYEDIIRQTAFLKN-VNLYSESAPIQD--PDDLVTIGVVYYIPPEHAQEVREYLNVREQN 117
           P+++I++   FL++ V   +   PI +  P+DL TIGVVYYIP + A EVREYL+VREQN
Sbjct: 61  PHDEIMKTPRFLQDYVKYENHGNPITNLQPNDLHTIGVVYYIPADRADEVREYLDVREQN 120

Query: 118 GYTLHEVEVHLETNREHEA--ELGEALEQLPRHNKSGKRVLLTSVYIGTIDNEAFVGPET 175
           GYTLHEVEVHL+      +  EL  A+ QLP H  +GK+VL T+VYIGT+ NEAFVGPET
Sbjct: 121 GYTLHEVEVHLDLTESDSSDQELMAAIHQLPEHETTGKKVLTTNVYIGTVSNEAFVGPET 180

Query: 176 VDETAKVIAVSHGPSGSNYEYLAKLEQALAQMPIMKERGRITDHYLTALLETVN 229
           +++TA VIA + GPSG+N++YL  L +++A M   +E    TD YL  L + VN
Sbjct: 181 IEQTASVIATNVGPSGTNFDYLRMLCESMASMKTCEE----TDKYLEHLFKEVN 230

>Sklu_879.2 YER163C, Contig c879 312-1013 reverse complement
          Length = 233

 Score =  270 bits (691), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 133/230 (57%), Positives = 169/230 (73%), Gaps = 4/230 (1%)

Query: 1   MTNDNSGIWVLGYGSLIYKPPSHYTHRIPAIIHGFARRFWQSSTDHRGTPANPGRVATLI 60
           MT D  GIWVLGYGSLIYKPP HY HRIP II+GF RRFWQSS+DHRGTP +PGRVATLI
Sbjct: 1   MTQDK-GIWVLGYGSLIYKPPPHYRHRIPGIIYGFKRRFWQSSSDHRGTPQSPGRVATLI 59

Query: 61  PYEDIIRQTAFLKNVNLYSESAPIQDPDDLVTIGVVYYIPPEHAQEVREYLNVREQNGYT 120
            Y+DI++   FLK++  Y +S  ++  +DL   GV YYIPP++AQEV +YLNVREQ+GY+
Sbjct: 60  AYDDIVKHPKFLKDLYHYKKSK-VEKAEDLSIFGVAYYIPPQYAQEVTDYLNVREQDGYS 118

Query: 121 LHEVEVHLETNREHEAELGEALEQLPRHNKSGKRVLLTSVYIGTIDNEAFVGPETVDETA 180
           +H VE+HLET    E EL ++L  LPRH+ + K VL + VYIGT+DNE+FVGPE +  TA
Sbjct: 119 VHCVEIHLETTLSQEQELRDSLHLLPRHHITNKYVLRSIVYIGTVDNESFVGPEDIKTTA 178

Query: 181 KVIAVSHGPSGSNYEYLAKLEQALAQM--PIMKERGRITDHYLTALLETV 228
            +IA SHGPSG NYEYL  L  +L ++   +  +   + D YL +LL+ V
Sbjct: 179 SIIADSHGPSGPNYEYLKLLHDSLTEVACSLGHKLSDVEDTYLDSLLDHV 228

>Scas_576.4
          Length = 237

 Score =  264 bits (674), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 163/224 (72%), Gaps = 2/224 (0%)

Query: 7   GIWVLGYGSLIYKPPSHYTHRIPAIIHGFARRFWQSSTDHRGTPANPGRVATLIPYEDII 66
           G+WVLGYGSLIYKPP HY +RIPA I+GF RRFWQSS DHRGTP +PGRV TLIPY++I+
Sbjct: 11  GLWVLGYGSLIYKPPPHYKYRIPATIYGFMRRFWQSSIDHRGTPDSPGRVVTLIPYDEIV 70

Query: 67  RQTAFLKNVNLYSES-APIQDPDDLVTIGVVYYIPPEHAQEVREYLNVREQNGYTLHEVE 125
            +  F +++ LYS +   I+  +DL T+GVVYYIP E A +VREYL+VREQNGYTLHEVE
Sbjct: 71  SRPEFSQDLKLYSPNFDDIKGANDLTTLGVVYYIPTEFADQVREYLDVREQNGYTLHEVE 130

Query: 126 VHLETNREHEAELGEALEQLPRHNKSGKRVLLTSVYIGTIDNEAFVGPETVDETAKVIAV 185
           VHL T  E E  L   L +LP HN++ KR+L T+VYIGT+ NEAFVGPE + +TAKVI+ 
Sbjct: 131 VHLNTTGEQERALKHVLCKLPFHNETKKRILKTNVYIGTVTNEAFVGPEAIHDTAKVIST 190

Query: 186 SHGPSGSNYEYLAKLEQALAQMPIMKERGRITDHYLTALLETVN 229
           S GPSG N EYL  L  ++  M    E    +D YL  LL  V+
Sbjct: 191 SRGPSGPNIEYLKLLHDSIEFMS-DNELLPTSDIYLNKLLRQVD 233

>KLLA0C11649g complement(1005591..1006307) similar to sp|P32656
           Saccharomyces cerevisiae YER163c singleton, start by
           similarity
          Length = 238

 Score =  236 bits (603), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 156/228 (68%), Gaps = 3/228 (1%)

Query: 1   MTNDNSGIWVLGYGSLIYKPPSHYTHRIPAIIHGFARRFWQSSTDHRGTPANPGRVATLI 60
           MT  + GIWV+GYGSLIYKPP H+ +++  I++GF RRFWQSS DHRGTP +PGRVATLI
Sbjct: 1   MTKGSEGIWVVGYGSLIYKPPPHWKYKVNGIVYGFKRRFWQSSIDHRGTPDSPGRVATLI 60

Query: 61  PYEDIIRQTAFLKNVNLYSESAPIQDPDDLVTIGVVYYIPPEHAQEVREYLNVREQNGYT 120
           P++ I     F K++  ++ S  +   DDL  + V YYIPPEHAQ V E+L+VRE+NGYT
Sbjct: 61  PFDGITNNAEFEKDLRTWN-SKVVAKQDDLKLLAVAYYIPPEHAQFVTEHLDVREKNGYT 119

Query: 121 LHEVEVHLETNREHEAELGEALEQLPRHNKSGKRVLLTSVYIGTIDNEAFVGPETVDETA 180
            H + +HL+  +    EL   L +LP H  +GK +L + VYIGT DNEAF+GPE ++ TA
Sbjct: 120 AHRIFIHLQPPKSEPLELQALLHKLPVHETTGKHILDSLVYIGTSDNEAFIGPEDINVTA 179

Query: 181 KVIAVSHGPSGSNYEYLAKLEQALAQMP--IMKERGRITDHYLTALLE 226
           KVI+ + GPSG NYEYL  L  +L +M   + +    I D YL +LL+
Sbjct: 180 KVISHNLGPSGPNYEYLKLLHDSLTEMADELGQSLEEIEDSYLDSLLK 227

>AFR184C [3376] [Homologous to ScYER163C - NSH] (772555..773211)
           [657 bp, 218 aa]
          Length = 218

 Score =  187 bits (475), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 128/231 (55%), Gaps = 27/231 (11%)

Query: 1   MTNDNSGIWVLGYGSLIYKPPSHYTHRIPAIIHGFARRFWQSSTDHRGTPANPGRVATLI 60
           M   + G WV+GYGSLIYKPP HY+ R+  ++HGF RRFWQSS+DHRGTP  PGRVATL+
Sbjct: 1   MNPVHGGAWVVGYGSLIYKPPPHYSQRVIGVVHGFRRRFWQSSSDHRGTPELPGRVATLV 60

Query: 61  PYEDIIRQTAFLKNVNLYSESAPIQDPDDLVTIGVVYYIPPEHAQEVREYLNVREQNGYT 120
           P  D                            + V Y+IP  H   V  YL+VREQ+GY 
Sbjct: 61  PAADA-------------------------RLLVVAYFIPAAHVAAVTAYLDVREQDGYL 95

Query: 121 LHEVEVHLETNREHEAELGEALEQLPRHNKSGKRVLLTSVYIGTIDNEAFVGPETVDETA 180
              V VHL    +   EL +AL+ LP  + SG  V+ + +YIG  D   FVGPE +  TA
Sbjct: 96  PQTVPVHLVAPPQPPHELRDALDALPCDSVSGLPVVQSVIYIGIPDAATFVGPEELQRTA 155

Query: 181 KVIAVSHGPSGSNYEYLAKLEQALAQMP--IMKERGRITDHYLTALLETVN 229
            VIA +HGPSG NYEYL  L  AL  +          + DHYL  LLE V+
Sbjct: 156 AVIAHNHGPSGPNYEYLKLLHSALHSIAETFGARLCELEDHYLDELLEAVD 206

>KLLA0A03531g 320828..323026 similar to sp|P06103 Saccharomyces
           cerevisiae YOR361c PRT1 translation initiation factor
           eIF3 subunit singleton, start by similarity
          Length = 732

 Score = 29.3 bits (64), Expect = 3.2,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 59/131 (45%), Gaps = 19/131 (14%)

Query: 86  DPDDLVTIGVVYYIPPEHAQEVREYLN-------VREQNGYTLHEVEVHLETNREHEAEL 138
           DP  L+     Y+ P  + Q  + +L        V+  N   +  V +H      HE + 
Sbjct: 353 DPTTLLA----YWTPETNNQSCKAFLMTLPNKRIVKTVNLVQVSNVSIHW-----HE-QA 402

Query: 139 GEALEQLPRHNKSGKRVLLTSVYIGTIDNEAFVGPETVDETAKVIAVSHGPSGSNYEYLA 198
                Q+ RH KS K+   T++ I  + NE+ +  E ++   +V+ ++  P G+ +  ++
Sbjct: 403 DFVCFQVDRHTKS-KKTFFTNLEICKL-NESEIPVEKIEMKDRVLELAWEPKGTRFVTIS 460

Query: 199 KLEQALAQMPI 209
           K++    + P+
Sbjct: 461 KMDNGGEENPM 471

>CAGL0H05071g 486899..490231 similar to sp|Q12749 Saccharomyces
           cerevisiae YLR383w RHC18, hypothetical start
          Length = 1110

 Score = 28.5 bits (62), Expect = 4.9,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 120 TLHEVEVHLETNREHEAELGEALEQLPRHNKSGKRVLLTSVYIG 163
           TLH    H    R  + ELG  L  +   N SGK  +LT++ IG
Sbjct: 84  TLHNFMCH----RNFDVELGPGLNFIVGKNGSGKSAILTAITIG 123

>Sklu_2324.8 YFR051C, Contig c2324 10790-12427 reverse complement
          Length = 545

 Score = 28.5 bits (62), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 57/140 (40%), Gaps = 26/140 (18%)

Query: 86  DPDDLVTIGVVYYIPPEHAQEVREYLNVREQNGYTLHEVEVHLETNREHEAELGEALEQL 145
           D + L+ + V  ++ P  + E              + +V V  E N ++E EL +    +
Sbjct: 393 DDNSLIPLEVSTWVSPSSSNE-------------GMFDVTVEFEVNPDYEQELKDLRFAV 439

Query: 146 PRHNKSGKRVLLTSVYIGTIDNEAFVGPETVDETAKVI----AVSHGPSGS-NYEYLAKL 200
           P        V   +VYI   +NE+    + +DE   VI    +++ G SG   +   A  
Sbjct: 440 P--------VFTENVYINDENNESGASIKEIDEEQGVIIGVDSIAPGNSGVFGFVVEAGF 491

Query: 201 EQALAQMPIMKERGRITDHY 220
           E AL  M +  +   ++  +
Sbjct: 492 EDALFPMTVAFKNTNVSSTF 511

>YLR086W (SMC4) [3501] chr12 (302244..306500) Subunit of condensin
           protein complex required for proper chromosome
           condensation and segregation, coiled-coil protein of the
           SMC family [4257 bp, 1418 aa]
          Length = 1418

 Score = 28.1 bits (61), Expect = 7.3,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 4/42 (9%)

Query: 101 PEHAQEVREYLNVREQN----GYTLHEVEVHLETNREHEAEL 138
           PE   ++   L+ RE N      T+HE+E  L+  R+HE +L
Sbjct: 848 PEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDL 889

>Scas_715.28d
          Length = 95

 Score = 26.6 bits (57), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 11/55 (20%)

Query: 50 PANPGRVATLIPYEDIIRQTA----------FLK-NVNLYSESAPIQDPDDLVTI 93
          PA P R+  L  Y+  IR +           FL+ +   + E+APIQD + +  +
Sbjct: 2  PATPSRLQVLSLYKQFIRNSNQFNNFNFREYFLRISREKFKENAPIQDKEKVAKL 56

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,956,685
Number of extensions: 335585
Number of successful extensions: 867
Number of sequences better than 10.0: 16
Number of HSP's gapped: 861
Number of HSP's successfully gapped: 16
Length of query: 229
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 131
Effective length of database: 13,203,545
Effective search space: 1729664395
Effective search space used: 1729664395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)