Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER162C (RAD4)75474137600.0
CAGL0L11726g82574219840.0
Scas_576.377973919190.0
Kwal_56.2341772371115540.0
AGR162C76359813641e-178
KLLA0F14465g76775513101e-170
CAGL0H07293g6686541444e-09
YDR314C6922711257e-07
Sklu_2426.26642721016e-04
CAGL0H05753g348149950.002
ABR193W350119890.011
Kwal_27.12204368119890.012
KLLA0E17919g1099114770.46
YPL096W (PNG1)363119750.54
Scas_700.2351117750.56
Kwal_47.1795243682702.6
Sklu_1929.21154119685.0
CAGL0J08591g1196113668.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER162C
         (741 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER162C (RAD4) [1590] chr5 complement(500625..502889) Component ...  1452   0.0  
CAGL0L11726g complement(1249886..1252363) similar to sp|P14736 S...   768   0.0  
Scas_576.3                                                            743   0.0  
Kwal_56.23417                                                         603   0.0  
AGR162C [4473] [Homologous to ScYER162C (RAD4) - SH] (1049961..1...   530   e-178
KLLA0F14465g 1341764..1344067 weakly similar to sp|P14736 Saccha...   509   e-170
CAGL0H07293g 713669..715675 similar to tr|Q06665 Saccharomyces c...    60   4e-09
YDR314C (YDR314C) [1142] chr4 complement(1090426..1092504) Membe...    53   7e-07
Sklu_2426.2 YDR314C, Contig c2426 795-2789 reverse complement          44   6e-04
CAGL0H05753g complement(569862..570908) similar to tr|Q02890 Sac...    41   0.002
ABR193W [787] [Homologous to ScYPL096W (PNG1) - SH] complement(7...    39   0.011
Kwal_27.12204                                                          39   0.012
KLLA0E17919g complement(1582644..1585943) weakly similar to sp|Q...    34   0.46 
YPL096W (PNG1) [5348] chr16 (366922..368013) Peptide:N-glycanase...    33   0.54 
Scas_700.2                                                             33   0.56 
Kwal_47.17952                                                          32   2.6  
Sklu_1929.2 YJR041C, Contig c1929 1685-5149 reverse complement         31   5.0  
CAGL0J08591g complement(847505..851095) similar to tr|Q12466 Sac...    30   8.9  

>YER162C (RAD4) [1590] chr5 complement(500625..502889) Component of
           the nucleotide excision repairosome, homolog of human
           XPC xeroderma pigmentosum gene product [2265 bp, 754 aa]
          Length = 754

 Score = 1452 bits (3760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 711/741 (95%), Positives = 711/741 (95%)

Query: 1   MNEDLPKEYFELIRKALNEKEAEKAPLSRRRRVRRKNQPLPDAKKKFKTGLNELPRESVV 60
           MNEDLPKEYFELIRKALNEKEAEKAPLSRRRRVRRKNQPLPDAKKKFKTGLNELPRESVV
Sbjct: 1   MNEDLPKEYFELIRKALNEKEAEKAPLSRRRRVRRKNQPLPDAKKKFKTGLNELPRESVV 60

Query: 61  TVNLDSSDDGVVTVPTDDSVXXXXXXXXXXXXXXXXXVTDGNEVAGVEDISVEIKPSSKR 120
           TVNLDSSDDGVVTVPTDDSV                 VTDGNEVAGVEDISVEIKPSSKR
Sbjct: 61  TVNLDSSDDGVVTVPTDDSVEEIQSSEEDYDSEEFEDVTDGNEVAGVEDISVEIKPSSKR 120

Query: 121 NSDARRTSRNVCSNEERKRRKYFHMLYLVCLMVHGFIRNEWINSKRLSRKLSNLVPEKVF 180
           NSDARRTSRNVCSNEERKRRKYFHMLYLVCLMVHGFIRNEWINSKRLSRKLSNLVPEKVF
Sbjct: 121 NSDARRTSRNVCSNEERKRRKYFHMLYLVCLMVHGFIRNEWINSKRLSRKLSNLVPEKVF 180

Query: 181 ELLHPQKDEELPLRSTRKLLDGLKKCMELWQKHWKITKKYDNEGLYMRTWKEIEMSANNK 240
           ELLHPQKDEELPLRSTRKLLDGLKKCMELWQKHWKITKKYDNEGLYMRTWKEIEMSANNK
Sbjct: 181 ELLHPQKDEELPLRSTRKLLDGLKKCMELWQKHWKITKKYDNEGLYMRTWKEIEMSANNK 240

Query: 241 RKFKTLKRSDFLRAVSKGHGDPDISVQGFVAMLRACNVNARLIMSCQPPDFTNMKIDTSL 300
           RKFKTLKRSDFLRAVSKGHGDPDISVQGFVAMLRACNVNARLIMSCQPPDFTNMKIDTSL
Sbjct: 241 RKFKTLKRSDFLRAVSKGHGDPDISVQGFVAMLRACNVNARLIMSCQPPDFTNMKIDTSL 300

Query: 301 NGNNAYKDMVKYPIFWCEVWDKFSKKWITVDPVNLKTIEQVRLHSKLAPKGVACCERNML 360
           NGNNAYKDMVKYPIFWCEVWDKFSKKWITVDPVNLKTIEQVRLHSKLAPKGVACCERNML
Sbjct: 301 NGNNAYKDMVKYPIFWCEVWDKFSKKWITVDPVNLKTIEQVRLHSKLAPKGVACCERNML 360

Query: 361 RYVIAYDRKYGCRDVTRRYAQWMNSKVRKRRITKDDFGEKWFRKVITALHHRKRTKIDDY 420
           RYVIAYDRKYGCRDVTRRYAQWMNSKVRKRRITKDDFGEKWFRKVITALHHRKRTKIDDY
Sbjct: 361 RYVIAYDRKYGCRDVTRRYAQWMNSKVRKRRITKDDFGEKWFRKVITALHHRKRTKIDDY 420

Query: 421 EDQYFFQRDESEGIPDSVQDLKNHPYYVLEQDIKQTQIVKPGCKECGYXXXXXXXXXXXX 480
           EDQYFFQRDESEGIPDSVQDLKNHPYYVLEQDIKQTQIVKPGCKECGY            
Sbjct: 421 EDQYFFQRDESEGIPDSVQDLKNHPYYVLEQDIKQTQIVKPGCKECGYLKVHGKVGKVLK 480

Query: 481 XYAKRDIADLKSARQWYMNGRILKTGSRCKKVIKRTVGRPKGEAEEEDERLYSFEDTELY 540
            YAKRDIADLKSARQWYMNGRILKTGSRCKKVIKRTVGRPKGEAEEEDERLYSFEDTELY
Sbjct: 481 VYAKRDIADLKSARQWYMNGRILKTGSRCKKVIKRTVGRPKGEAEEEDERLYSFEDTELY 540

Query: 541 IPPLASASGEITKNTFGNIEVFAPTMIPGNCCLVENPVAIKAARFLGVEFAPAVTSFKFE 600
           IPPLASASGEITKNTFGNIEVFAPTMIPGNCCLVENPVAIKAARFLGVEFAPAVTSFKFE
Sbjct: 541 IPPLASASGEITKNTFGNIEVFAPTMIPGNCCLVENPVAIKAARFLGVEFAPAVTSFKFE 600

Query: 601 RGSTVKPVLSGIVVAKWLREAIETAIDGIEFIQEDDNRKEHLLGALESWNTLLLKLRIRS 660
           RGSTVKPVLSGIVVAKWLREAIETAIDGIEFIQEDDNRKEHLLGALESWNTLLLKLRIRS
Sbjct: 601 RGSTVKPVLSGIVVAKWLREAIETAIDGIEFIQEDDNRKEHLLGALESWNTLLLKLRIRS 660

Query: 661 KLNSTYGKIAEEEPNVTKEQNIADNHDNTETFMGGGFLPGIANHEARPYSEPSEPEDSLD 720
           KLNSTYGKIAEEEPNVTKEQNIADNHDNTETFMGGGFLPGIANHEARPYSEPSEPEDSLD
Sbjct: 661 KLNSTYGKIAEEEPNVTKEQNIADNHDNTETFMGGGFLPGIANHEARPYSEPSEPEDSLD 720

Query: 721 YVSVDKAEESATDDDVGEDYS 741
           YVSVDKAEESATDDDVGEDYS
Sbjct: 721 YVSVDKAEESATDDDVGEDYS 741

>CAGL0L11726g complement(1249886..1252363) similar to sp|P14736
           Saccharomyces cerevisiae YER162c RAD4 excision repair
           protein, start by similarity
          Length = 825

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/742 (50%), Positives = 502/742 (67%), Gaps = 36/742 (4%)

Query: 2   NEDLPKEYFELIRKALNEK--EAEKAPLSRRRRVRRKNQPLPDAKKKFKTGLNELPRESV 59
           ++ +P EYF+LIR  L  K    ++ PL RR+R R     L    +      N  P E+ 
Sbjct: 3   SDQIPSEYFDLIRDVLKNKGDATQERPLKRRKRRRAVTSELESGYE------NPQPTEAK 56

Query: 60  VTVNLDSSDD--------GVVTVPTDDSVXXXXXXXXXXXXXXXXXVTDGNEVAGVE--- 108
           + VNLDS  +          +++ +D  V                   +  +V+  E   
Sbjct: 57  IVVNLDSDPELEDKLGASNTISLVSDGEVQHTEASEDGAESDEAYESEEFEDVSADEMQM 116

Query: 109 ---DISVEI---KPSSKRNSDARRTSRNVCSNEERKRRKYFHMLYLVCLMVHGFIRNEWI 162
              ++SV I   K  S+   ++ +  +N+CSNE+RK R + H LYL+CLM HG I N W+
Sbjct: 117 PSDNLSVTINVNKKDSQSKKESSKIQKNMCSNEDRKFRTHMHCLYLLCLMCHGHIINHWL 176

Query: 163 NSKRLSRKLSNLVPEKVFELLHPQKDEELPLRSTRKLLDGLKKCMELWQKHWKITKKYDN 222
           N+ +++RKLS ++PEKVF++LHP+KDEELPLRSTRKLLDGLKK ME+WQKHW+I ++Y  
Sbjct: 177 NNSKMNRKLSGMIPEKVFDMLHPEKDEELPLRSTRKLLDGLKKAMEIWQKHWRIMQRYKG 236

Query: 223 EGLYMRTWKEIEMSANNKRKFKTLKRSDFLRAVSKGHGDPDISVQGFVAMLRACNVNARL 282
              YMR W E+++   ++   KTL ++DF++ + KG GD D++ QGFVA+LR+CNVNARL
Sbjct: 237 VNCYMRYWDELQICDKSR---KTLTKNDFIKGILKGVGDRDVATQGFVALLRSCNVNARL 293

Query: 283 IMSCQPPDFTNMKIDTSLNGNNAYKDMVKYPIFWCEVWDKFSKKWITVDPVNLKTIEQVR 342
           +MSCQPPDFTN+K         +Y+DM KYP+FWCEVWDKFSKKWIT+DP   KTIEQVR
Sbjct: 294 VMSCQPPDFTNLKKSYGTEKKVSYEDMTKYPVFWCEVWDKFSKKWITIDPFCKKTIEQVR 353

Query: 343 LHSKLAPKGVACCERNMLRYVIAYDRKYGCRDVTRRYAQWMNSKVRKRRITKDDFGEKWF 402
           L SK  P+GV+ C+RN +RYVI +DRK GCRD+TRRY QW NSK RK+RITK+ FGE+W+
Sbjct: 354 LSSKFEPRGVSPCKRNAMRYVIGFDRKEGCRDITRRYCQWFNSKTRKKRITKEAFGERWY 413

Query: 403 RKVITALHHRKRTKIDDYEDQYFFQRDESEGIPDSVQDLKNHPYYVLEQDIKQTQIVKPG 462
            +V+ +LH RKRTKIDDYED YF QR++ EG+PD++QD K HPYYVLE+DI+Q Q++K G
Sbjct: 414 ERVLASLHKRKRTKIDDYEDAYFDQRNQDEGMPDNMQDFKGHPYYVLEKDIRQNQVLKSG 473

Query: 463 CKECGYXXXXXXXXXXXXXYAKRDIADLKSARQWYMNGRILKTGSRCKKVIKRTVGRPKG 522
           CKECGY             Y+K+DI DLKSA+QWYM GRILKTG+R  K +++  GR   
Sbjct: 474 CKECGYLKLHNKTNQVLKVYSKKDIIDLKSAKQWYMEGRILKTGARALKTVEKKRGRFTD 533

Query: 523 EAEEEDERLYSFEDTELYIPPLASASGEITKNTFGNIEVFAPTMIPGNCCLVENPVAIKA 582
             E+E+ERLY F+DTELY+ PLA+ SGEI  NTFGNIEVF P+MIP NCCLVE+PVAIKA
Sbjct: 534 PEEQEEERLYQFDDTELYVAPLATRSGEIETNTFGNIEVFVPSMIPANCCLVESPVAIKA 593

Query: 583 ARFLGVEFAPAVTSFKFERGSTVKPVLSGIVVAKWLREAIETAIDGIEFIQEDDNRKEHL 642
           A F+ ++FA AVT+FKFE+G +VKP ++G+VVA W R+A+  AIDGI     ++   EH 
Sbjct: 594 ASFIRIKFAKAVTAFKFEKGRSVKPSITGVVVALWFRDALVAAIDGITQANAEEKHIEHE 653

Query: 643 LGALESWNTLLLKLRIRSKLNSTYGKIAEEEPNVTKEQNIADNHDNTET--------FMG 694
           L AL  W+ L+ KLRI++KLNS YGK+ EEE +    Q +  N  + ET        F  
Sbjct: 654 LEALSYWHNLITKLRIKNKLNSEYGKVNEEESSTVVSQPLIANRFDEETSMTDSGDEFPQ 713

Query: 695 GGFLPGIANHEARPYSEPSEPE 716
           GGFLP   NH+   ++E S+ E
Sbjct: 714 GGFLPTDINHDGTSHNETSDNE 735

>Scas_576.3
          Length = 779

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/739 (52%), Positives = 489/739 (66%), Gaps = 42/739 (5%)

Query: 1   MNEDLPKEYFELIRKAL----NEKEAEKAPLSRRRRVRRKNQPLPDAKKKFKTGLNELPR 56
           MN+DLPKEYFELIR AL    +E + E+    R+RR R     +P+  ++  T     P 
Sbjct: 1   MNDDLPKEYFELIRTALRNKKDEPQEERQLKKRKRRTRTTATSVPEKHEEQTTLDLSSPI 60

Query: 57  ESVVTVNLDSSD-----DGVVTVPTDDSVXXXXXXXXXXXXXXXXXVTDGNEV-AGVEDI 110
           +      L S +      G  +  ++  +                 VT+ N     + DI
Sbjct: 61  DKYSNTQLKSPERKEEHAGEASNSSNTEIQDEDDDDENYNSDDFEDVTENNSTDENINDI 120

Query: 111 SVEIKPSSKRNSDARRT--SRNVCSNEERKRRKYFHMLYLVCLMVHGFIRNEWINSKRLS 168
           S+ I+  +KRN    +T  +RNVCS E+R RR  FHM  L+CLMVHG++RNEW+NS +  
Sbjct: 121 SITIEDPTKRNEAKGKTASTRNVCSREDRDRRYAFHMADLLCLMVHGYLRNEWLNSSKFI 180

Query: 169 RKLSNLVPEKVFELLHPQKDEELPLRSTRKLLDGLKKCMELWQKHWKITKKYDNEGLYMR 228
            KLS LVPEKVF+LLHP KDEELPLRSTRKLLDGLKK MELW KHWKI +KY+    YM+
Sbjct: 181 VKLSKLVPEKVFQLLHPVKDEELPLRSTRKLLDGLKKTMELWNKHWKILQKYEGVACYMK 240

Query: 229 TWKEIEMSANNKRKFKTLKRSDFLRAVSKGHGDPDISVQGFVAMLRACNVNARLIMSCQP 288
           +W EI  S      F  L +  F+R V KG GD DI+ QG+VA+LRACNVNARLIMSCQP
Sbjct: 241 SWDEITTSTKPNSPF-FLSKKQFIRQVIKGQGDRDIAAQGYVALLRACNVNARLIMSCQP 299

Query: 289 PDFTNMK-----IDTSLNGNNAYKDMVKYPIFWCEVWDKFSKKWITVDPVNLKTIEQVRL 343
           PD T++K     ID        Y DMVKYPIFWCEVWDKF+KKWIT+D +N   IEQV+ 
Sbjct: 300 PDITDLKEKCKPIDID------YDDMVKYPIFWCEVWDKFAKKWITIDCMNFHIIEQVKH 353

Query: 344 HSKLAPKGVACCERNMLRYVIAYDRKYGCRDVTRRYAQWMNSKVRKRRITKDDFGEKWFR 403
            SKL P GVACC+RN LRYVI YDRK GCRDVTRRYA+W N+K RK+RITK+  GE+WF 
Sbjct: 354 RSKLEPHGVACCKRNNLRYVIGYDRKNGCRDVTRRYAEWYNAKTRKKRITKEPKGEEWFN 413

Query: 404 KVITALHHRKRTKIDDYEDQYFFQRDESEGIPDSVQDLKNHPYYVLEQDIKQTQIVKPGC 463
           KV+T LH RKRTKIDDYED Y  QRD  E +PD++QDLKNHPYY+LE D+++ Q++KPG 
Sbjct: 414 KVLTTLHRRKRTKIDDYEDAYLEQRDYDEAMPDNLQDLKNHPYYILETDLRRNQVLKPGS 473

Query: 464 KECGYXXXX----XXXXXXXXXYAKRDIADLKSARQWYMNGRILKTGSRCKKVIKRTVGR 519
           KE GY                 Y +++I DLKSARQWYM GR+LKTGSR  K +KR   R
Sbjct: 474 KESGYLHLQGSKSKNKNKLLKVYERKNILDLKSARQWYMEGRVLKTGSRSLKTVKRRAMR 533

Query: 520 PKGEAEEEDERLYSFEDTELYIPPLASASGEITKNTFGNIEVFAPTMIPGNCCLVENPVA 579
           P  + EE++ERLYS +DT LY+PPLA++ GEIT N +GNIEVF PTMIPGNCCL+E+P A
Sbjct: 534 PSLDDEEDEERLYSIDDTVLYVPPLATSDGEITPNAYGNIEVFVPTMIPGNCCLIESPYA 593

Query: 580 IKAARFLGVEFAPAVTSFKFERGSTVKPVLSGIVVAKWLREAIETAIDGIEFIQEDDNRK 639
           IKAA+FL + +  AVT FKFERG T KP++ G+VVA W R+A+++ IDGIE+  ++D + 
Sbjct: 594 IKAAKFLRINYGRAVTGFKFERGRTSKPIIGGVVVANWYRDAVKSCIDGIEYSVDNDKKL 653

Query: 640 EHLLGALESWNTLLLKLRIRSKLNSTYGKIAEEEPNVTKEQNIADNHDNTETFMGGGFLP 699
           E  L +L  W+TLL KLRI+ KL+  YG + EE  N+    N++D     +   GGGF  
Sbjct: 654 EEELESLRCWHTLLSKLRIKKKLDVIYGTVGEENLNLG---NVSDE----DVAEGGGFF- 705

Query: 700 GIANHEARPYSEPSEPEDS 718
            +   E+ P     EP DS
Sbjct: 706 -VPRTESFP-----EPNDS 718

>Kwal_56.23417
          Length = 723

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/711 (45%), Positives = 437/711 (61%), Gaps = 68/711 (9%)

Query: 5   LPKEYFELIRKALNEKEAEKAPLSRRRRVRRKNQPLPDAKKKFKTGLNELPRESVVTVNL 64
           LP+EYF+L+R+A+  KE ++ P         K + LP    K+++  N++ R + V +NL
Sbjct: 4   LPQEYFDLVRQAV--KEDKQTPRR-------KRRRLP----KYES--NDISRPADVIINL 48

Query: 65  DSSDDGVVTVPT---------------DDSVXXXXXXXXXXXXXXXXXVTDGNEVAGVED 109
           DS  D      +               DD                     + ++   V D
Sbjct: 49  DSDTDNETKFTSEGLSKSFESQSNRDLDDDNEKGSNNGGDYDDDDDDDEFNSDDFEDVSD 108

Query: 110 ISVEIKPSSKRNS--------DARRTSRNVCSNEERKRRKYFHMLYLVCLMVHGFIRNEW 161
             V  + S+   S          +  S+N+ SNEERK R+YFH+L LV LMVHG++RN+W
Sbjct: 109 ADVSEQTSNAELSITLNPQKPQKKTGSKNLVSNEERKYRRYFHLLQLVTLMVHGYVRNQW 168

Query: 162 INSKRLSRKLSNLVPEKVFELLHPQKDEELPLRSTRKLLDGLKKCMELWQKHWKITKKYD 221
           +N  +L +KLS LVP+ VFELLHP++D+ELPLRSTRKLLDGLK+CME+W KH+    +++
Sbjct: 169 LNDAKLHQKLSKLVPDNVFELLHPKRDDELPLRSTRKLLDGLKRCMEIWWKHFDQITRWE 228

Query: 222 NEGLYMRTWKEIEMSANNKRKFKTLKRSDFLRAVSKGHGDPDISVQGFVAMLRACNVNAR 281
             GLYM  W E++       ++ + K   F + V+ G G  +I+ QGFVAMLRAC VNAR
Sbjct: 229 TPGLYMLDWDELDGPWEQPTRYMSQKL--FNKKVAHGKGSSEIAAQGFVAMLRACGVNAR 286

Query: 282 LIMSCQPPDFTNMKIDT--SLNGNNAYKDMV--------------------KYPIFWCEV 319
           LIM+ QPPDFTN K+    SL     Y D                      ++ +FWCEV
Sbjct: 287 LIMNAQPPDFTNNKVSARGSLKTPGEYLDKTDMRPKRRKKAKGGQRDPDAKRHVLFWCEV 346

Query: 320 WDKFSKKWITVDPVNLKTIEQVRLHSKLAPKGVACCERNMLRYVIAYDRKYGCRDVTRRY 379
           WDK SKKWITVDP+  +TIEQ+R  + L P+G A    N+ RY+IAYDRK GCRDVTRRY
Sbjct: 347 WDKVSKKWITVDPMGQRTIEQIRYKTALDPQGSAK-RNNLFRYIIAYDRKLGCRDVTRRY 405

Query: 380 AQWMNSKVRKRRITKDDFGEKWFRKVITALHHRKRTKIDDYEDQYFFQRDESEGIPDSVQ 439
               NSK RKRRIT+D  GEKW ++V+  LH RKRT+ DD+ED YF QRDE+EGIPD++Q
Sbjct: 406 TTHFNSKTRKRRITRDAEGEKWMKRVLARLHQRKRTRTDDFEDAYFRQRDETEGIPDNMQ 465

Query: 440 DLKNHPYYVLEQDIKQTQIVKPGCKECGYXXXXXXXXXXXXXYAKRDIADLKSARQWYMN 499
           DLKNHPYYVL+ D K  +++K GCKECG+             Y + D+  LK+AR WY  
Sbjct: 466 DLKNHPYYVLQNDFKWNEVLKSGCKECGF--LRTKNNTSLKVYRREDVLVLKTARTWYTE 523

Query: 500 GRILKTGSRCKKVIKRTVGRPKGEAEEEDERLYSFEDTELYIPPLASASGEITKNTFGNI 559
           GR+LK G+     +K T  R     E  +ERLY+F++TEL+IP     + E+  N +GNI
Sbjct: 524 GRVLKPGA---SALKTTKSRDFKTGEATEERLYAFDETELFIPEDLGPNNEVPTNVYGNI 580

Query: 560 EVFAPTMIPGNCCLVENPVAIKAARFLGVEFAPAVTSFKFERGSTVKPVLSGIVVAKWLR 619
           +++  +MIP   CL+E+PVA+KAA  LG+EFA AVT FKFE+    KP ++GIVV++  R
Sbjct: 581 DIYTSSMIPRGSCLIESPVAVKAAACLGIEFAKAVTGFKFEKKRVAKPQITGIVVSQEYR 640

Query: 620 EAIETAIDGIEFIQEDDNRKEHLLGALESWNTLLLKLRIRSKLNSTYGKIA 670
           EA+E+ IDG+E+  E+D R+E  L AL+ WN  L KLRI+ +LN+T+GK++
Sbjct: 641 EAVESMIDGVEYSLEEDERQERELEALQHWNLFLAKLRIKQRLNTTHGKVS 691

>AGR162C [4473] [Homologous to ScYER162C (RAD4) - SH]
           (1049961..1052252) [2292 bp, 763 aa]
          Length = 763

 Score =  530 bits (1364), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 261/598 (43%), Positives = 368/598 (61%), Gaps = 27/598 (4%)

Query: 131 VCSNEERKRRKYFHMLYLVCLMVHGFIRNEWINSKRLSRKLSNLVPEKVFELLHPQKDEE 190
           V  +E R  R+ FHML++  L+ H  +RN W+N  RL  +L+ LVP++V+  +HP++DE+
Sbjct: 144 VVDSETRAFRRSFHMLHVAALLAHYHVRNTWLNDGRLQSRLAALVPDEVYASMHPERDEQ 203

Query: 191 LPLRSTRKLLDGLKKCMELWQKHWKITKKYDNEGLYMRTWKEIEMSANNKRKFKTLKRSD 250
           LPLRSTRKLLD L+KCM+LW+KH K     D  GLYMR W ++    ++      L R  
Sbjct: 204 LPLRSTRKLLDALRKCMKLWEKHCKRIIGRDG-GLYMRPWAQLGQRYSSGAAL--LTRKA 260

Query: 251 FLRAVSKGHGDP-DISVQGFVAMLRACNVNARLIMSCQPPDFTNMKIDTSLNGNNAYKDM 309
           F RA+ KG   P  ++ +GFVA+LR C +NARL+ S QPPD T+MK      G++   D 
Sbjct: 261 FNRALQKGAPMPRSVAQEGFVALLRGCGLNARLVASLQPPDLTDMKPAGDARGSDPPGDS 320

Query: 310 ------VKYPIFWCEVWDKFSKKWITVDPVNLKTIEQVRLHSKLAPKGVACCERNMLRYV 363
                  ++P+ WCEVWD++SK WITVDP+  + +EQVR  SKL P G      N +RYV
Sbjct: 321 EDDTDKYEFPLVWCEVWDRYSKAWITVDPLCKQLVEQVRNKSKLEPTG-KFARFNQMRYV 379

Query: 364 IAYDRKYGCRDVTRRYAQWMNSKVRKRRITKDDFGEKWFRKVITALHHRKRTKIDDYEDQ 423
           + +DRK GCRD+TRRY    N+KVR+RRIT+D  G  W+  ++ ALH RKR K DDYED+
Sbjct: 380 VGFDRKMGCRDITRRYCAQYNAKVRRRRITRDTHGAAWYDALLRALHQRKRMKTDDYEDE 439

Query: 424 YFFQRDESEGIPDSVQDLKNHPYYVLEQDIKQTQIVKPGCKECGY---XXXXXXXXXXXX 480
           YF +RDE EGIP+++ DL+NHP+YVLE+D++Q +I++P  ++CGY               
Sbjct: 440 YFARRDEVEGIPNNMADLRNHPHYVLEKDLRQHEILRPATEQCGYVRFKTTKRSAGSTLK 499

Query: 481 XYAKRDIADLKSARQWYMNGRILKTGSRCKKVIKRTVGRPKGEAEEEDERLYSFEDTELY 540
            + + DI    S R W++ G++L+   R  K +   + +     E E+ERLY   +TE Y
Sbjct: 500 VFRRTDIVPCYSGRHWFLQGKVLRKNCRAAKTV---IVKDHRTGESEEERLYPESETEPY 556

Query: 541 IPPLASASGEITKNTFGNIEVFAPTMIPGNCCLVENPVAIKAARFLGVEFAPAVTSFKFE 600
           +PP  +  G I  N+FGNI+++ P+MIP  C L+ENP A++AA F+GV FA AVT F FE
Sbjct: 557 VPPPVAPDGTIPTNSFGNIDIYKPSMIPAGCVLIENPNAVRAAAFIGVPFAKAVTGFSFE 616

Query: 601 RGSTVKPVLSGIVVAKWLREAIETAIDGIEFIQEDDNRKEHLLGALESWNTLLLKLRIRS 660
           RG TVKP  SG+VV    R+A+   IDGIE I ++   +E  LGAL+SW  LL +LR++ 
Sbjct: 617 RGRTVKPKFSGVVVQSCYRDAVCAMIDGIETIGDEARMQERELGALQSWALLLAQLRVKQ 676

Query: 661 KLNSTYGKIAEEEPNVTKEQNIADNHDNTETFMGGGFLPGIANH---EARPYSEPSEP 715
           +L   +G ++E   +   E   +D          GGF P  +      + P   PSEP
Sbjct: 677 RLIDRHGAVSEHTSDSDSEPEASDTE-------AGGFFPDDSASPVPRSPPIRAPSEP 727

>KLLA0F14465g 1341764..1344067 weakly similar to sp|P14736
           Saccharomyces cerevisiae YER162c RAD4 excision repair
           protein singleton, start by similarity
          Length = 767

 Score =  509 bits (1310), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 303/755 (40%), Positives = 425/755 (56%), Gaps = 49/755 (6%)

Query: 5   LPKEYFELIRKALNEKEAEKAPLSRRRRVRRKNQPLPDAKKKFKTGLNELPRES---VVT 61
           L +EYF+LI+ AL E+E      S   R RRK + L            EL  ES   V+T
Sbjct: 6   LSREYFDLIKDALQEEEKTGGSGSSSPRKRRKLRSLQKEP--------ELESESNRVVIT 57

Query: 62  VNLDSSDDGVVTVPTDDSVXXXXXXXXXXXXXXXXXVTDGNEVAGVEDISVEIKPSSKRN 121
           +  D  +        DD                     +GN       IS+ I  S+++ 
Sbjct: 58  IESDDEEQNNYDDDDDDDDDDDEYDSEEFEDVTDAPANNGN-------ISITIDTSAQKK 110

Query: 122 SDARRTSRNVCSNEERKR-RKYFHMLYLVCLMVHGFIRNEWINSKRLSRKLSNLVPEKVF 180
           S  ++       +   K  RK  HM  L+ L+ H + RNEW N ++L +KL+ LV + +F
Sbjct: 111 STKKKKKTEHGLDPAVKEFRKTCHMFMLLTLVCHSYQRNEWCNDEKLQKKLAKLVSDDIF 170

Query: 181 ELLHPQKDEELPLRSTRKLLDGLKKCMELWQKHWKI--TKKYDNEGLYMRTWKEIEMSAN 238
             LHPQKD+E+PLRSTRKLLD L+  M+ W K +K+  T  Y+   LYM  W  +     
Sbjct: 171 NNLHPQKDDEMPLRSTRKLLDALRMLMKHWNKKFKLELTSPYEFNHLYMVHWDSVL---- 226

Query: 239 NKRKFKTLKRSDFLRAVSKGHGDPDISVQGFVAMLRACNVNARLIMSCQPPDFTNMKIDT 298
            K K +++    F +  ++  G  +ISVQGFV MLR C +NARLI S QPPDFT+ KI  
Sbjct: 227 -KHKCESVTFKTFKKFFTRMRGPANISVQGFVTMLRGCGLNARLIHSLQPPDFTDSKIYN 285

Query: 299 SLNGNNAYKDMVKYPIFWCEVWDKFSKKWITVDPVNLKTIEQVRLHSKLAPKGVACCERN 358
                +   + +KYPIFWCEVWDKF+K+WIT+D V  + IEQVR  SKL P G      N
Sbjct: 286 KRVVWSLENECLKYPIFWCEVWDKFAKQWITIDIVGQEIIEQVRYKSKLEPIGRINSAFN 345

Query: 359 MLRYVIAYDRKYGCRDVTRRYAQWMNSKVRKRRITKDDFGEKWFRKVITALHHRKRTKID 418
           M+RYVIA+DRK GC+DV+RRY   + +KVRK+RIT++    +WF  +I  L+ R R +ID
Sbjct: 346 MMRYVIAFDRKQGCKDVSRRYIAHLQNKVRKKRITREAKLNEWFNSIIKFLNKRNRNRID 405

Query: 419 DYEDQYFFQRDESEGIPDSVQDLKNHPYYVLEQDIKQTQIVKPGCKECGYXXXXXXXXXX 478
           DYED+YF  R+E EGIPDS+QD+KNHP+YVLE+D++  Q++KPG ++CG+          
Sbjct: 406 DYEDEYFDLRNEHEGIPDSLQDIKNHPFYVLEKDLRANQVLKPGAQQCGFLRLRNKSNSL 465

Query: 479 XXXYAKRDIADLKSARQWYMNGRILKTGSRCKKVIKRTVGRPKGEAEEEDERLYSFEDTE 538
              + ++D+    SAR WYM GR LK+G+  K ++   +  P  E +E++ERLY    TE
Sbjct: 466 LKVFPRKDVISCYSARHWYMQGRALKSGA--KHLLTHKIKNPV-EEDEDEERLYPIGQTE 522

Query: 539 LYIPPLASASGEITKNTFGNIEVFAPTMIPGNCCLVENPVAIKAARFLGVEFAPAVTSFK 598
             IP    A G+I  N +GNI+++ P MIP  CCLVENP +IKAA FL V FA AVT FK
Sbjct: 523 YVIPKQVDADGKIPTNFYGNIDIYKPWMIPIGCCLVENPNSIKAASFLRVPFAKAVTGFK 582

Query: 599 FERGSTVKPVLSGIVVAKWLREAIETAIDGIEFIQEDDNRKEHLLGALESWNTLLLKLRI 658
           FE G  VKP ++G+VV     +A+   I+ IE   +D  R E  L AL  W+ LL KLRI
Sbjct: 583 FESGRRVKPKVTGVVVENEYVDALVAVIENIEECNDDAARHELELEALNGWSLLLTKLRI 642

Query: 659 RSKLNSTYGKIAEEEP---NVTKEQNIADNHDNT----------------ETFMGGGFLP 699
           +S+L   +G +A+E+    +  ++ ++ D+   T                ++ M GGF+P
Sbjct: 643 KSRLVEEHGAVADEDGRDYSGERDSDLEDHESYTGEDTEMGGFEQGGFLLDSNMDGGFVP 702

Query: 700 GIANHEARPYSEPSE-PEDSLDYVSVDKAEESATD 733
                 A   +E  E P  +    ++D+AE S T+
Sbjct: 703 EPELQHAESETEQVEHPPVTYGEATLDRAEPSNTE 737

>CAGL0H07293g 713669..715675 similar to tr|Q06665 Saccharomyces
           cerevisiae YDR314c, hypothetical start
          Length = 668

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 137/654 (20%), Positives = 261/654 (39%), Gaps = 123/654 (18%)

Query: 103 EVAGVEDISVEIKPSSKRNSDARRTSRNVCSNEERKRRKYFHMLYLVCLMVHGFIRNEWI 162
           ++AG  DI+V++K    +N+  +R  ++   N   + R   H++ +  L+     R  W 
Sbjct: 51  DLAG--DITVKLKAPLHQNATNKRRRKD---NFYHRLRYGLHIIAIPILVATLIKRTNWT 105

Query: 163 NSKRLSRKLSNLVPEKVFELLH--PQKDEELPLRSTRKLLDGLKKCMELW---------- 210
             +RL R+L   VP+++ + +    +  +++ + S R LL G    + +W          
Sbjct: 106 QDERLRRRLKRSVPKQITKKVKNWSKSSQDIRISSIRTLLLG----LVMWFRANYQINSN 161

Query: 211 ---QKHWKITKKYD-NEGLYMRTWKEIEMSANNK----RKFKTLKRSDFLRAVSKGHGDP 262
              Q  +++   +  ++G  M+ ++E  +   +K    R        D    V     + 
Sbjct: 162 GFRQNFYRLHYIFRLDDGNVMKPYREACLRDQHKYYGERPDIAGNIEDIRTFVRNKKANR 221

Query: 263 DISVQGFVAMLRACNVNARLIMS---CQPPDFTNMKID----TSLNGNNAYK-------D 308
           D     F+ +LR   + A  I S   C      N +I     T L   +A K       D
Sbjct: 222 DYLTLFFITILREI-LPADQIKSLRLCFSLPLHNFQISPRNITKLASRDAGKVPNRFDTD 280

Query: 309 MVKYPIFWCEVW--DKFSKKWITVDPV-NLKTIEQVRLHSKLAP-------KGVACCERN 358
           +++ P FW E+   D+  K ++ +DPV +++    V+ ++   P       K +      
Sbjct: 281 LLQ-PYFWIELHTIDEPDKLYV-IDPVVHIEEGNIVKKYNIDEPVDIFEPIKDLNLNVNQ 338

Query: 359 MLRYVIAYDRK-YGCRDVTRRYAQWMNSKVRKR------RITKDDFGEKWFRKVITALHH 411
             +YVI+ D K    RDV+ RY   +  +   R        T+      +F +V+ +   
Sbjct: 339 WFQYVISCDAKDMTIRDVSARYIPDIYYRYYDRTRGSVLETTRQSKSHHFFMRVLKSTSR 398

Query: 412 RKRTKIDDYEDQYFFQRD---ESEGIPDSVQDLKNHPYYVLEQDIKQTQIVKPGCKECGY 468
            +        D     +    ++  +P S+ +LK  P +   + +KQ++ V    K  G 
Sbjct: 399 YR-------NDNTVLMKTIAAKNYKLPKSISELKRSPNFKGLRILKQSETVSSKAKPVG- 450

Query: 469 XXXXXXXXXXXXXYAKRDIADLKSARQWYMNGRILKTGS---RCKKVIKRTVGRPKGEAE 525
                        Y   DI  LK+ + WY+ GR +K  +   R K +  R         E
Sbjct: 451 --KVQYGGKKDKIYRISDILPLKTRQHWYLLGRTVKEDAKPIRTKTIPLRKRNAISSAQE 508

Query: 526 EEDER-LYSFEDTELYIPPLASASGEI------------TKNTFGNIEVFAPTMIPGNCC 572
               R L+S+E T+L  P   S+  ++             KN + N+E+++ ++IP    
Sbjct: 509 LNFARELFSYEQTDL-TPKYPSSYKDVYGIYHVVCDVDFYKNKYKNVEIYSKSVIPTGFR 567

Query: 573 LV---ENPVAIKAARFLG-------------VEFAPAVTSFKFERGSTVKPVLSGIVVAK 616
           L+   +        R +              +++   V+ F F +G    P+ + I+V  
Sbjct: 568 LMRTFDKDYKFDLRRLIKNANVEKGKKGQKLIKYLDVVSGFDFRKGQAT-PIKTHILVNY 626

Query: 617 W-LREAIETAIDGIEFIQEDDNRKEHLLGALESWNTLLLKLRIRSKLNSTYGKI 669
              R+ +    D IE ++            LESW+  + +L+I+ +L   YGK+
Sbjct: 627 MDYRKILSLQKDYIELLR------------LESWSNFITRLKIKCELEDKYGKL 668

>YDR314C (YDR314C) [1142] chr4 complement(1090426..1092504) Member
           of the DNA repair protein Rad4 family, has low
           similarity to uncharacterized C. albicans Orf6.3103p
           [2079 bp, 692 aa]
          Length = 692

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 62/271 (22%), Positives = 113/271 (41%), Gaps = 49/271 (18%)

Query: 434 IPDSVQDLKNHPYYVLEQDIKQTQIVKPGCKECGYXXXXXXXXXXXXXYAKRDIADLKSA 493
           +P SV ++K    +V+   +K  +++K   K+                + +RD+  LKS 
Sbjct: 434 LPKSVTEIKRTDNFVIPSLLKSNEVLKACAKQAA--TFTKGDNSQEPIFWRRDVIQLKSK 491

Query: 494 RQWYMNGRILKTGSRCKKVIKRTVGRPKGEAEEED------ERLYSFEDTELYIPPLASA 547
           + W + GR +   ++    +KR    P  E    +      + L+S+E T +  P   S 
Sbjct: 492 QHWAILGRSILPNAQP---LKRKKYLPMRERMVRNLDKYVIKELFSYEQT-MKSPKYPST 547

Query: 548 SGE-------IT-----KNTFGNIEVFAPTMIPGNCCLV--ENPVAIKAA---------R 584
             +       IT     KN FGNIE+++    P    L+     V IK           +
Sbjct: 548 YCDHLGQEHVITDLSHYKNKFGNIEIYSKETKPDGFELIPLSKEVDIKCLIKEYNKGKRK 607

Query: 585 FLGVEFAPAVTSFKFE--RGSTVKPVLSGIVVAKWLREAIETAIDGIEFIQEDDNRKEHL 642
              +++   V+ F F+  +G  + P +  I+V        ET    ++ +++    +  +
Sbjct: 608 MQKIKYLDVVSGFDFKQKKGHAI-PKIESILVK-------ETDYKAVQLLKQ----QTKV 655

Query: 643 LGALESWNTLLLKLRIRSKLNSTYGKIAEEE 673
           L  L  W+ LL KLR+  +LN+ YG +   E
Sbjct: 656 LLGLSFWDILLRKLRVNDRLNAEYGNVGNNE 686

>Sklu_2426.2 YDR314C, Contig c2426 795-2789 reverse complement
          Length = 664

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 61/272 (22%), Positives = 102/272 (37%), Gaps = 49/272 (18%)

Query: 434 IPDSVQDLKNHPYYVLEQDIKQTQIVKPGCKECGYXXXXXXXXXXXXXYAKRDIADLKSA 493
           IP ++  +K    + +   +K  +++    +  G              Y K+DI  LKS 
Sbjct: 401 IPKTLIGMKRSDNFTMPSLLKANEVISASTRPVG--TFCRGQQTEEYVYWKKDILRLKSR 458

Query: 494 RQWYMNGRILKTGS---RCKKVIKRTVGRPKGEAEEEDERLYSFEDTELYIPPL------ 544
           + W + GR +K  +   + KKV    + R K     E   LY+FE T +  P +      
Sbjct: 459 QHWALLGRTVKMDAVPMKSKKVHTMKMRREKRLYMYEIRELYAFEQT-IATPKMNNTYLT 517

Query: 545 -ASASGEIT-----KNTFGNIEVFAPTMIPGNCCLVENPVAIKAARFLGVEFAPAV-TSF 597
                G IT     KN  G++E++   + P      E   A K  + L  ++   +    
Sbjct: 518 SVGGRGLITDVYHFKNAHGHVEIYNANLKPDG---FEMFAATKETKLLIRQYNRDIRKGI 574

Query: 598 KFERGSTVKPVLSGIVVAKWLREAIETAIDGIEFIQ----------------EDDNRKEH 641
            F +   V P L  +   K+L       + G +F Q                 D  R E 
Sbjct: 575 GFLKDKYVVPKLQCLEPLKFL-----DVVSGFDFKQTPGYAVPVLNQILVNHNDFCRLEL 629

Query: 642 LLGA------LESWNTLLLKLRIRSKLNSTYG 667
           L+G       L  W  LL  L+++ +++  YG
Sbjct: 630 LIGQNRELQNLNYWQNLLQALQVKRRIDKQYG 661

>CAGL0H05753g complement(569862..570908) similar to tr|Q02890
           Saccharomyces cerevisiae YPL096w PNG1, hypothetical
           start
          Length = 348

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 71/149 (47%), Gaps = 24/149 (16%)

Query: 316 WCEVWDKFSKKWITVDPVNLKTIEQVRLHSKLAPKGVACCERNMLRYVIAYDRKYGCRDV 375
           WCE +  + K+WI VD    ++ ++  ++SK   K ++        Y I + R YG  DV
Sbjct: 206 WCEYYSPYLKRWIHVDSCE-QSFDEPFIYSKNWNKSMS--------YCIGFWR-YGVVDV 255

Query: 376 TRRYAQWMNSKVRKRRITKDDFGEKWFRKVITALHHRKRTKIDDYEDQYFFQRDESEGIP 435
           ++RY       + + ++ +D   E   + +  AL  R RT + D E    + RD+     
Sbjct: 256 SKRY-------ILQNQLPRDIIKEDDLQFLCHALTKRLRTGLSDDESYKMYCRDD----- 303

Query: 436 DSVQDLKNHPYYVLEQDIKQTQIVKPGCK 464
             ++ L+ +P     +++++ +I K G K
Sbjct: 304 --LEQLELNPSATPTKEMQKLKISKTGNK 330

>ABR193W [787] [Homologous to ScYPL096W (PNG1) - SH]
           complement(768355..769407) [1053 bp, 350 aa]
          Length = 350

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 60/119 (50%), Gaps = 17/119 (14%)

Query: 316 WCEVWDKFSKKWITVDPVNLKTIEQVRLHSKLAPKGVACCERNMLRYVIAYDRKYGCRDV 375
           WCEV+    K+W+ VD    K+ ++  ++S    K ++        YVIA+  +   +DV
Sbjct: 212 WCEVYSNALKRWVHVDSCE-KSFDEPHIYSVNWNKAMS--------YVIAFSNR-SVKDV 261

Query: 376 TRRYAQWMNSKVRKRRITKDDFGEKWFRKVITALHHRKRTKIDDYEDQYFFQRDESEGI 434
           +RRY   + +++ + +I +DD   ++  K +T L    R ++ D E      RDE E I
Sbjct: 262 SRRYI--VRNRLPRDQIDEDDL--QFLTKYLTKL---LRLQLPDEERYLLHCRDELEAI 313

>Kwal_27.12204
          Length = 368

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 62/119 (52%), Gaps = 21/119 (17%)

Query: 316 WCEVWDKFSKKWITVDPVNLKTIEQVRLHSKLAPKGVACCERNMLRYVIAYDRKYGCRDV 375
           WCE +  F K+W+ VD    ++ ++  ++S    K ++        YVIA++  Y C DV
Sbjct: 226 WCEFYSTFLKRWVHVDACE-QSFDEPHIYSVNWNKKMS--------YVIAFE-PYSCVDV 275

Query: 376 TRRYAQWMNSKVRKRRITKDDFGEKWFRKVITALHHRKRTKIDDYEDQYFFQ--RDESE 432
           ++RY   + +++ + +I +DD      + ++  +  R+R  + D  D+ + Q  RDE E
Sbjct: 276 SKRYI--IQNQLPRDQIKEDD-----LQFLLDMITRRQRMLLTD--DEVYVQACRDEQE 325

>KLLA0E17919g complement(1582644..1585943) weakly similar to sp|Q08236
            Saccharomyces cerevisiae YOL078w singleton, start by
            similarity
          Length = 1099

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 53/114 (46%), Gaps = 5/114 (4%)

Query: 216  ITKKYDNEGLYMRTWKEIEMSANNKRKFKTLKRSDFLRAVSKGHGDPDISVQGFVAMLRA 275
            +T   DN  L  +T +E E SAN+ R       S  L +++K H +   S  GF  +  +
Sbjct: 895  LTMANDNR-LLNKTLQEEETSANSGRPTSNRTSSKNLFSINKQH-NTSSSTSGFFKLKNS 952

Query: 276  CNVNARLIMSCQPPDFTNM-KIDTSLNGNNAYKDMVKYPIFWCEVWDKFSKKWI 328
                + L    + P   ++ K   +++GNN+YKD+     +  +VW +    +I
Sbjct: 953  SK--SSLNNGQKSPKLGSLSKPSNNVSGNNSYKDLFAGSYYKYKVWRRQQMSFI 1004

>YPL096W (PNG1) [5348] chr16 (366922..368013) Peptide:N-glycanase
           enzyme, may be involved in degradation of misfolded
           glycoproteins [1092 bp, 363 aa]
          Length = 363

 Score = 33.5 bits (75), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 53/119 (44%), Gaps = 17/119 (14%)

Query: 316 WCEVWDKFSKKWITVDPVNLKTIEQVRLHSKLAPKGVACCERNMLRYVIAYDRKYGCRDV 375
           WCE +  F  +W+ VD    ++ +Q  ++S    K ++        Y IA+ +  G  DV
Sbjct: 220 WCEYFSNFLNRWVHVDSCE-QSFDQPYIYSINWNKKMS--------YCIAFGKD-GVVDV 269

Query: 376 TRRYAQWMNSKVRKRRITKDDFGEKWFRKVITALHHRKRTKIDDYEDQYFFQRDESEGI 434
           ++RY       + +  + +D   E+  + +   +  R R  ++D E      RDE E I
Sbjct: 270 SKRY-------ILQNELPRDQIKEEDLKFLCQFITKRLRYSLNDDEIYQLACRDEQEQI 321

>Scas_700.2
          Length = 351

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 52/117 (44%), Gaps = 17/117 (14%)

Query: 316 WCEVWDKFSKKWITVDPVNLKTIEQVRLHSKLAPKGVACCERNMLRYVIAYDRKYGCRDV 375
           WCE +  +  +W+ VD    ++ +Q  ++S    K ++        Y IA+ +     DV
Sbjct: 210 WCEYYSPYLNRWVHVDSCE-QSFDQPYIYSINWNKSMS--------YCIAFSKD-DVTDV 259

Query: 376 TRRYAQWMNSKVRKRRITKDDFGEKWFRKVITALHHRKRTKIDDYEDQYFFQRDESE 432
           ++RY       + K  + +D   E   + + T L  R R +  D E    F+RDE E
Sbjct: 260 SKRY-------ILKNELPRDQISELDLQFICTYLTKRLRRQRTDDELFELFKRDERE 309

>Kwal_47.17952
          Length = 436

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 43/82 (52%), Gaps = 5/82 (6%)

Query: 205 KCMELWQKHWKIT-KKYDNEGLYMRTWKEIEMSANNKRKFKTLKRSDFLRAVSKGHGDPD 263
           K +E  Q+  K++ KKY  E L  R  KE EM+ N K + ++    + LR  SK   + +
Sbjct: 301 KYLEQLQRSKKVSDKKYLYEKLNSRLRKEHEMNQNKKNRMES---PETLRPESKASKNRN 357

Query: 264 ISVQGFVAMLRACNVNARLIMS 285
            S +G++  L  CN  ++ + S
Sbjct: 358 CS-RGYLVELERCNTPSQALPS 378

>Sklu_1929.2 YJR041C, Contig c1929 1685-5149 reverse complement
          Length = 1154

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 53/119 (44%), Gaps = 8/119 (6%)

Query: 164 SKRLSRKLSNLVPEKVFELLHPQKDEELPLRSTRKLLDGLKKCMELW--QKHWKITKKYD 221
           SK L  K  N+   +++E++    D    +    K +  L+  ++ W  QK  +    Y 
Sbjct: 11  SKLLRSK--NITTHQIYEIVSELFDSNTDIYFPNKEVFVLELIVDRWNDQKQLEFKLDYH 68

Query: 222 NEGLYMRTWKEIEMSANNKRKFKTLKRS-DFLRAVSKGHGDPDISVQGF---VAMLRAC 276
              L+ R WK +   ++ K+ FK LK     ++ +S    D D+ +  F   + +L +C
Sbjct: 69  IWELFNRMWKLLASDSHRKKIFKNLKFVPHLIQTLSSIENDTDLYINVFLETITLLNSC 127

>CAGL0J08591g complement(847505..851095) similar to tr|Q12466
           Saccharomyces cerevisiae YOR086c or sp|P48231
           Saccharomyces cerevisiae YNL087w, hypothetical start
          Length = 1196

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 52/113 (46%), Gaps = 15/113 (13%)

Query: 237 ANNKRKF---KTLKRSDFLRAVSKGHGD-PDISVQGFVAMLRACNVNARLIMSCQPPDFT 292
            NNKRK    + L+    + A+S   GD PDI V  +V      N +AR I     P  T
Sbjct: 864 HNNKRKLSLDQLLEHKIGILAISVLSGDVPDIGV--YVQSFFDGNAHARFI----SPKLT 917

Query: 293 NMKIDTSLNGNNAYKDMVKYPIFWCEVWDKFSKKWITVDP---VNLKTIEQVR 342
           +  I++   G+   K++    + +    DKFS K  T D    V L TI+ +R
Sbjct: 918 SRTINSGWTGDVMIKELDNSVVTFKVTRDKFSGK--TSDKLCDVTLSTIDLLR 968

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,041,367
Number of extensions: 1120964
Number of successful extensions: 3875
Number of sequences better than 10.0: 30
Number of HSP's gapped: 3941
Number of HSP's successfully gapped: 32
Length of query: 741
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 632
Effective length of database: 12,822,747
Effective search space: 8103976104
Effective search space used: 8103976104
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)