Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER161C (SPT2)33332812531e-174
Scas_576.23493574645e-55
CAGL0L11704g3363284225e-49
Kwal_56.234133153513124e-33
AGR161C3373401905e-16
KLLA0F14487g302571081e-05
Scas_718.2696968637.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER161C
         (328 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER161C (SPT2) [1589] chr5 complement(499342..500343) HMG-like c...   487   e-174
Scas_576.2                                                            183   5e-55
CAGL0L11704g complement(1248417..1249427) similar to sp|P06843 S...   167   5e-49
Kwal_56.23413                                                         124   4e-33
AGR161C [4472] [Homologous to ScYER161C (SPT2) - SH] (1048663..1...    78   5e-16
KLLA0F14487g 1344298..1345206 weakly similar to sp|P06843 Saccha...    46   1e-05
Scas_718.26                                                            29   7.2  

>YER161C (SPT2) [1589] chr5 complement(499342..500343) HMG-like
           chromatin protein that interacts with Snf1p through a
           conserved domain, negative regulator of HO gene
           transcription [1002 bp, 333 aa]
          Length = 333

 Score =  487 bits (1253), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 256/328 (78%), Positives = 256/328 (78%)

Query: 1   MSFLSKLSQIRKSTTASKAQVQDPLPKKNDEEYSLLPKNYIRDEDPAVXXXXXXXXXXXX 60
           MSFLSKLSQIRKSTTASKAQVQDPLPKKNDEEYSLLPKNYIRDEDPAV            
Sbjct: 1   MSFLSKLSQIRKSTTASKAQVQDPLPKKNDEEYSLLPKNYIRDEDPAVKRLKELRRQELL 60

Query: 61  XNGALAKKSGVKRKRGTSSGSEKKKIERNDDDEGGLGIRFKRSIGASHAPLKPVVRKKPE 120
            NGALAKKSGVKRKRGTSSGSEKKKIERNDDDEGGLGIRFKRSIGASHAPLKPVVRKKPE
Sbjct: 61  KNGALAKKSGVKRKRGTSSGSEKKKIERNDDDEGGLGIRFKRSIGASHAPLKPVVRKKPE 120

Query: 121 PIKKMSFEELMKQAENNEKQPPKVKSSEPVTKERPHFNKPGFKSSKRPQKKASPGATLRX 180
           PIKKMSFEELMKQAENNEKQPPKVKSSEPVTKERPHFNKPGFKSSKRPQKKASPGATLR 
Sbjct: 121 PIKKMSFEELMKQAENNEKQPPKVKSSEPVTKERPHFNKPGFKSSKRPQKKASPGATLRG 180

Query: 181 XXXXXXXXXXXXXPKPVKLNLPTNGFAQPNRRLKEKLESRKQKSRYQXXXXXXXXXXXXX 240
                        PKPVKLNLPTNGFAQPNRRLKEKLESRKQKSRYQ             
Sbjct: 181 VSSGGNSIKSSDSPKPVKLNLPTNGFAQPNRRLKEKLESRKQKSRYQDDYDEEDNDMDDF 240

Query: 241 XXXXXXXGYHSKSKHSNGPGYDRDEIWAMFNRGKKRSXXXXXXXXXXXXXXXXXXXXXXX 300
                  GYHSKSKHSNGPGYDRDEIWAMFNRGKKRS                       
Sbjct: 241 IEDDEDEGYHSKSKHSNGPGYDRDEIWAMFNRGKKRSEYDYDELEDDDMEANEMEILEEE 300

Query: 301 XXARKMARLEDKREEAWLKKHEEEKRRR 328
             ARKMARLEDKREEAWLKKHEEEKRRR
Sbjct: 301 EMARKMARLEDKREEAWLKKHEEEKRRR 328

>Scas_576.2
          Length = 349

 Score =  183 bits (464), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 139/357 (38%), Positives = 188/357 (52%), Gaps = 40/357 (11%)

Query: 1   MSFLSKLSQIRKSTTAS---KAQVQDPLPKKNDEEY---SLLPKNYIRDEDPAVXXXXXX 54
           MSFLSKLSQ++K++T +   K   ++ +P+K   E    SLLP NYIRDEDPAV      
Sbjct: 1   MSFLSKLSQLKKASTTNTSMKNTSKESIPRKKSIEEDIPSLLPTNYIRDEDPAVRRLKEL 60

Query: 55  XXXXXXXNGALAKKSGVKRKRGTSSGSEKKKIERNDDDEGGLGI-RFKRSIGASHAPLKP 113
                  NG  AKK     K+   S + K+K +++DD+    G  RFK+ +G++H    P
Sbjct: 61  RRKEQIKNGEFAKK----HKKTNPSTTTKRKSKKDDDNLAADGYSRFKKKLGSTHTRPTP 116

Query: 114 V--VRKKPEPIKKMSFEELMKQAENNEKQPPKVKSSEPVTKE------RPHFNKPGFKSS 165
           V  + +K EPIKK+SF+ELMKQAENN       +SSE ++K+      RPH +KPGF+S+
Sbjct: 117 VRTLTRKMEPIKKISFDELMKQAENNASSK---ESSEGISKKESPSASRPHLHKPGFRSA 173

Query: 166 K---RPQKKASPGATL---RXXXXXXXXXXXXXXPKPVKLNLPTNGFAQPNRRLKEKLES 219
           +   R  K      TL   +                P+K++LP    AQPN+RLK++LES
Sbjct: 174 RDRNRVSKPVKHQTTLPRKKMSLSPIRNRPGSRDATPIKISLP---VAQPNQRLKQRLES 230

Query: 220 RKQK----SRY---QXXXXXXXXXXXXXXXXXXXXGYHSKSK-HSNGPGYDRDEIWAMFN 271
           ++Q+     RY   +                      H + K H + PGYDRDEIWAMFN
Sbjct: 231 KRQRPSGRDRYGRPEYDYDDEDDMDDFIEDDEEDSEVHRRMKLHRDDPGYDRDEIWAMFN 290

Query: 272 RGKKRSXXXXXXXXXXXXXXXXXXXXXXXXXARKMARLEDKREEAWLKKHEEEKRRR 328
           +G+KRS                           +MARLEDKRE AWLKKHEEEKRR+
Sbjct: 291 KGRKRSEYAYDEEEDDMEANEMEILEEEERAE-EMARLEDKREAAWLKKHEEEKRRK 346

>CAGL0L11704g complement(1248417..1249427) similar to sp|P06843
           Saccharomyces cerevisiae YER161c SPT2 multifunctional
           HMG-like chromatin protein, start by similarity
          Length = 336

 Score =  167 bits (422), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 132/328 (40%), Positives = 164/328 (50%), Gaps = 21/328 (6%)

Query: 1   MSFLSKLSQIRKSTTASKAQVQDPLPKKNDEEYSLLPKNYIRDEDPAVXXXXXXXXXXXX 60
           MSFLSKLS+++K  T  K  +  P      EE SLLPKNY+R+EDPAV            
Sbjct: 1   MSFLSKLSELKK--TKPKTVISPPQKANKQEEISLLPKNYVREEDPAVTRLKELRRQELL 58

Query: 61  XNGALAKKSGVK-RKRGTSSGSEKKKIERNDDDEGGLGIRFKRSIGASHAPLKPV-VRKK 118
            N  LAKK   + RK  +SS +   K ++N DD   L  RFKR +G S  P  P+ V+KK
Sbjct: 59  KNPELAKKKQKQVRKTPSSSKASTGKKDKNGDD-NMLVSRFKRKVG-SDKPAVPIQVKKK 116

Query: 119 PEPIKKMSFEELMKQAENNEKQPPKVKSSEPVTKER----PHFNKPGFKSSKRPQKKASP 174
           P+PIKK+SFEELMKQAENN+  P    +      E+       NKPGFK+S RP K  SP
Sbjct: 117 PQPIKKLSFEELMKQAENNQTIPVSKDTQSNGAGEKIKGSAKLNKPGFKTS-RP-KSLSP 174

Query: 175 GATLRXXXXXXXXXXXXXXPKP-VKLNLPTNGFAQPNRRLKEKLESRKQKSRYQXXXXXX 233
              +                +P VK+ +P   FAQPN RLK+KLE R++ ++        
Sbjct: 175 TTHINKTDHGKDKSTAKEKSEPVVKIGIPK--FAQPNERLKKKLEMRQRVNK--SRRYED 230

Query: 234 XXXXXXXXXXXXXXGYHSKSKHSNGPGYDRDEIWAMFNRGKKRSXXXXXXXXXX----XX 289
                          Y S    S  PGYDRDEIWAMFN+G+KRS                
Sbjct: 231 EEDDMDDFIEDDEEEYSSYRTTSKDPGYDRDEIWAMFNKGRKRSYNEYMDYEEEDDFDAM 290

Query: 290 XXXXXXXXXXXXXARKMARLEDKREEAW 317
                        A +MARLEDKREEAW
Sbjct: 291 EANEMEILEEEEEAARMARLEDKREEAW 318

>Kwal_56.23413
          Length = 315

 Score =  124 bits (312), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 111/351 (31%), Positives = 149/351 (42%), Gaps = 63/351 (17%)

Query: 1   MSFLSKLSQIRKSTTA------SKAQVQDPLPKKNDE----EYSLLPKNYIRDEDPAVXX 50
           MSFL+K SQ+RK   A      S+ + Q  L +  ++    E SLLP+ Y+R+EDPA+  
Sbjct: 1   MSFLAKFSQLRKKPAAGNDARGSEQKRQSKLNESQEDPLRDESSLLPQKYVREEDPAIRR 60

Query: 51  XXXXXXXXXXXNGALAKKSGVKRKRGTSSGSEKKKIERNDDDEGGLGIRFKRSIGASHAP 110
                      N    K +   RKR              D++      +F+R +G S   
Sbjct: 61  LKELRRKEQLKNAPKNKPAAPSRKR-------------KDENSANTETKFRRKVGESLQS 107

Query: 111 LKPVVRKKPEPIKKMSFEELMKQAENNEKQPPKVKSSEPV--------TKERP--HFNKP 160
            KPV   K  P+KK+SF+ELMK+AE   K P    S++P+         +  P     +P
Sbjct: 108 RKPVAPVKRTPLKKLSFDELMKEAEEKSKNP----STDPIDSTSRSKALQNNPPVRLQRP 163

Query: 161 GFKSSKRPQKKASPGATLRXXXXXXXXXXXXXXPKPVKLNLPTNGFAQPNRRLKEKLESR 220
           GFKS+ R  +K      +               P+P          AQP  +LK KLE+ 
Sbjct: 164 GFKSAARRDRKPLSTPKITKQKSPVESLQRLPAPRP--------SIAQPGAKLKRKLENL 215

Query: 221 K---QKSRYQXXXXXXXXXXXXXXXXXXXXGYHSKSKHSNGPGYDRDEIWAMFNRGKKRS 277
           K   Q  RY+                                G++RDEIWAMFN+GKKR 
Sbjct: 216 KKHRQTDRYR--------------SSEEEDMDDFIEDDEEEQGFNRDEIWAMFNKGKKR- 260

Query: 278 XXXXXXXXXXXXXXXXXXXXXXXXXARKMARLEDKREEAWLKKHEEEKRRR 328
                                    A KMA+LEDKREE WLKKHE+EKRRR
Sbjct: 261 RDFENDYESDDMEVNEMDIMEEEERATKMAKLEDKREEEWLKKHEQEKRRR 311

>AGR161C [4472] [Homologous to ScYER161C (SPT2) - SH]
           (1048663..1049676) [1014 bp, 337 aa]
          Length = 337

 Score = 77.8 bits (190), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 92/340 (27%), Positives = 129/340 (37%), Gaps = 39/340 (11%)

Query: 1   MSFLSKLSQIRKSTTASKAQVQDPLPKKNDEEYSL------LPKNYIRDEDPAVXXXXXX 54
           MSFL+KLSQ++KSTT+S          K ++  SL      LP+ Y+R EDPA+      
Sbjct: 1   MSFLAKLSQLKKSTTSSTDTGSGSKATKKEDNPSLDFKSPILPEYYVRKEDPAIRRLKEK 60

Query: 55  XXXXXXXNGALAKKSGVKRKRGTSSGSEKKKIERNDDDEGGLGIRFKRSIGASHAPLKPV 114
                   G L K S  +R +          + +    EG    +  R       P   V
Sbjct: 61  RRQEQLRKGTLKKASSQRRSKANGGEVASGGVRQ----EGSTRWKLPR-------PKSTV 109

Query: 115 VRKKPEP--IKKMSFEELMKQAENNEKQPPKV-KSSEPVTKERPHFNKPGFKSSKRPQKK 171
           V        +KK+SFEELMKQAE   K P    K + P     P  +KPGFK        
Sbjct: 110 VAAAAPAPPLKKLSFEELMKQAEEKAKSPAASGKRTAPAGPSAPAVSKPGFKPRSNSGAA 169

Query: 172 ASPGATLRXXXXXXXXXXXXXXPKP-----------VKLNLPTNG-FAQPNRRLKEKLES 219
              G                    P           + ++LP+ G  A+PN +L+  LE 
Sbjct: 170 VVGGKVAGADKGARNGGADRTAHAPNSARGMKAKQAIAIDLPSGGGLAKPNEKLRRILE- 228

Query: 220 RKQKSRYQXXXXXXXXXXXXXXXXXXXXGYHSKSKHSNGPGYDRDEIWAMFNRGKKR-SX 278
            KQ+ R +                    G      +    GYD++EIW++FN+G++R   
Sbjct: 229 -KQERRKRSAGEYEEDDSDLDDFIADDDGEEEGGSY----GYDKEEIWSIFNKGRRRLYQ 283

Query: 279 XXXXXXXXXXXXXXXXXXXXXXXXARKMARLEDKREEAWL 318
                                   + KMAR EDK EE W+
Sbjct: 284 EDDDNDFDDDMEANEMEILEEEDYSSKMARREDKMEEEWI 323

>KLLA0F14487g 1344298..1345206 weakly similar to sp|P06843
           Saccharomyces cerevisiae YER161c SPT2 multifunctional
           HMG-like chromatin protein singleton, start by
           similarity
          Length = 302

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 261 YDRDEIWAMFNRGKKRSXXXXXXXXXXXXXXXXXXXXXXXXXARKMARLEDKREEAW 317
           YDRDEIW++FN+G KR                          A KMA+LEDKRE+AW
Sbjct: 232 YDRDEIWSIFNKGSKR--KYFDSDDDDDMEANEMEIFEEEERATKMAKLEDKREQAW 286

>Scas_718.26
          Length = 969

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 29/68 (42%)

Query: 63  GALAKKSGVKRKRGTSSGSEKKKIERNDDDEGGLGIRFKRSIGASHAPLKPVVRKKPEPI 122
           GALA    V +   T     K   + ND  E  L    ++  G ++  + PV +KK E  
Sbjct: 828 GALALAHSVMKATATQPVDFKYLYDINDSVEDKLTTIVQKMYGGANIEISPVAQKKIEMY 887

Query: 123 KKMSFEEL 130
           KK  F  L
Sbjct: 888 KKQGFGNL 895

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.127    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,456,582
Number of extensions: 352448
Number of successful extensions: 1473
Number of sequences better than 10.0: 39
Number of HSP's gapped: 1435
Number of HSP's successfully gapped: 41
Length of query: 328
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 226
Effective length of database: 13,065,073
Effective search space: 2952706498
Effective search space used: 2952706498
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 62 (28.5 bits)