Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER064C50549722740.0
YIL056W6402023636e-37
Sklu_2353.16272213255e-32
CAGL0M12496g5272033201e-31
ADL067C639733151e-30
Kwal_23.58426412353097e-30
Scas_701.7489733058e-30
CAGL0M12507g278732922e-29
KLLA0C08151g640732973e-28
Scas_704.29811952877e-27
CAGL0J03014g573732705e-25
Kwal_34.1592249699664.8
Sklu_1792.4558113656.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER064C
         (497 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER064C (YER064C) [1495] chr5 complement(282703..284220) Protein...   880   0.0  
YIL056W (YIL056W) [2612] chr9 (249989..251911) Protein containin...   144   6e-37
Sklu_2353.1 YIL056W, Contig c2353 881-2764 reverse complement         129   5e-32
CAGL0M12496g complement(1242621..1244204) similar to sp|P40522 S...   127   1e-31
ADL067C [1674] [Homologous to ScYER064C - SH; ScYIL056W - SH] (5...   125   1e-30
Kwal_23.5842                                                          123   7e-30
Scas_701.7                                                            122   8e-30
CAGL0M12507g complement(1243855..1244691) highly similar to sp|P...   117   2e-29
KLLA0C08151g 714910..716832 some similarities with sp|P40522 Sac...   119   3e-28
Scas_704.29                                                           115   7e-27
CAGL0J03014g complement(287508..289229) weakly similar to sp|P40...   108   5e-25
Kwal_34.15922                                                          30   4.8  
Sklu_1792.4 YBR044C, Contig c1792 3897-5573                            30   6.8  

>YER064C (YER064C) [1495] chr5 complement(282703..284220) Protein
           required for full expression ERG9 and CYC1, may be a
           global transcriptional regulator [1518 bp, 505 aa]
          Length = 505

 Score =  880 bits (2274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/497 (88%), Positives = 442/497 (88%)

Query: 1   MIDDTENSKIHLEGSXXXXXXXXXXXXXXIRAQLNFNDEKKWKKFSSRRLELIDSFGLSQ 60
           MIDDTENSKIHLEGS              IRAQLNFNDEKKWKKFSSRRLELIDSFGLSQ
Sbjct: 1   MIDDTENSKIHLEGSHKTGKYTGYGTTHKIRAQLNFNDEKKWKKFSSRRLELIDSFGLSQ 60

Query: 61  HKASEQDDNIRQIATILRSEFEYPDTFSAEFEKLVTAAVQSVXXXXXXXXXXXXXXXXXI 120
           HKASEQDDNIRQIATILRSEFEYPDTFSAEFEKLVTAAVQSV                 I
Sbjct: 61  HKASEQDDNIRQIATILRSEFEYPDTFSAEFEKLVTAAVQSVRRNRKRSKKKLLDSKKKI 120

Query: 121 ARGKVQKIPLXXXXXXXXXXXXXXXXXXXXXXXXVKEEPAEHALPSLNTITSQKLLPYPN 180
           ARGKVQKIPL                        VKEEPAEHALPSLNTITSQKLLPYPN
Sbjct: 121 ARGKVQKIPLSPPSSSNMGSCSASNASSSDEEASVKEEPAEHALPSLNTITSQKLLPYPN 180

Query: 181 GRTLPPVPTQVRSLLKKNASLLRDPSAPYAHGGDEKLQKFDIEDQPLESEQEYDFIAKSI 240
           GRTLPPVPTQVRSLLKKNASLLRDPSAPYAHGGDEKLQKFDIEDQPLESEQEYDFIAKSI
Sbjct: 181 GRTLPPVPTQVRSLLKKNASLLRDPSAPYAHGGDEKLQKFDIEDQPLESEQEYDFIAKSI 240

Query: 241 IVEIVNNAIPLPEQIQRDKFIRPNLTKKKGCQSKVVISNNLRKLILSKIHNSRTCLEMSK 300
           IVEIVNNAIPLPEQIQRDKFIRPNLTKKKGCQSKVVISNNLRKLILSKIHNSRTCLEMSK
Sbjct: 241 IVEIVNNAIPLPEQIQRDKFIRPNLTKKKGCQSKVVISNNLRKLILSKIHNSRTCLEMSK 300

Query: 301 DERNLDSFANLETLGKNSLMASISLVVENSFSHLPSSTKQYLTERLSSIEFLTILSQRLF 360
           DERNLDSFANLETLGKNSLMASISLVVENSFSHLPSSTKQYLTERLSSIEFLTILSQRLF
Sbjct: 301 DERNLDSFANLETLGKNSLMASISLVVENSFSHLPSSTKQYLTERLSSIEFLTILSQRLF 360

Query: 361 MPATRQLFADLSQEKIQVRVLNLILGSLVKDYGFDASLAPINEIIYHMTLHQYPLVCSNK 420
           MPATRQLFADLSQEKIQVRVLNLILGSLVKDYGFDASLAPINEIIYHMTLHQYPLVCSNK
Sbjct: 361 MPATRQLFADLSQEKIQVRVLNLILGSLVKDYGFDASLAPINEIIYHMTLHQYPLVCSNK 420

Query: 421 QSNPMRPHSTSEVLSAHSSTKDASTPGKEEPRVTRSSTSADSTIITLPSIEVPNTYDDDR 480
           QSNPMRPHSTSEVLSAHSSTKDASTPGKEEPRVTRSSTSADSTIITLPSIEVPNTYDDDR
Sbjct: 421 QSNPMRPHSTSEVLSAHSSTKDASTPGKEEPRVTRSSTSADSTIITLPSIEVPNTYDDDR 480

Query: 481 LKMLSAISLQIENSTFS 497
           LKMLSAISLQIENSTFS
Sbjct: 481 LKMLSAISLQIENSTFS 497

>YIL056W (YIL056W) [2612] chr9 (249989..251911) Protein containing a
           domain of unknown function (DUF352), has low similarity
           to uncharacterized C. albicans Orf6.8720p [1923 bp, 640
           aa]
          Length = 640

 Score =  144 bits (363), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 127/202 (62%), Gaps = 12/202 (5%)

Query: 229 SEQEYDFIAKSIIVEIVNNAIPLPEQIQRDKFIRPNLT--------KKKGCQSKVVISNN 280
           ++Q+Y+ I   ++ ++V N +PL EQ  +D +  PNL+        ++    + + I + 
Sbjct: 191 TQQKYNDIVTMLVHDLVTNVVPLSEQALKDPYTGPNLSHFATSSLSQQPNITTNIPIDST 250

Query: 281 ----LRKLILSKIHNSRTCLEMSKDERNLDSFANLETLGKNSLMASISLVVENSFSHLPS 336
               LR+ +L +I  SRTC ++S+   ++D +ANLE LG+ S+  SI+ V+E  FS+L S
Sbjct: 251 VPFFLREKLLLQIQRSRTCQDISQAAGSIDIYANLEILGEMSIRMSIAFVIERFFSNLVS 310

Query: 337 STKQYLTERLSSIEFLTILSQRLFMPATRQLFADLSQEKIQVRVLNLILGSLVKDYGFDA 396
           S+ +Y+T +  S E L +LSQRLF  ATR   +     ++Q+R+L L++G +VKD+GFD 
Sbjct: 311 SSMKYITAKTCSPENLALLSQRLFGAATRHNLSHFPAAQVQLRLLYLVIGGIVKDFGFDP 370

Query: 397 SLAPINEIIYHMTLHQYPLVCS 418
           +L P++EII+H+ + QYPL  S
Sbjct: 371 TLYPLSEIIHHIVMVQYPLASS 392

 Score =  121 bits (303), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 59/73 (80%), Positives = 64/73 (87%)

Query: 30  IRAQLNFNDEKKWKKFSSRRLELIDSFGLSQHKASEQDDNIRQIATILRSEFEYPDTFSA 89
           IR  LNFNDEKKWK+FSSRRLELID F LSQ+KASEQD NI+QIATILR+EF YP + S 
Sbjct: 24  IRELLNFNDEKKWKQFSSRRLELIDKFQLSQYKASEQDQNIKQIATILRTEFGYPVSCSK 83

Query: 90  EFEKLVTAAVQSV 102
           EFEKLVTAAVQSV
Sbjct: 84  EFEKLVTAAVQSV 96

>Sklu_2353.1 YIL056W, Contig c2353 881-2764 reverse complement
          Length = 627

 Score =  129 bits (325), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 124/221 (56%), Gaps = 28/221 (12%)

Query: 227 LESEQEYDFIAKSIIVEIVNNAIPLPEQIQRDKFIRPNLTK-----------KKGCQSKV 275
           + S+Q+YD + KSII ++V+N +PL EQ   D    PNLT                 SK 
Sbjct: 197 ISSQQKYDELLKSIIADLVHNRVPLQEQSTHDDS-SPNLTDFALSFNNHHLLSLALSSKK 255

Query: 276 VISNN---------------LRKLILSKIHNSRTCLEMSKDERNLDSFANLETLGKNSLM 320
             SN                LR+ IL  +  S+TCLE+   + +LD   NL  LG+ S+ 
Sbjct: 256 EPSNMPSSSASTTDEKIPFFLREKILLHVQRSKTCLELGSLQGSLDLHNNLTMLGETSIK 315

Query: 321 ASISLVVENSFSHLPSSTKQYLTERLSSIEFLTILSQRLFMPATRQLFADLSQEKIQVRV 380
           +SI+ V+E  FS+LP ++ +Y+T ++S+ E L ++  +LF   TR   + L Q+  ++ V
Sbjct: 316 SSIAFVIERFFSNLPQTSMEYITSKISATEQLALMCIKLFGQGTRHNLSQLPQDS-KLSV 374

Query: 381 LNLILGSLVKDYGFDASLAPINEIIYHMTLHQYPLVCSNKQ 421
           L LI+G ++KD+GFD  + P++EI++ + L QYPL+C + Q
Sbjct: 375 LYLIIGGVIKDFGFDPCVYPLSEIVHDIILRQYPLICKSNQ 415

 Score =  107 bits (267), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 51/73 (69%), Positives = 62/73 (84%)

Query: 30  IRAQLNFNDEKKWKKFSSRRLELIDSFGLSQHKASEQDDNIRQIATILRSEFEYPDTFSA 89
           IR QLNF+D+KKWK  S RR+ELID FGL++ KA+EQDDNIRQIATIL+++F Y  + SA
Sbjct: 25  IREQLNFSDDKKWKGVSRRRVELIDKFGLNERKATEQDDNIRQIATILKTKFGYSVSSSA 84

Query: 90  EFEKLVTAAVQSV 102
           E +KLVTAAVQSV
Sbjct: 85  ECKKLVTAAVQSV 97

>CAGL0M12496g complement(1242621..1244204) similar to sp|P40522
           Saccharomyces cerevisiae YIL056w, hypothetical start
          Length = 527

 Score =  127 bits (320), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 121/203 (59%), Gaps = 15/203 (7%)

Query: 229 SEQEYDFIAKSIIVEIVNNAIPLPEQIQRDK--------FIRPNLTKKKGCQSKV----- 275
           + Q+YD I K+I+ ++V+N +PL EQ  RD            PN   K      +     
Sbjct: 103 AAQKYDDIIKNIVADLVHNIVPLAEQANRDNNGLALKLSTFDPNNPVKSEHPPSIDQEPA 162

Query: 276 --VISNNLRKLILSKIHNSRTCLEMSKDERNLDSFANLETLGKNSLMASISLVVENSFSH 333
              +   LR+ +L +I  S+TCLE++  + +++ +ANLETLG+ ++  SI+ +VE  FS+
Sbjct: 163 HGGLPYFLREKLLLQIQKSKTCLEIATSQGSMELYANLETLGEMAIRTSIAFLVERFFSN 222

Query: 334 LPSSTKQYLTERLSSIEFLTILSQRLFMPATRQLFADLSQEKIQVRVLNLILGSLVKDYG 393
           + S + +Y++ + SS E L  L+ +L  PA R   A++   ++Q++ L L++G +VKD+G
Sbjct: 223 MLSMSMEYISRKSSSDENLANLALKLMSPAVRINLANMPMHEVQIKTLYLLVGGIVKDFG 282

Query: 394 FDASLAPINEIIYHMTLHQYPLV 416
           FD  L P++E I+H+ + QYPLV
Sbjct: 283 FDPCLYPLSEAIHHLIMTQYPLV 305

>ADL067C [1674] [Homologous to ScYER064C - SH; ScYIL056W - SH]
           (560735..562654) [1920 bp, 639 aa]
          Length = 639

 Score =  125 bits (315), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 64/73 (87%)

Query: 30  IRAQLNFNDEKKWKKFSSRRLELIDSFGLSQHKASEQDDNIRQIATILRSEFEYPDTFSA 89
           IR QLNF D KKWK+FSSRRLELID FGLS+ KASEQDDNIRQIATILR+EF YP + S 
Sbjct: 17  IREQLNFKDNKKWKQFSSRRLELIDKFGLSERKASEQDDNIRQIATILRTEFGYPVSSSG 76

Query: 90  EFEKLVTAAVQSV 102
           EFEKLVTAAVQSV
Sbjct: 77  EFEKLVTAAVQSV 89

 Score =  119 bits (299), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/220 (32%), Positives = 118/220 (53%), Gaps = 36/220 (16%)

Query: 236 IAKSIIVEIVNNAIPLPEQIQRDKFIRPNLT----------------------------K 267
           I +S+I+++V N IPL EQ + D    P+LT                            +
Sbjct: 200 ILRSVIMDLVYNHIPLAEQCRHD--TSPSLTDLAIFSQHRNLLSLALASSKHESKEAEDR 257

Query: 268 KKGCQSKVVISNN-----LRKLILSKIHNSRTCLEMSKDERNLDSFANLETLGKNSLMAS 322
           ++  Q     SN      LR+ IL  I  S+TC+E++ +E  L++  NL  LG   + A+
Sbjct: 258 EQSDQHNRAASNENIPFFLREKILLHIQRSKTCMEIATEELRLENCVNLCMLGDTCIKAA 317

Query: 323 ISLVVENSFSHLPSSTKQYLTERLSSIEFLTILSQRLFMPATRQLFADLSQEKIQVRVLN 382
           +S V+E  FS LP ++ +Y+T++++S+E   ++  + F P T+     LS E  +V +  
Sbjct: 318 VSFVMERFFSSLPVTSTEYITQKVTSLEQSALICMKFFAPGTKSNMQILSVEN-KVTLFQ 376

Query: 383 LILGSLVKDYGFDASLAPINEIIYHMTLHQYPLVCSNKQS 422
           LI+G++VKD+GFD  L P+ E+ + + L QYPLVCS+  S
Sbjct: 377 LIIGAIVKDFGFDPCLYPLGEVFHDLILRQYPLVCSSSPS 416

>Kwal_23.5842
          Length = 641

 Score =  123 bits (309), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 81/235 (34%), Positives = 125/235 (53%), Gaps = 42/235 (17%)

Query: 223 EDQPLES-----EQEYDFIAKSIIVEIVNNAIPLPEQIQRDKFIRPNLTK---------- 267
           +D PL S      Q YD I K++I + V+N + L EQ ++D    PNLT           
Sbjct: 203 KDSPLPSIVATHAQNYDEIIKAVIADAVHNRVSLHEQSRKDD-ATPNLTDFALSSNDGNL 261

Query: 268 -KKGCQSKVVISNN------------------------LRKLILSKIHNSRTCLEMSKDE 302
                 S+V  +N                         LR+ IL  +  SR CLE+S  +
Sbjct: 262 LNLAFNSQVNTANTYTIAYPKAKASNDDSNSGNKIPFFLREKILLHVQRSRACLEVSSAQ 321

Query: 303 RNLDSFANLETLGKNSLMASISLVVENSFSHLPSSTKQYLTERLSSIEFLTILSQRLFMP 362
            +LD +ANL  LG+ S+ AS++ V+E  FS+L +S+ +Y+T +L S   L +++ +LF P
Sbjct: 322 GSLDLYANLFMLGEVSIKASVAFVMERFFSNLTASSVEYVTSKLCSERELALVAIKLFGP 381

Query: 363 ATRQLFADLSQEKIQVRVLNLILGSLVKDYGFDASLAPINEIIYHMTLHQYPLVC 417
           AT      +SQ   Q+++  LI+G +VKD+GFD S+ P++EI++ + L QYPL C
Sbjct: 382 ATEHNLEQISQ-GAQLKLFYLIIGGIVKDFGFDPSIYPLSEIMHDVILRQYPLDC 435

 Score =  112 bits (281), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 53/73 (72%), Positives = 59/73 (80%)

Query: 30  IRAQLNFNDEKKWKKFSSRRLELIDSFGLSQHKASEQDDNIRQIATILRSEFEYPDTFSA 89
           IR QL F DE++WK FS RRL LI+ FGL + KASEQD NIRQIATILR+EF YP + S 
Sbjct: 19  IREQLGFTDERRWKVFSGRRLALIEKFGLGERKASEQDKNIRQIATILRTEFGYPLSSSG 78

Query: 90  EFEKLVTAAVQSV 102
           EFEKLVTAAVQSV
Sbjct: 79  EFEKLVTAAVQSV 91

>Scas_701.7
          Length = 489

 Score =  122 bits (305), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 64/73 (87%)

Query: 30  IRAQLNFNDEKKWKKFSSRRLELIDSFGLSQHKASEQDDNIRQIATILRSEFEYPDTFSA 89
           IR +LNF DEKKWK FSSRRLELID FGLSQ KASEQDDNI+QIAT+LR EF Y ++++ 
Sbjct: 26  IRERLNFIDEKKWKHFSSRRLELIDKFGLSQRKASEQDDNIKQIATLLRDEFGYSNSYTN 85

Query: 90  EFEKLVTAAVQSV 102
           EFEKLVTAAVQSV
Sbjct: 86  EFEKLVTAAVQSV 98

 Score =  103 bits (256), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 53/124 (42%), Positives = 83/124 (66%), Gaps = 2/124 (1%)

Query: 285 ILSKIHNSRTCLEMSKDERNLDSFANLETLGKNSLMASISLVVENSFSHLPSSTKQYLTE 344
           IL++I  SRTCL + K +      ANLE LG+ S+ ASIS V+E  F++L +++   LT 
Sbjct: 270 ILTQIQQSRTCLSILKSQE--PHSANLENLGEMSIKASISFVIERYFTNLETASLNQLTT 327

Query: 345 RLSSIEFLTILSQRLFMPATRQLFADLSQEKIQVRVLNLILGSLVKDYGFDASLAPINEI 404
             SS EFL ILS  LF  A+R     L   ++Q+++L +++GS+V+D+GFD+ L P+NE+
Sbjct: 328 TSSSPEFLAILSSTLFNKASRTNLEGLPMNEVQIKLLFMVIGSIVRDFGFDSILYPLNEV 387

Query: 405 IYHM 408
           ++H+
Sbjct: 388 VHHV 391

>CAGL0M12507g complement(1243855..1244691) highly similar to
           sp|P40522 Saccharomyces cerevisiae YIL056w, hypothetical
           start
          Length = 278

 Score =  117 bits (292), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 61/73 (83%)

Query: 30  IRAQLNFNDEKKWKKFSSRRLELIDSFGLSQHKASEQDDNIRQIATILRSEFEYPDTFSA 89
           IR QL F DEKKWK+FSSRRLELID F LSQ KASEQD NI+QIA ILR+EF YP T S 
Sbjct: 15  IREQLGFTDEKKWKRFSSRRLELIDKFQLSQFKASEQDLNIKQIANILRTEFGYPVTCSM 74

Query: 90  EFEKLVTAAVQSV 102
           EFEKLVTAA+QSV
Sbjct: 75  EFEKLVTAAIQSV 87

>KLLA0C08151g 714910..716832 some similarities with sp|P40522
           Saccharomyces cerevisiae YIL056w, hypothetical start
          Length = 640

 Score =  119 bits (297), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 64/73 (87%)

Query: 30  IRAQLNFNDEKKWKKFSSRRLELIDSFGLSQHKASEQDDNIRQIATILRSEFEYPDTFSA 89
           IR QLNF+D+KKWK+FSSRRLELID F LS+ KASEQD+NIRQIA ILR+EF YP   S+
Sbjct: 14  IREQLNFSDDKKWKQFSSRRLELIDKFNLSERKASEQDENIRQIAHILRTEFGYPTITSS 73

Query: 90  EFEKLVTAAVQSV 102
           EFEKLVTAAVQSV
Sbjct: 74  EFEKLVTAAVQSV 86

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 88/142 (61%), Gaps = 2/142 (1%)

Query: 281 LRKLILSKIHNSRTCLEMSKDERNLDSFANLETLGKNSLMASISLVVENSFSHLPSSTKQ 340
           L++ ++  I NS+T +++S +  N     NL  LG++ +++SIS V+E  FS+L  ++  
Sbjct: 304 LKEKLMHFIQNSKTLIDLSSN-LNTQENNNLLKLGQHVILSSISFVLEKFFSNLSVNSVD 362

Query: 341 YLTERLSSIEFLTILSQRLFMPATRQLFADLSQEKIQVRVLNLILGSLVKDYGFDASLAP 400
           YL ++LSS + L+ +  +L    T++    L  E  +V++LN ILG +VKD+GFD  + P
Sbjct: 363 YLHDKLSSCDSLSEMCIKLIGSGTKRNLNQLPLE-WRVKLLNFILGGVVKDFGFDPCVYP 421

Query: 401 INEIIYHMTLHQYPLVCSNKQS 422
           + EI +   L +YPLVC + +S
Sbjct: 422 LAEIFHDSILKKYPLVCKDGKS 443

>Scas_704.29
          Length = 811

 Score =  115 bits (287), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 66/95 (69%)

Query: 8   SKIHLEGSXXXXXXXXXXXXXXIRAQLNFNDEKKWKKFSSRRLELIDSFGLSQHKASEQD 67
           SK   EG+              IRA LNF DE KWK+FSSRRLELID F LS+ KASEQD
Sbjct: 3   SKNDSEGNTNHTNSLSMGTTHRIRALLNFTDEVKWKQFSSRRLELIDKFKLSEFKASEQD 62

Query: 68  DNIRQIATILRSEFEYPDTFSAEFEKLVTAAVQSV 102
            NIRQIA ILR+EF YP  ++ EFEKLVTAAVQSV
Sbjct: 63  YNIRQIAAILRTEFGYPVHYTHEFEKLVTAAVQSV 97

 Score =  108 bits (271), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 116/203 (57%), Gaps = 20/203 (9%)

Query: 231 QEYDFIAKSIIVEIVNNAIPLPEQIQRDKFIRPNLTKKKGCQSKVVISNN---------- 280
           Q+ D   +  I EIVNN +PL EQ +      PNL +     S + IS +          
Sbjct: 291 QKIDDTTREYIYEIVNNVVPLTEQAKNSHNDMPNLAQFSEINSPLQISKDHESTSDEIPF 350

Query: 281 -LRKLILSKIHNSRTCLEMS-KDERNLDSFANLETLGKNSLMASISLVVENSFSHLPSST 338
            LR+ +L +I NS+TC ++S  +++  ++  NL+ LG  +L  S S V+E  FS L + +
Sbjct: 351 FLREKLLMQIQNSKTCSKLSLPNQKPPENLPNLQVLGNLALQISTSFVLERFFSDLSAVS 410

Query: 339 KQYLTERLSSIEFLTILSQRLFMPA-TRQLFADLSQEKIQVR-VLNLILGSLVKDYGFDA 396
             Y+T ++ S + +  LS +LF PA T  +F      +I  + +L ++LGS+VKD+GFD 
Sbjct: 411 MDYITSKILSEDNIKDLSNKLFSPAVTHNIF------EINTKFLLFILLGSIVKDFGFDP 464

Query: 397 SLAPINEIIYHMTLHQYPLVCSN 419
           +L P++E+++H+ + +YPLV  N
Sbjct: 465 TLYPLSEMLHHIIMKRYPLVTGN 487

>CAGL0J03014g complement(287508..289229) weakly similar to sp|P40522
           Saccharomyces cerevisiae YIL056w or sp|P40041
           Saccharomyces cerevisiae YER064c, hypothetical start
          Length = 573

 Score =  108 bits (270), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 53/73 (72%), Positives = 60/73 (82%)

Query: 30  IRAQLNFNDEKKWKKFSSRRLELIDSFGLSQHKASEQDDNIRQIATILRSEFEYPDTFSA 89
           IR QL F DE KWK+FSSRRLELID F LS++KASEQDDNI+QIA +LR EFE+P   + 
Sbjct: 14  IREQLRFTDEIKWKQFSSRRLELIDKFELSKYKASEQDDNIKQIANMLRIEFEFPVEATQ 73

Query: 90  EFEKLVTAAVQSV 102
            FEKLVTAAVQSV
Sbjct: 74  GFEKLVTAAVQSV 86

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 6/108 (5%)

Query: 308 FANLETLGKNSLMASISLVVENSFSHLPS---STKQYLTERLSSIEFLTILSQRLF--MP 362
           FAN+E LG+  L +S+S  VE +F+   S   STK+Y+T +    E LT  ++ LF    
Sbjct: 313 FANMEILGEMVLKSSVSFSVEKNFNDKFSKFASTKEYITLKTFQQESLTTFAKNLFNKFN 372

Query: 363 ATRQLFADLSQEKIQVRVLNLILGSLVKDYGFDASLAPINEIIYHMTL 410
                F       I V++L +I+G+LV D+GF+ +LA +N  +  +T+
Sbjct: 373 INANTFKQNDSPFI-VKLLFIIIGALVTDHGFEKTLAVLNPFLEDLTI 419

>Kwal_34.15922
          Length = 496

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 27/99 (27%)

Query: 311 LETLGKNSLMASISLVVENSFSHLPSSTKQYL------TERLSSIEFLTILSQRL----- 359
           LE LG + L  +I++++ N F HL       L       ERL    FL   +++L     
Sbjct: 227 LEFLGDSILNTTITMILYNQFPHLTEGQLSKLRMKLISNERLKKWSFLYKFNEKLRTNLD 286

Query: 360 -------FMPATRQLFADLSQEKIQVRVLNLILGSLVKD 391
                  F    ++L+AD         V    +G L++D
Sbjct: 287 KTCENSDFRQGKQKLYAD---------VFEAYIGGLIED 316

>Sklu_1792.4 YBR044C, Contig c1792 3897-5573
          Length = 558

 Score = 29.6 bits (65), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 57/113 (50%), Gaps = 22/113 (19%)

Query: 261 IRPNLTKKKGCQSKVVISNNLRKLILSKIHNSRTC------------LEMSKDERNLDSF 308
           +R  +T   G +S+  I    R+  L  I N+  C            + ++K   NLD+ 
Sbjct: 396 LRTTVTVNVGGESEFEIDQ--RRAALDNIINNILCHGLAQGFVPSYGVALAKSIANLDAG 453

Query: 309 ----ANLETLGKNSLMASISLVVENSFSHLPS----STKQYLTERLSSIEFLT 353
               +NL+++GK ++M S++  +EN+ ++L S    ST + +++ ++  +F T
Sbjct: 454 NVDKSNLQSVGKYAVMESLTYPLENAMNNLYSLDRFSTAKLISQTIADSDFTT 506

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.129    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,104,666
Number of extensions: 566957
Number of successful extensions: 1971
Number of sequences better than 10.0: 36
Number of HSP's gapped: 2001
Number of HSP's successfully gapped: 48
Length of query: 497
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 391
Effective length of database: 12,926,601
Effective search space: 5054300991
Effective search space used: 5054300991
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)