Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER062C (HOR2)25024711891e-167
YIL053W (RHR2)27124711021e-154
Scas_701.825024710631e-148
CAGL0M11660g24824510451e-145
Kwal_23.583124924310441e-145
CAGL0M12430g24924310411e-145
ADL071C2532429621e-133
CAGL0I05874g2472429221e-127
KLLA0C08217g2562429221e-127
Scas_704.322472418821e-121
Sklu_2394.32432282805e-30
CAGL0M12925g2462222659e-28
CAGL0D04092g2512382642e-27
KLLA0C11143g2682322492e-25
YHR043C (DOG2)2462232441e-24
AAL123W2892252451e-24
Scas_690.302592262397e-24
Scas_690.312442262361e-23
YHR044C (DOG1)2462202352e-23
CAGL0L01969g237179661.5
CAGL0A01386g110229671.6
Kwal_33.1405673038653.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER062C
         (247 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER062C (HOR2) [1493] chr5 complement(279928..280680) DL-glycero...   462   e-167
YIL053W (RHR2) [2614] chr9 (255050..255865) DL-glycerol phosphat...   429   e-154
Scas_701.8                                                            414   e-148
CAGL0M11660g complement(1158566..1159312) highly similar to sp|P...   407   e-145
Kwal_23.5831                                                          406   e-145
CAGL0M12430g complement(1238150..1238899) highly similar to sp|P...   405   e-145
ADL071C [1670] [Homologous to ScYIL053W (RHR2) - SH; ScYER062C (...   375   e-133
CAGL0I05874g complement(558102..558845) highly similar to sp|P41...   359   e-127
KLLA0C08217g 721753..722523 highly similar to sp|P41277 Saccharo...   359   e-127
Scas_704.32                                                           344   e-121
Sklu_2394.3 YHR043C, Contig c2394 2120-2851 reverse complement        112   5e-30
CAGL0M12925g 1274919..1275659 similar to sp|P38773 Saccharomyces...   106   9e-28
CAGL0D04092g 405613..406368 similar to sp|P38773 Saccharomyces c...   106   2e-27
KLLA0C11143g 956474..957280 similar to sp|P38773 Saccharomyces c...   100   2e-25
YHR043C (DOG2) [2331] chr8 complement(192797..193537) 2-Deoxyglu...    99   1e-24
AAL123W [64] [Homologous to ScYHR043C (DOG2) - SH; ScYHR044C (DO...    99   1e-24
Scas_690.30                                                            97   7e-24
Scas_690.31                                                            96   1e-23
YHR044C (DOG1) [2332] chr8 complement(194060..194800) 2-Deoxyglu...    95   2e-23
CAGL0L01969g 228760..229473 similar to tr|Q86ZR7 Saccharomyces c...    30   1.5  
CAGL0A01386g 136693..140001 some similarities with sp|P08640 Sac...    30   1.6  
Kwal_33.14056                                                          30   3.0  

>YER062C (HOR2) [1493] chr5 complement(279928..280680) DL-glycerol
           phosphate phosphatase (sn-glycerol-3-phosphatase) [753
           bp, 250 aa]
          Length = 250

 Score =  462 bits (1189), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 228/247 (92%), Positives = 228/247 (92%)

Query: 1   MGLTTKPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFD 60
           MGLTTKPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFD
Sbjct: 1   MGLTTKPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFD 60

Query: 61  AIAKFAPDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRD 120
           AIAKFAPDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRD
Sbjct: 61  AIAKFAPDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRD 120

Query: 121 MAQKWFEHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDX 180
           MAQKWFEHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFED 
Sbjct: 121 MAQKWFEHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDA 180

Query: 181 XXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGGYNAETDEVEFIFDDY 240
                             TTFDLDFLKEKGCDIIVKNHESIRVGGYNAETDEVEFIFDDY
Sbjct: 181 PAGIAAGKAAGCKIIGIATTFDLDFLKEKGCDIIVKNHESIRVGGYNAETDEVEFIFDDY 240

Query: 241 LYAKDDL 247
           LYAKDDL
Sbjct: 241 LYAKDDL 247

>YIL053W (RHR2) [2614] chr9 (255050..255865) DL-glycerol phosphate
           phosphatase (sn-glycerol-3-phosphatase) [816 bp, 271 aa]
          Length = 271

 Score =  429 bits (1102), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 210/247 (85%), Positives = 219/247 (88%)

Query: 1   MGLTTKPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFD 60
           M LTTKPLSLK+NAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVI +SHGWRT+D
Sbjct: 22  MPLTTKPLSLKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYD 81

Query: 61  AIAKFAPDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRD 120
           AIAKFAPDFA+EEYVNKLE EIP KYGE SIEVPGAVKLCNALNALPKEKWAVATSGTRD
Sbjct: 82  AIAKFAPDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNALPKEKWAVATSGTRD 141

Query: 121 MAQKWFEHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDX 180
           MA+KWF+ L I+RP+YFITANDVKQGKPHPEPYLKGRNGLG+PINEQDPSKSKVVVFED 
Sbjct: 142 MAKKWFDILKIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDA 201

Query: 181 XXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGGYNAETDEVEFIFDDY 240
                             TTFDLDFLKEKGCDIIVKNHESIRVG YNAETDEVE IFDDY
Sbjct: 202 PAGIAAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGEYNAETDEVELIFDDY 261

Query: 241 LYAKDDL 247
           LYAKDDL
Sbjct: 262 LYAKDDL 268

>Scas_701.8
          Length = 250

 Score =  414 bits (1063), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 203/247 (82%), Positives = 214/247 (86%)

Query: 1   MGLTTKPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFD 60
           MGLTTKPLSLKVNAALFDVDGTIIISQ AIAAFWRDFGKDKPYFDAEHVI +SHGWRT+D
Sbjct: 1   MGLTTKPLSLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYD 60

Query: 61  AIAKFAPDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRD 120
           AIAKFAPDFA+EE V+KLE EIP KYGE SIEVPGAVKLCN LN LPKEKWAVATSGTR+
Sbjct: 61  AIAKFAPDFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNKLPKEKWAVATSGTRE 120

Query: 121 MAQKWFEHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDX 180
           MA KWF+ L I+RP+YFITANDVKQGKPHPEPYLKGRNGLG+PINEQDPSKSK +VFED 
Sbjct: 121 MATKWFDLLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDA 180

Query: 181 XXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGGYNAETDEVEFIFDDY 240
                             TTFDLDFLKEKGCDIIVKNHESIRVGGY+  TDEVEFIFDDY
Sbjct: 181 PAGIVAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGGYDPVTDEVEFIFDDY 240

Query: 241 LYAKDDL 247
           LYAKDDL
Sbjct: 241 LYAKDDL 247

>CAGL0M11660g complement(1158566..1159312) highly similar to
           sp|P41277 Saccharomyces cerevisiae YIL053w RHR2 or
           sp|P40106 Saccharomyces cerevisiae YER062c GPP2,
           hypothetical start
          Length = 248

 Score =  407 bits (1045), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 199/245 (81%), Positives = 212/245 (86%)

Query: 3   LTTKPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAI 62
           ++T P+SLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVI +SHGWRT+DAI
Sbjct: 1   MSTSPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAI 60

Query: 63  AKFAPDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRDMA 122
           AKFAPD+A+EEYVNKLE EIP KYGE SIEVPGAVKLC  LN LPKEKWAVATSGTRDMA
Sbjct: 61  AKFAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMA 120

Query: 123 QKWFEHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDXXX 182
           QKWF+ L I RP+YFITANDVKQGKP PEPYLKGR GLG+PIN++DPSKSKVVVFED   
Sbjct: 121 QKWFKILNIERPEYFITANDVKQGKPFPEPYLKGREGLGFPINKEDPSKSKVVVFEDAPA 180

Query: 183 XXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGGYNAETDEVEFIFDDYLY 242
                           TTFD+DFLKEKGCDIIVKNHESIRVGGYN ETDEVEFIFDDYLY
Sbjct: 181 GIAAGKAAGCKIIGIATTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYLY 240

Query: 243 AKDDL 247
           AKDDL
Sbjct: 241 AKDDL 245

>Kwal_23.5831
          Length = 249

 Score =  406 bits (1044), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 199/243 (81%), Positives = 211/243 (86%)

Query: 5   TKPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAK 64
           +KPLS KVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVI  SHGWRT+DAIAK
Sbjct: 4   SKPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAIAK 63

Query: 65  FAPDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAQK 124
           FAPDFA+E+Y  +LEAEIP KYGE SIEVPGAVKLC  LNALPKEKWAVATSGTR MA K
Sbjct: 64  FAPDFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLNALPKEKWAVATSGTRPMASK 123

Query: 125 WFEHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDXXXXX 184
           WFEHLGI +P+YFITANDVKQGKP PEPYLKGRNGLG+PINEQDPSKSKV+VFED     
Sbjct: 124 WFEHLGIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFEDAPAGI 183

Query: 185 XXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGGYNAETDEVEFIFDDYLYAK 244
                         TTFDLDFLKEKGCDIIVK+HESIRVGGY+AETDEVEFIFDD+LYAK
Sbjct: 184 AAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKDHESIRVGGYDAETDEVEFIFDDFLYAK 243

Query: 245 DDL 247
           DDL
Sbjct: 244 DDL 246

>CAGL0M12430g complement(1238150..1238899) highly similar to
           sp|P41277 Saccharomyces cerevisiae YIL053w RHR2 or
           sp|P40106 Saccharomyces cerevisiae YER062c GPP2,
           hypothetical start
          Length = 249

 Score =  405 bits (1041), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 199/243 (81%), Positives = 210/243 (86%)

Query: 5   TKPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAK 64
            KP+SLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVI +SHGWRT+DAIAK
Sbjct: 4   AKPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK 63

Query: 65  FAPDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAQK 124
           FAPD+A+EEYVNKLE EIP KYGE SIEVPGAVKLC  LN LPKEKWAVATSGTRDMAQK
Sbjct: 64  FAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMAQK 123

Query: 125 WFEHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDXXXXX 184
           WF+ L I RP+YFITANDVKQGKP PEPY+KGR GLGYPIN++DPSKSKVVVFED     
Sbjct: 124 WFKFLNIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFEDAPAGI 183

Query: 185 XXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGGYNAETDEVEFIFDDYLYAK 244
                         TTFD+DFLKEKGCDIIVKNHESIRVGGYN ETDEVEFIFDDYLYAK
Sbjct: 184 AAGQAAGCKIIGIATTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYLYAK 243

Query: 245 DDL 247
           DDL
Sbjct: 244 DDL 246

>ADL071C [1670] [Homologous to ScYIL053W (RHR2) - SH; ScYER062C
           (HOR2) - SH] (556136..556897) [762 bp, 253 aa]
          Length = 253

 Score =  375 bits (962), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 177/242 (73%), Positives = 201/242 (83%)

Query: 6   KPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAKF 65
           +P+SLKVN ALFDVDGTIIISQPA+AAFWR+FGKDKPYFDAEHVI  +HGWRT+DAIA F
Sbjct: 9   QPISLKVNGALFDVDGTIIISQPALAAFWREFGKDKPYFDAEHVISATHGWRTYDAIATF 68

Query: 66  APDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAQKW 125
           APD+ +EEYV +LE EIP KYG+ S+EVPGAV LCNALN LPKEKWAV TSGT +MA KW
Sbjct: 69  APDYLSEEYVTRLEGEIPDKYGKFSVEVPGAVTLCNALNELPKEKWAVGTSGTFEMAHKW 128

Query: 126 FEHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDXXXXXX 185
           F+ LGI+RP  FITANDVKQGKPHPEPY+KGRN LG+PINEQ+P  SKV+VFED      
Sbjct: 129 FDVLGIKRPSTFITANDVKQGKPHPEPYIKGRNALGFPINEQNPKGSKVIVFEDAPAGIA 188

Query: 186 XXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGGYNAETDEVEFIFDDYLYAKD 245
                        TTFD+++LKE+GCDIIVK+H SIRVGGYN ETDEVEF+FDDYLYAKD
Sbjct: 189 AGKAAGCKIVGVATTFDVEYLKERGCDIIVKDHRSIRVGGYNPETDEVEFVFDDYLYAKD 248

Query: 246 DL 247
           DL
Sbjct: 249 DL 250

>CAGL0I05874g complement(558102..558845) highly similar to sp|P41277
           Saccharomyces cerevisiae YIL053w RHR2 or sp|P40106
           Saccharomyces cerevisiae YER062c GPP2, hypothetical
           start
          Length = 247

 Score =  359 bits (922), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 171/242 (70%), Positives = 196/242 (80%)

Query: 6   KPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAKF 65
           +P++L+VNAALFDVDGTIIISQPA+AAFWRDFGKDKPYFDAEHVI VSHGWRT+DAIAKF
Sbjct: 3   EPITLRVNAALFDVDGTIIISQPALAAFWRDFGKDKPYFDAEHVIHVSHGWRTYDAIAKF 62

Query: 66  APDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAQKW 125
           APDFA+EE V KLE EIP KYG+++IEV GAVKLCN+ N LPKEKWAVATSGTR+MA KW
Sbjct: 63  APDFADEETVTKLEGEIPDKYGKEAIEVAGAVKLCNSFNELPKEKWAVATSGTREMASKW 122

Query: 126 FEHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDXXXXXX 185
           F  LGI++P YFITANDVK+GKP+PEPYLKGR GLGYPIN   P KSKVVVFED      
Sbjct: 123 FAVLGIKKPTYFITANDVKKGKPNPEPYLKGREGLGYPINTHYPEKSKVVVFEDAPAGIA 182

Query: 186 XXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGGYNAETDEVEFIFDDYLYAKD 245
                        TTF    L+EKGCDI++K+H S+RV GY+ ETDEV  +FDDYLY +D
Sbjct: 183 AGKAAGCKIIGIATTFSASSLREKGCDIVIKDHRSVRVAGYDKETDEVILVFDDYLYVRD 242

Query: 246 DL 247
           D+
Sbjct: 243 DI 244

>KLLA0C08217g 721753..722523 highly similar to sp|P41277
           Saccharomyces cerevisiae YIL053w RHR2 DL-glycerol
           phosphatase, start by similarity
          Length = 256

 Score =  359 bits (922), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 196/242 (80%)

Query: 6   KPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAKF 65
           +P+SL+VNAALFDVDGT+IISQPAIA FWRDFGKDKPYFD++HVI +SHGWRT+D I +F
Sbjct: 12  QPISLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVIKQF 71

Query: 66  APDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAQKW 125
           APD+ANEEYV KLE EIP K+G+ +IEVPGA KLC  LN LPKEKWAVATSGT +MA KW
Sbjct: 72  APDYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNKLPKEKWAVATSGTYEMAHKW 131

Query: 126 FEHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDXXXXXX 185
           F+ LGI+RP  FITANDVK GKPHPEPYLKGRNGL YPIN+++P+ SKV+VFED      
Sbjct: 132 FDILGIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDAPAGIL 191

Query: 186 XXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGGYNAETDEVEFIFDDYLYAKD 245
                        TTFD +FL EKGCDI++K+H  +RV  Y+ ETDEVEFIFD+YLYAKD
Sbjct: 192 AGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVAAYHPETDEVEFIFDEYLYAKD 251

Query: 246 DL 247
           DL
Sbjct: 252 DL 253

>Scas_704.32
          Length = 247

 Score =  344 bits (882), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 162/241 (67%), Positives = 192/241 (79%)

Query: 7   PLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAKFA 66
           P++L+VNAALFDVDGTIIISQPA+AAFW+ FG+DKPYFDA+ V   +HGWRT+DAI KFA
Sbjct: 4   PIALRVNAALFDVDGTIIISQPALAAFWKHFGEDKPYFDADLVTHATHGWRTYDAIEKFA 63

Query: 67  PDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAQKWF 126
           PD+A+ EYV +LE EIP K+G+ ++EVPGAVKLCN  N LPKE+WAVATSGT +MA KWF
Sbjct: 64  PDWADREYVTQLEGEIPTKFGQHALEVPGAVKLCNEFNKLPKERWAVATSGTFEMASKWF 123

Query: 127 EHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDXXXXXXX 186
           E L I RP  FITANDV++GKPHP+PYLKGRNGLG+PIN  +PSKSKVVVFED       
Sbjct: 124 ELLKIERPTNFITANDVERGKPHPDPYLKGRNGLGFPINATNPSKSKVVVFEDAPAGIES 183

Query: 187 XXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGGYNAETDEVEFIFDDYLYAKDD 246
                       TTFD +FLKEKGCD+IV NHESI++ GY  ETDE+E +F DYL+AKDD
Sbjct: 184 GKAAGCKIVGVATTFDEEFLKEKGCDLIVSNHESIKLNGYYPETDEIELVFHDYLFAKDD 243

Query: 247 L 247
           L
Sbjct: 244 L 244

>Sklu_2394.3 YHR043C, Contig c2394 2120-2851 reverse complement
          Length = 243

 Score =  112 bits (280), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 79/228 (34%), Positives = 113/228 (49%), Gaps = 20/228 (8%)

Query: 10  LKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAKFAPDF 69
            KVN  LFD+DGTI+ +  A  + W++  K K   D E + + SHG RT +  +KF P  
Sbjct: 4   FKVNLCLFDLDGTIVSTTIAAESAWKELCK-KHGVDPEELFKCSHGARTSEIFSKFFPSI 62

Query: 70  AN--EEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNA--------LPKEKWAVATSGTR 119
            N   + V KLE  I   Y +    +PGA +L  +L+           K KWA+ TSG+ 
Sbjct: 63  DNTDNQAVKKLELAIAHDYLDSVGLIPGASELLLSLDKCSDPPFDNFSKRKWAIVTSGSS 122

Query: 120 DMAQKWF----EHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVV 175
           D+A  WF    +H+G  +P  FITA DV +GKP PE Y K R+ L    + + P   ++V
Sbjct: 123 DLAFSWFDTILQHIG--KPDVFITAFDVVKGKPDPEGYSKARDQLSKIWSLEFP---EIV 177

Query: 176 VFEDXXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRV 223
           VFED                   +T+  D L E G D +V +  ++ V
Sbjct: 178 VFEDAPVGIKAGKEIGAITVGITSTYSKDVLFEAGADYVVSDLTNVIV 225

>CAGL0M12925g 1274919..1275659 similar to sp|P38773 Saccharomyces
           cerevisiae YHR043c DOG2 2-deoxyglucose-6-phosphate
           phosphatase, hypothetical start
          Length = 246

 Score =  106 bits (265), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 70/222 (31%), Positives = 106/222 (47%), Gaps = 12/222 (5%)

Query: 12  VNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAKFAPDFAN 71
           V+  LFD+DGTI+ +  A+   W+    +    D E + + SHG RT +  AKF PD  N
Sbjct: 7   VDLCLFDLDGTIVSTTRAVEMTWKKLCAEHD-VDPEELFRFSHGTRTGEVFAKFFPDIDN 65

Query: 72  EEYVNKLEAEIPVKYGEKSIE-VPGAVKLCNALN-------ALPKEKWAVATSGTRDMAQ 123
                 +  E+ +      I  +PGA +L   L+       A+ + KWA+ TSG+ ++  
Sbjct: 66  TGNRAAVAFELSIADDLSLISLIPGAQELLLKLDKNTTDGSAVGERKWAIVTSGSPELTL 125

Query: 124 KWFEHL--GIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDXX 181
            WF+++   + RP  FI+  DV +GKP PE Y  GRN L   +   D S ++ VVFED  
Sbjct: 126 SWFDNVLKEVGRPPVFISGADVAKGKPDPEGYYTGRNLLCQKLG-LDASHARTVVFEDAP 184

Query: 182 XXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRV 223
                             T+D D L   G D +V +   ++V
Sbjct: 185 VGIMAGKAIGAITVGIAGTYDKDLLYSAGADYVVSDLNQVKV 226

>CAGL0D04092g 405613..406368 similar to sp|P38773 Saccharomyces
           cerevisiae YHR043c DOG2 2-deoxyglucose-6-phosphate
           phosphatase, hypothetical start
          Length = 251

 Score =  106 bits (264), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 114/238 (47%), Gaps = 19/238 (7%)

Query: 12  VNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAKFAPDFAN 71
           V+  LFD+DGTI+ +  A  + WR     K   D E + + SHG RT + +AKF P+  N
Sbjct: 11  VDVCLFDLDGTIVSTTVAAESAWRMLCA-KEGVDPEELFKFSHGVRTSEVLAKFFPNIDN 69

Query: 72  EEYVNKLEAEIPVKYGEKSIE----VPGAVKLCNALNA--------LPKEKWAVATSGTR 119
            +  NK+  E+ +      ++    +PGA  L   L+           + KWA+ TSG+ 
Sbjct: 70  TD--NKMTRELELSMANNFLDTVSLIPGAKDLLLTLDKDTARQGAKFNERKWAIVTSGSP 127

Query: 120 DMAQKWFEHL--GIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVF 177
           D+A  WF+ +   + +P  FITA DV +GKP PE Y K +  L   +  +  S +  VVF
Sbjct: 128 DLAFSWFKTILKEVGKPDVFITAFDVTKGKPDPEGYAKAKKLLCERLQYESASATS-VVF 186

Query: 178 EDXXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGGYNAETDEVEF 235
           ED                   +T+DL  L + G D +VK+   + V   N E D++  
Sbjct: 187 EDAPAGIKAGKAMGAITVGITSTYDLQTLIDAGADYVVKDLTQVEV-LKNTEGDQITL 243

>KLLA0C11143g 956474..957280 similar to sp|P38773 Saccharomyces
           cerevisiae YHR043c DOG2 2-deoxyglucose-6-phosphate
           phosphatase, start by similarity
          Length = 268

 Score =  100 bits (249), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 112/232 (48%), Gaps = 15/232 (6%)

Query: 9   SLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAKFAP- 67
           S+ V+  LFD+DGT++ S  A    W     DK   D   + +VSHG RT + +AKF P 
Sbjct: 3   SIAVDYVLFDLDGTLVSSTDAAEEAWNKLC-DKYGVDYSTLSKVSHGSRTAEILAKFFPN 61

Query: 68  -DFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALN----ALPKE-----KWAVATSG 117
            D  N + V + E  I   Y +    +PG++ L  +L+    A P E     KWAV TSG
Sbjct: 62  VDNTNNQAVKEFELSIANDYMDIVCLIPGSIDLLISLDRPTGAHPGEVFHHRKWAVVTSG 121

Query: 118 TRDMAQKWFEHL--GIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVV 175
           +  +A  WF++L   I++P+ FITA DV +GKP P  +      L   I + D  + + V
Sbjct: 122 SPWVAHAWFDNLLKSIKKPEVFITAFDVSKGKPDPAGFALATKRLK-EIWQDDRKEVRTV 180

Query: 176 VFEDXXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGGYN 227
           VFED                   +T+D + L   G D +V++   + +   N
Sbjct: 181 VFEDAPVGVQAGKANGSIVVALTSTYDKELLFAAGADYVVEDLSQVCLQSNN 232

>YHR043C (DOG2) [2331] chr8 complement(192797..193537)
           2-Deoxyglucose-6-phosphate phosphatase, converts
           2-deoxy-D-glucose 6-phosphate to 2-deoxy-D-glucose and
           orthophosphate [741 bp, 246 aa]
          Length = 246

 Score = 98.6 bits (244), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 105/223 (47%), Gaps = 12/223 (5%)

Query: 12  VNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAKFAPDFAN 71
           V+  LFD+DGTI+ +  A  + W+   + +   D   + + SHG R+ + + KF P   N
Sbjct: 6   VDLCLFDLDGTIVSTTTAAESAWKKLCR-QHGVDPVELFKHSHGARSQEMMKKFFPKLDN 64

Query: 72  EEY--VNKLEAEIPVKYGEKSIEVPGAVKLCNALNA-------LPKEKWAVATSGTRDMA 122
            +   V  LE ++   Y +    +PGA  L  +L+        LP+ KWA+ TSG+  +A
Sbjct: 65  TDNKGVLALEKDMADNYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLA 124

Query: 123 QKWFEHL--GIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDX 180
             WFE +   + +PK FIT  DVK GKP PE Y + R+ L   +        K VVFED 
Sbjct: 125 FSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDA 184

Query: 181 XXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRV 223
                             +++D   L + G D +V +   + V
Sbjct: 185 PVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSV 227

>AAL123W [64] [Homologous to ScYHR043C (DOG2) - SH; ScYHR044C (DOG1)
           - SH] complement(131449..132318) [870 bp, 289 aa]
          Length = 289

 Score = 99.0 bits (245), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 103/225 (45%), Gaps = 14/225 (6%)

Query: 10  LKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAKFAPDF 69
           + V+  LFD+DGTI+ +  A+ A W+  G+     DA  + + SHG R  +   ++ PD 
Sbjct: 4   ITVDVCLFDLDGTIVDTTDAVEAAWQKVGR-AHQVDAAKIRRNSHGRRASETFKQYFPDA 62

Query: 70  ANEEYVNKLEAEIPVKYGEKSIEVPGAVKL---------CNALNALPKEKWAVATSGTRD 120
            N+  V + E  + V        +PGA  L         CN        +WA+ TS T  
Sbjct: 63  DNDAAVKEFEHAL-VSQSHYVGLIPGANDLLLTLDRPSGCNPGEVFRDNRWAIVTSATPS 121

Query: 121 MAQKWFEHL--GIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFE 178
           +A+ WF  L   ++ PK FIT+ DV +GKP PE Y K ++ L   I   +  K + VVFE
Sbjct: 122 LARSWFNTLLKKVKPPKVFITSADVAKGKPDPEGYQKAKDQLA-DILGLNKDKVRAVVFE 180

Query: 179 DXXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRV 223
           D                   +T+  D L   G D +V++   + V
Sbjct: 181 DSALGIRAAKAMGAIAVGITSTYSKDVLYRSGADYVVEDLAQVCV 225

>Scas_690.30
          Length = 259

 Score = 96.7 bits (239), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 68/226 (30%), Positives = 109/226 (48%), Gaps = 13/226 (5%)

Query: 9   SLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAKFAP- 67
           S  V+  LFD+DGT++ +  A  A W D   +    + + + + SHG +T + +A++ P 
Sbjct: 5   SFNVDVCLFDLDGTLVNTIKASEAVWTDLCNEHG-VNPQELFKHSHGVKTSEVLAEWFPM 63

Query: 68  -DFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALN-------ALPKEKWAVATSGTR 119
            D  +++ V  LE  +   +      VPGA+ L   L+           +KWA+ TSG+ 
Sbjct: 64  LDNTDDKAVKYLEESMGRDHLSSVFAVPGAIDLLKQLDIDTDTGKKFKDKKWAIVTSGST 123

Query: 120 DMAQKWFEHL--GIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVF 177
            +A  WF+ +   + +P+ F+TA DVK GKP PE Y K R+ L    N  D   +K VVF
Sbjct: 124 YIAFGWFKSILSELEKPEVFVTAFDVKNGKPDPEGYSKARDELCKTWN-FDVKTAKSVVF 182

Query: 178 EDXXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRV 223
           ED                   +T+D   L + G D +V++   I +
Sbjct: 183 EDAPVGIQAGKAMGAITVGITSTYDKKVLFDAGADYVVRDLSQITI 228

>Scas_690.31
          Length = 244

 Score = 95.5 bits (236), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 109/226 (48%), Gaps = 15/226 (6%)

Query: 9   SLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAKFAPD 68
           +  V+  LFD+DGTI+ +  A+   W  F K K   +AE + + SHG R+ + +A+F P 
Sbjct: 3   TFTVDLCLFDLDGTIVSTTIAVERAWIKFCK-KHNVNAEELFEHSHGARSGEIMARFFPH 61

Query: 69  FANEEYVNKLEAEIPVKYGEKSIE----VPGAVKLCNALNALP-----KEKWAVATSGTR 119
             N +  NK   E+ +     +I+    +PG+ KL  AL+        K KWA+ TSG+ 
Sbjct: 62  VDNTD--NKATKELELSMAYDNIDTVSLIPGSEKLLLALDKATTKDATKRKWAIVTSGSP 119

Query: 120 DMAQKWFEHL--GIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVF 177
            +A  WF+ +   + +P  FIT  DV++GKP PE Y K R+ L       D    + VVF
Sbjct: 120 YLAFSWFDTILKDVGKPDVFITGFDVEKGKPDPEGYGKARDQLCKNWG-PDNKHVRTVVF 178

Query: 178 EDXXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRV 223
           ED                    T+D + L + G D +V +   + V
Sbjct: 179 EDAPVGIKAGKAIGAITVGITFTYDKNLLFDAGADYVVADLTHVSV 224

>YHR044C (DOG1) [2332] chr8 complement(194060..194800)
           2-Deoxyglucose-6-phosphate phosphatase [741 bp, 246 aa]
          Length = 246

 Score = 95.1 bits (235), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/220 (30%), Positives = 101/220 (45%), Gaps = 12/220 (5%)

Query: 15  ALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAKFAP--DFANE 72
            LFD+DGTI+ +  A    W     +    D   + + SHG RT + + +F P  D  + 
Sbjct: 9   CLFDLDGTIVSTTVAAEKAWTKLCYEYG-VDPSELFKHSHGARTQEVLRRFFPKLDDTDN 67

Query: 73  EYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNA-------LPKEKWAVATSGTRDMAQKW 125
           + V  LE +I   Y +    +PGA  L  +L+        LP+ KWA+ TSG+  +A  W
Sbjct: 68  KGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSW 127

Query: 126 FEHL--GIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDXXXX 183
           FE +   + +PK FIT  DVK GKP PE Y + R+ L   +        K VVFED    
Sbjct: 128 FETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVG 187

Query: 184 XXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRV 223
                          +++D   L + G D +V +   + V
Sbjct: 188 IKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSV 227

>CAGL0L01969g 228760..229473 similar to tr|Q86ZR7 Saccharomyces
           cerevisiae YKL033wa, hypothetical start
          Length = 237

 Score = 30.0 bits (66), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 72/179 (40%), Gaps = 12/179 (6%)

Query: 11  KVNAALFDVDGTII----ISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAKFA 66
           +V A LFD+DG +I    I    +    +++G     +D +  +Q   G      I +  
Sbjct: 7   RVKACLFDMDGLLINTEDIYTLTLNRILKEYGLGPLTWDVKIQLQGLPGPEAGKKIIETY 66

Query: 67  PDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAQKWF 126
                 + +     EI   Y   +  +PGA++L   L +      A+ TS  +   +   
Sbjct: 67  KLPLTPKELETKNIEIQNDYWPTAAFLPGALELLKYLKS-KNIPIALCTSSNKIKFKGKT 125

Query: 127 EHL--GIRRPKYFITANDVK----QGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFED 179
            HL  G       +T +D +    +GKP P+ +  G   L    N    S S+ +VFED
Sbjct: 126 SHLGEGFNLFDAIVTGDDERIPSGRGKPFPDVWQVGLKSLNDKFN-TSISPSECLVFED 183

>CAGL0A01386g 136693..140001 some similarities with sp|P08640
           Saccharomyces cerevisiae YIR019c STA1, hypothetical
           start
          Length = 1102

 Score = 30.4 bits (67), Expect = 1.6,   Method: Composition-based stats.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 218 HESIRVGGYNAETDEVEFIFDDYLYAKDD 246
           H    VG Y   T+E+ + FD YLY  DD
Sbjct: 260 HSKFMVGFYPPNTEEITYDFDGYLYMLDD 288

>Kwal_33.14056
          Length = 730

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 111 WAVATSGTRDMAQKW-FEHLGIRRPKYFITANDVKQGK 147
           WA+     R   ++W F  + +   ++ +T N+VK GK
Sbjct: 652 WAIEMQEIRQTVERWNFNRITLTLARHLVTINNVKNGK 689

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.138    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,164,211
Number of extensions: 335289
Number of successful extensions: 703
Number of sequences better than 10.0: 24
Number of HSP's gapped: 665
Number of HSP's successfully gapped: 24
Length of query: 247
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 148
Effective length of database: 13,168,927
Effective search space: 1949001196
Effective search space used: 1949001196
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)