Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER061C (CEM1)44243523010.0
Scas_715.4844844514850.0
CAGL0J02970g44845112941e-177
Kwal_23.582842443812221e-166
ADL072C43344110951e-147
KLLA0C08239g4294339161e-120
Kwal_23.48621731219940.002
KLLA0C15983g1893250880.011
YPL231W (FAS2)1887255870.018
Kwal_56.24248877217840.035
AFL138W1891250840.035
CAGL0E06138g1883250810.079
YLR106C (MDN1)491058740.52
ADR165C397114691.7
KLLA0C06336g519205691.7
Kwal_27.1130347921673.5
Sklu_1799.254256648.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER061C
         (435 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER061C (CEM1) [1492] chr5 complement(278296..279624) Beta-ketoa...   890   0.0  
Scas_715.48                                                           576   0.0  
CAGL0J02970g complement(284370..285716) similar to sp|P39525 Sac...   503   e-177
Kwal_23.5828                                                          475   e-166
ADL072C [1669] [Homologous to ScYER061C (CEM1) - SH] (554605..55...   426   e-147
KLLA0C08239g 723077..724366 similar to sp|P39525 Saccharomyces c...   357   e-120
Kwal_23.4862                                                           41   0.002
KLLA0C15983g 1389936..1395617 highly similar to sp|P19097 Saccha...    39   0.011
YPL231W (FAS2) [5218] chr16 (108652..114315) Fatty-acyl-CoA synt...    38   0.018
Kwal_56.24248                                                          37   0.035
AFL138W [3057] [Homologous to ScYPL231W (FAS2) - SH] complement(...    37   0.035
CAGL0E06138g complement(611598..617249) highly similar to sp|P19...    36   0.079
YLR106C (MDN1) [3521] chr12 complement(349007..363739) Nuclear p...    33   0.52 
ADR165C [1907] [Homologous to ScYPL028W (ERG10) - SH] (991934..9...    31   1.7  
KLLA0C06336g 561371..562930 highly similar to sp|P32340 Saccharo...    31   1.7  
Kwal_27.11303                                                          30   3.5  
Sklu_1799.2 YDR235W, Contig c1799 1242-2870 reverse complement         29   8.0  

>YER061C (CEM1) [1492] chr5 complement(278296..279624)
           Beta-ketoacyl-ACP synthase, mitochondrial
           (3-oxoacyl-[Acyl-carrier-protein] synthase) [1329 bp,
           442 aa]
          Length = 442

 Score =  890 bits (2301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/435 (100%), Positives = 435/435 (100%)

Query: 1   MSRRVVITGLGCVTPLGRSLSESWGNLLSSKNGLTPITSLPNYNEDYKLREKSIPSTITV 60
           MSRRVVITGLGCVTPLGRSLSESWGNLLSSKNGLTPITSLPNYNEDYKLREKSIPSTITV
Sbjct: 1   MSRRVVITGLGCVTPLGRSLSESWGNLLSSKNGLTPITSLPNYNEDYKLREKSIPSTITV 60

Query: 61  GKIPENFQNENSAINKLLFTSQDERRTSSFIKLALRTTYEALHNAGLLNPNDITINTSLC 120
           GKIPENFQNENSAINKLLFTSQDERRTSSFIKLALRTTYEALHNAGLLNPNDITINTSLC
Sbjct: 61  GKIPENFQNENSAINKLLFTSQDERRTSSFIKLALRTTYEALHNAGLLNPNDITINTSLC 120

Query: 121 NLDHFGCLIGSGIGSIQDIYQTSLQFHNDNKRINPYFVPKILTNMAAGNVSIKFNLRGLS 180
           NLDHFGCLIGSGIGSIQDIYQTSLQFHNDNKRINPYFVPKILTNMAAGNVSIKFNLRGLS
Sbjct: 121 NLDHFGCLIGSGIGSIQDIYQTSLQFHNDNKRINPYFVPKILTNMAAGNVSIKFNLRGLS 180

Query: 181 HSVSTACATGNNSIGDAFNFIRLGMQDICVAGASETSLHPLSLAGFIRAKSITTNGISRP 240
           HSVSTACATGNNSIGDAFNFIRLGMQDICVAGASETSLHPLSLAGFIRAKSITTNGISRP
Sbjct: 181 HSVSTACATGNNSIGDAFNFIRLGMQDICVAGASETSLHPLSLAGFIRAKSITTNGISRP 240

Query: 241 FDTQRSGFVLGEGCGMIVMESLEHAQKRNANIISELVGYGLSSDACHITSPPADGNGAKR 300
           FDTQRSGFVLGEGCGMIVMESLEHAQKRNANIISELVGYGLSSDACHITSPPADGNGAKR
Sbjct: 241 FDTQRSGFVLGEGCGMIVMESLEHAQKRNANIISELVGYGLSSDACHITSPPADGNGAKR 300

Query: 301 AIEMALKMARLEPTDVDYVNAHATSTLLGDKAECLAVASALLPGRSKSKPLYISSNKGAI 360
           AIEMALKMARLEPTDVDYVNAHATSTLLGDKAECLAVASALLPGRSKSKPLYISSNKGAI
Sbjct: 301 AIEMALKMARLEPTDVDYVNAHATSTLLGDKAECLAVASALLPGRSKSKPLYISSNKGAI 360

Query: 361 GHLLGARGAVESIFTICSLKDDKMPHTLNLDNVLTLENNEADKLHFIRDKPIVGANPKYA 420
           GHLLGARGAVESIFTICSLKDDKMPHTLNLDNVLTLENNEADKLHFIRDKPIVGANPKYA
Sbjct: 361 GHLLGARGAVESIFTICSLKDDKMPHTLNLDNVLTLENNEADKLHFIRDKPIVGANPKYA 420

Query: 421 LCNSFGFGGVNTSLL 435
           LCNSFGFGGVNTSLL
Sbjct: 421 LCNSFGFGGVNTSLL 435

>Scas_715.48
          Length = 448

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/445 (64%), Positives = 353/445 (79%), Gaps = 14/445 (3%)

Query: 1   MSRRVVITGLGCVTPLGRSLSESWGNLLSSKNGLTPITSLPNYNEDYKLREKSIPSTITV 60
           MSRRVV+TGLGC TPLG +L ESW NLL SK+G+ PITSL NY  DY+   K IP TI+V
Sbjct: 1   MSRRVVVTGLGCATPLGNTLRESWKNLLKSKSGIVPITSLENYESDYEPFAKHIPRTISV 60

Query: 61  GKIPENFQNENSAINKLLFTSQDERRTSSFIKLALRTTYEALHNAGLL----NPNDITIN 116
           G+IP   +++   +++L FTSQ+ERR S FIKLA+++TYEAL +A LL    +P++  I+
Sbjct: 61  GRIPTPTESDQQELDQL-FTSQEERRYSKFIKLAIQSTYEALKSANLLTHKSSPSNPEID 119

Query: 117 TSLCNLDHFGCLIGSGIGSIQDIYQTSLQFHNDNKRINPYFVPKILTNMAAGNVSIKFNL 176
            + CN++ FGC+IGSGIGSI DIY T+LQF N  K+I+PYFVPKILTNMAAGNVSIKFNL
Sbjct: 120 ITHCNMEKFGCVIGSGIGSISDIYSTTLQFQN-GKKISPYFVPKILTNMAAGNVSIKFNL 178

Query: 177 RGLSHSVSTACATGNNSIGDAFNFIRLGMQDICVAGASETSLHPLSLAGFIRAKSITTNG 236
           RGLSHSVSTACATGNNSIGDA+NFIRLGMQDICVAGASE S+HPLSLAGF+RAKSITT+G
Sbjct: 179 RGLSHSVSTACATGNNSIGDAYNFIRLGMQDICVAGASEASIHPLSLAGFLRAKSITTDG 238

Query: 237 ISRPFDTQRSGFVLGEGCGMIVMESLEHAQKRNANIISELVGYGLSSDACHITSPPADGN 296
           ISRPFD +RSGFVLGEG GM+V+ESLEHA+KRNA I  E+ GYGLSSDA HITSPP+DGN
Sbjct: 239 ISRPFDLERSGFVLGEGAGMVVLESLEHAKKRNAKIFCEIKGYGLSSDAYHITSPPSDGN 298

Query: 297 GAKRAIEMALKMARLEPTDVDYVNAHATSTLLGDKAECLAVASALL------PGRSKSKP 350
           GA+RA++MA+  + +   ++DYVNAHATST +GD  E  A+ S+ +         +++KP
Sbjct: 299 GARRAMDMAINSSSISRDEIDYVNAHATSTPVGDITEVKAIYSSFINENIFDKSNTRTKP 358

Query: 351 LYISSNKGAIGHLLGARGAVESIFTICSLKDDKMPHTLNLDNVLTLENNEADKLHFIRDK 410
           LY+SSNKG+IGHLLGA GAVESIFTI SL++  +PHTLNL +   +E   ++ L  + D+
Sbjct: 359 LYVSSNKGSIGHLLGAAGAVESIFTIMSLREKIIPHTLNLAH--PIEEVSSELLELVMDE 416

Query: 411 PIVGANPKYALCNSFGFGGVNTSLL 435
           P        ALCNSFGFGGVNT+LL
Sbjct: 417 PASPKQVNSALCNSFGFGGVNTALL 441

>CAGL0J02970g complement(284370..285716) similar to sp|P39525
           Saccharomyces cerevisiae YER061c CEM1, start by
           similarity
          Length = 448

 Score =  503 bits (1294), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 264/451 (58%), Positives = 330/451 (73%), Gaps = 25/451 (5%)

Query: 1   MSRRVVITGLGCVTPLGRSLSESWGNLLS-SKNGLTPITSLPNYNEDYKLREKSIPSTIT 59
           MSRRVV+TGLGCVTPLG+S+ ESW  LL    NGL  +  L     D+       P  + 
Sbjct: 1   MSRRVVVTGLGCVTPLGKSVKESWHRLLQRDSNGLVKLDQLTK--GDFAKWRGIFPPELR 58

Query: 60  VGKIP--ENFQNENSAINKLLFTSQDERRTSSFIKLALRTTYEALHNAGLLNPND----- 112
           VG +   E+F+     +N  LFTSQD+RR S FIKLA   +YEAL ++GL+N        
Sbjct: 59  VGAVSPIESFE-----VNSQLFTSQDDRRMSRFIKLATIASYEALVSSGLVNKETKMSED 113

Query: 113 ----ITINTSLCNLDHFGCLIGSGIGSIQDIYQTSLQFHNDNK--RINPYFVPKILTNMA 166
               I  +    + D  GCLIGSGIGSI+DIY+TS+ F ++ K  RINPYFVP+ILTNMA
Sbjct: 114 GRIPIDQHNQGIDPDKVGCLIGSGIGSIEDIYETSVTFDSNTKKNRINPYFVPRILTNMA 173

Query: 167 AGNVSIKFNLRGLSHSVSTACATGNNSIGDAFNFIRLGMQDICVAGASETSLHPLSLAGF 226
           AGN++IKFNLRG +HSVSTACATGNN+IGD +N I+LGMQDIC+AGASE S+HPLSLAGF
Sbjct: 174 AGNIAIKFNLRGPTHSVSTACATGNNAIGDGYNMIKLGMQDICLAGASEASVHPLSLAGF 233

Query: 227 IRAKSITTNGISRPFDTQRSGFVLGEGCGMIVMESLEHAQKRNANIISELVGYGLSSDAC 286
           +RAKS++ +GISRPFD +R+GFVLGEG G++V+ESLE A++R A I++E+VGYGLS DA 
Sbjct: 234 LRAKSLSPDGISRPFDEERNGFVLGEGAGIVVLESLESAERRGAPILAEIVGYGLSCDAH 293

Query: 287 HITSPPADGNGAKRAIEMALKMAR--LEPTDVDYVNAHATSTLLGDKAECLAVASALLPG 344
           HITSPP DG GA RAI+MAL ++   +   D++YVNAHATST LGD  EC A+ + L+  
Sbjct: 294 HITSPPNDGEGASRAIKMALDLSHGNVNARDIEYVNAHATSTKLGDNTECCAIQNTLIDN 353

Query: 345 RSKSKPLYISSNKGAIGHLLGARGAVESIFTICSLKDDKMPHTLNLDNVLTLENNEADKL 404
            ++ KPLYISSNKG+IGHLLGA GA ESIFTI SL +  +PHT NL NVL   N E+  +
Sbjct: 354 VNRQKPLYISSNKGSIGHLLGAAGAAESIFTILSLYNRTIPHTYNLKNVLG--NFESSSM 411

Query: 405 HFIRDKPIVGANPKYALCNSFGFGGVNTSLL 435
            F++ +P   A+ +YALCNSFGFGGVNTSLL
Sbjct: 412 RFVKSQPHKVADLEYALCNSFGFGGVNTSLL 442

>Kwal_23.5828
          Length = 424

 Score =  475 bits (1222), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 253/438 (57%), Positives = 315/438 (71%), Gaps = 23/438 (5%)

Query: 1   MSRRVVITGLGCVTPLGRSLSESWGNLLSSKNGLTPITSLPNYNEDYKLREKSIPSTITV 60
           M+ RVV+TGLG +TPLGR++SESW  LL+ K+G+ PI  LPN     K  E   P+++ V
Sbjct: 1   MTSRVVVTGLGAITPLGRTVSESWRALLAGKSGIRPIRDLPNA----KSYEGHCPASVAV 56

Query: 61  GKIPENFQNENSAINKLLFTSQDERRTSSFIKLALRTTYEALHNAGLLNPNDITINTSLC 120
             IP+ F  +       LFTSQD RR S F + A+    EAL +A +L     + N    
Sbjct: 57  ADIPD-FDPQAYGD---LFTSQDLRRMSQFTQFAMVAAQEALQDADILQMLAESKN---- 108

Query: 121 NLDHFGCLIGSGIGSIQDIYQTSLQFHNDNKRINPYFVPKILTNMAAGNVSIKFNLRGLS 180
             D  GC+IGSGIGSIQD+Y T + F    KR+ P FVPKIL NMA GN+SIKF LRG+S
Sbjct: 109 --DRVGCVIGSGIGSIQDMYDTIVDFER-GKRVAPTFVPKILANMACGNISIKFQLRGVS 165

Query: 181 HSVSTACATGNNSIGDAFNFIRLGMQDICVAGASETSLHPLSLAGFIRAKSITTNGISRP 240
           H VSTACATGNN+IGDA+NFIRLG  D+C+AGASE S+HPLSLAGF+RAKSITT+G+SRP
Sbjct: 166 HCVSTACATGNNAIGDAYNFIRLGYNDVCLAGASEASVHPLSLAGFLRAKSITTSGVSRP 225

Query: 241 FDTQRSGFVLGEGCGMIVMESLEHAQKRNANIISELVGYGLSSDACHITSPPADGNGAKR 300
           FD +R GFVLGEG G++V+ESLEHAQ+R A I +E+ GYGL+SDA HIT+P  +G GA+R
Sbjct: 226 FDKERDGFVLGEGAGLVVLESLEHAQRRGARIYAEIEGYGLTSDAHHITAPSENGEGARR 285

Query: 301 AIEMALKMARLEPTDVDYVNAHATSTLLGDKAECLAVASALLPGRSKSKPLYISSNKGAI 360
           A+EMALK    +P  VDY+NAHATST+LGD+AE  A++S  L        L +SSNKGAI
Sbjct: 286 AMEMALK--NHDPRKVDYINAHATSTVLGDRAESQAISS--LFSTPNPSTLKVSSNKGAI 341

Query: 361 GHLLGARGAVESIFTICSLKDDKMPHTLNLDNVLTLENNEAD---KLHFIRDKPIVGANP 417
           GHLLGA GAVESIFTI SL++  +PHTLNL N+   + +EAD    L  +RDKP V  + 
Sbjct: 342 GHLLGAAGAVESIFTIKSLQEGIIPHTLNLSNIGGAKGDEADTFNSLDLVRDKPAV-HDI 400

Query: 418 KYALCNSFGFGGVNTSLL 435
           + AL NSFGFGG+N+SLL
Sbjct: 401 QLALNNSFGFGGINSSLL 418

>ADL072C [1669] [Homologous to ScYER061C (CEM1) - SH]
           (554605..555906) [1302 bp, 433 aa]
          Length = 433

 Score =  426 bits (1095), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 226/441 (51%), Positives = 309/441 (70%), Gaps = 18/441 (4%)

Query: 1   MSRRVVITGLGCVTPLGRSLSESWGNLLSSKNGLTPITSLPNYNEDYKLREKSIPSTITV 60
           M  RVV+TG+GC TPLG SL++SW  LL   +GL  +  L  Y  DYK   + I   + V
Sbjct: 1   MHPRVVVTGIGCYTPLGPSLAQSWKELLRGTSGLVRLQDLAEYEGDYKPLSRLISGDLRV 60

Query: 61  GKIPENFQNENSAINKLLFTSQDERRTSSFIKLALRTTYEALHNAGLLNPNDITINTSLC 120
           GK+   F+    A ++ L +SQ++RRTS   +LA+ T  EAL +AGLL+ + +  +    
Sbjct: 61  GKV--GFE----ARDQELLSSQEQRRTSRAAQLAMVTAEEALRHAGLLSGSHLVASV--- 111

Query: 121 NLDHFGCLIGSGIGSIQDIYQTSLQFHNDNK-RINPYFVPKILTNMAAGNVSIKFNLRGL 179
           + +  GC+IG+G+ S++DI Q +    +  +  ++P+F+PK+L NMAAGNV+IKF LRG 
Sbjct: 112 DRNRAGCIIGAGLPSMEDISQATASLSSARRPSVSPFFIPKMLNNMAAGNVAIKFQLRGA 171

Query: 180 SHSVSTACATGNNSIGDAFNFIRLGMQDICVAGASETSLHPLSLAGFIRAKSITTNGISR 239
           S+  STACA+GNN+IGDA+NFIRLG  D+ VAGASE S+HPL+LAGF++AKSI+ +GISR
Sbjct: 172 SNCPSTACASGNNAIGDAYNFIRLGYSDVIVAGASELSVHPLALAGFVKAKSISASGISR 231

Query: 240 PFDTQRSGFVLGEGCGMIVMESLEHAQKRNANIISELVGYGLSSDACHITSPPADGNGAK 299
           PFD +R GFVLGEGCG++V+ESLEHA+ R A II+E+VGYG+ SDA HITSP   G+GA+
Sbjct: 232 PFDARRDGFVLGEGCGLLVLESLEHARHRGAEIIAEVVGYGVCSDAHHITSPSEGGDGAR 291

Query: 300 RAIEMALKMARLEPT--DVDYVNAHATSTLLGDKAECLAVASALLPGRSKSKPLYISSNK 357
           RA+ MAL+ A +  T   V YVNAHATST LGD+AE  A+ +    G + +    +SSNK
Sbjct: 292 RAMHMALQDAGIWDTRDQVGYVNAHATSTPLGDRAEARAIQAVF--GATGTGSTLVSSNK 349

Query: 358 GAIGHLLGARGAVESIFTICSLKDDKMPHTLNLDNV---LTLENNEADKLHFIRDKPIVG 414
           G +GHLLGA GAVE++FT+ SL++  +PHTLNL  V   L  + +    + F++D P V 
Sbjct: 350 GHMGHLLGAAGAVEAVFTVQSLREGIVPHTLNLQTVGEGLADKKDGFGGITFVQDNP-VP 408

Query: 415 ANPKYALCNSFGFGGVNTSLL 435
           A   YA+ NSFGFGG+N+SLL
Sbjct: 409 APLTYAMNNSFGFGGINSSLL 429

>KLLA0C08239g 723077..724366 similar to sp|P39525 Saccharomyces
           cerevisiae YER061c CEM1 beta-keto-acyl-ACP synthase,
           mitochondrial singleton, start by similarity
          Length = 429

 Score =  357 bits (916), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 190/433 (43%), Positives = 282/433 (65%), Gaps = 13/433 (3%)

Query: 3   RRVVITGLGCVTPLGRSLSESWGNLLSSKNGLTPITSLPNYNEDYKLREKSIPSTITVGK 62
           +RVV+TGLG  TPLG ++S+SW  LL++K  L P+ +  N  ED+   +K +P    V +
Sbjct: 4   KRVVVTGLGAYTPLGSTVSKSWAGLLAAKQSLIPLDAFYN-REDFAKVKKLVPLDTAVSR 62

Query: 63  IPENFQNENSAINKLLFTSQDERRTSSFIKLALRTTYEALHNAGLLNPNDITINTSLCNL 122
           +  +  +         F   D+RR +   ++ L  T EAL  A L+   ++   T   + 
Sbjct: 63  LHADPLDT--------FPEYDQRRMTPAHQIVLEKTKEALLQANLIADENLNTLTEDIDK 114

Query: 123 DHFGCLIGSGIGSIQDIYQTSLQFHNDNKRINPYFVPKILTNMAAGNVSIKFNLRGLSHS 182
              GC+IG+G+ S+ D+ ++++       +++P+ +P++L NMA GNV IK+ ++G S  
Sbjct: 115 TKVGCVIGTGMPSMPDL-ESTISTLFTKPKVSPFLIPRVLPNMAMGNVMIKYGIQGPSSC 173

Query: 183 VSTACATGNNSIGDAFNFIRLGMQDICVAGASETSLHPLSLAGFIRAKSITTNGISRPFD 242
            STACATGN+SI + FN I+LG+ D+ + G+ E S+ P+S+AGF R+K+I+    +RPFD
Sbjct: 174 PSTACATGNSSIIEGFNSIQLGLADVMICGSYEFSIDPISIAGFYRSKTISKKHQTRPFD 233

Query: 243 TQRSGFVLGEGCGMIVMESLEHAQKRNANIISELVGYGLSSDACHITSPPADGNGAKRAI 302
            +R GF++GEGCG++ +ESLE A KR + I++E+ G GLS+D  HITSP  DG+G K A+
Sbjct: 234 VERDGFIMGEGCGILTLESLESALKRGSPILAEISGVGLSNDGYHITSPLPDGSGGKLAM 293

Query: 303 EMALKMARLEPTDVDYVNAHATSTLLGDKAECLAVASALLPGRSKSKPLYISSNKGAIGH 362
           + ALK A + P  V Y+NAHATST LGD AE  A+ + L   +S     Y+SSNKG IGH
Sbjct: 294 QNALKRANIAPQQVGYINAHATSTQLGDVAESTAI-TELFGTKSTGTAPYVSSNKGHIGH 352

Query: 363 LLGARGAVESIFTICSLKDDKMPHTLNLDNVLTLENNEADKLHFIRDKPIVGANPKYALC 422
           LLGA G+VESIFT+ SLK  + PHTLNL  V   E +  ++L+ I+++ ++  + +YAL 
Sbjct: 353 LLGASGSVESIFTVLSLKYGRFPHTLNLKTV--DETSIINELNLIKNESMIDNSIEYALT 410

Query: 423 NSFGFGGVNTSLL 435
           NSFGFGGVNTS+L
Sbjct: 411 NSFGFGGVNTSIL 423

>Kwal_23.4862
          Length = 1731

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 93/219 (42%), Gaps = 24/219 (10%)

Query: 94   ALRTTYEALHNAGLLNPNDITINTSLCNLDHFGCLIGSGIGSIQDIYQTSLQFHNDNKRI 153
            AL  T EAL ++G+++P ++       ++   G   GSGIG ++  ++ + Q       +
Sbjct: 1232 ALVATAEALLSSGIVDPYEMY---QYVHVSEVGNCSGSGIGGMKS-HRLTRQARMKEDDV 1287

Query: 154  NPYFVPKILTNMAAGNVSIKFNLRGLSHS--VST---ACATGNNSIGDAFNFIRLGMQDI 208
                + +   N +A  V    N+  LS S  + T   ACAT   S+  A   I  G   I
Sbjct: 1288 QNDILQETFINASAAWV----NMLLLSSSGPIKTPVGACATAVESLDYAVETILSGKAKI 1343

Query: 209  CVAGA-SETSLHPLSLAGFIRAKSITTNGIS---------RPFDTQRSGFVLGEGCGMIV 258
            C+AG   +   H     G + A S     +          RP  T R+GF+  +G G+ V
Sbjct: 1344 CIAGGYDDFEEHVAYEFGNMGATSNHQKEVECGRDPREMCRPATTSRNGFMESQGAGIQV 1403

Query: 259  MESLEHAQKRNANIISELVGYGLSSDACHITSPPADGNG 297
            + S + A +    I   +VG   ++      S PA G G
Sbjct: 1404 LMSAQLAIRMGVPIYG-IVGMTSTASDKIGKSLPAPGKG 1441

>KLLA0C15983g 1389936..1395617 highly similar to sp|P19097
            Saccharomyces cerevisiae YPL231w FAS2 fatty-acyl-CoA
            synthase, alpha chain singleton, start by similarity
          Length = 1893

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 96/250 (38%), Gaps = 19/250 (7%)

Query: 58   ITVGKIPENFQNENSAINKLLFTSQDERRTSSFIKLALRTTYEALHNAGLLNPNDITINT 117
            +  G+IP  +  +   I++   +  D           L +  EA  ++G+ +P ++    
Sbjct: 1184 LVAGQIPTGWDAKTYGISEDTISQVD-----PITLFVLVSVIEAFISSGITDPYEMY--- 1235

Query: 118  SLCNLDHFGCLIGSGIGSIQDIYQTSLQFHNDNKRINPYFVPKILTNMAAGNVSIKFNLR 177
               ++   G   GSG+G +  +       + D    N       +  M+A    +  +  
Sbjct: 1236 KYVHVSEVGNCSGSGMGGVSALRGMFKDRYKDEPVQNDILQESFINTMSAWVNMLLISSS 1295

Query: 178  GLSHSVSTACATGNNSIGDAFNFIRLGMQDICVAGASETSLHPLSLA-GFIRAKSIT--- 233
            G   +   ACAT   S+      I      IC+ G  +      S   G ++A S T   
Sbjct: 1296 GPIKTPVGACATAVESLDIGVETILSNKAKICIVGGYDDFQEEGSYEFGNMKATSNTLEE 1355

Query: 234  -TNG-----ISRPFDTQRSGFVLGEGCGMIVMESLEHAQKRNANIISELVGYGLSSDACH 287
              NG     +SRP  T R+GF+  +G G+ V+ + + A K    I   L     ++D   
Sbjct: 1356 YENGRTPAEMSRPTTTTRNGFMEAQGAGIQVIMTADLALKMGVPIYGILAMTATATDKIG 1415

Query: 288  ITSPPADGNG 297
              S PA G G
Sbjct: 1416 -RSVPAPGKG 1424

>YPL231W (FAS2) [5218] chr16 (108652..114315) Fatty-acyl-CoA synthase,
            alpha chain, contains acyl carrier protein, beta-ketoacyl
            reductase, and beta-ketoacyl synthase in a single
            polypeptide chain [5664 bp, 1887 aa]
          Length = 1887

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 56/255 (21%), Positives = 94/255 (36%), Gaps = 29/255 (11%)

Query: 58   ITVGKIPENFQNENSAINKLLFTSQDERRTSSFIKLALRTTYEALHNAGLLNPNDITINT 117
            +  G+IP  +  +   I+  + +  D           L +  EA   +G+ +P ++    
Sbjct: 1184 LVAGQIPTGWNAKTYGISDDIISQVD-----PITLFVLVSVVEAFIASGITDPYEMY--- 1235

Query: 118  SLCNLDHFGCLIGSGIGSIQDIYQTSLQFHNDNKRINPYFVPKILTNMAAGNVSIKFNLR 177
               ++   G   GSG+G +  +         D    N       +  M+A    +  +  
Sbjct: 1236 KYVHVSEVGNCSGSGMGGVSALRGMFKDRFKDEPVQNDILQESFINTMSAWVNMLLISSS 1295

Query: 178  GLSHSVSTACATGNNSIGDAFNFIRLGMQDICVAGASETSLHPLSLA-GFIRAKSITTNG 236
            G   +   ACAT   S+      I  G   IC+ G  +      S   G ++A S T   
Sbjct: 1296 GPIKTPVGACATSVESVDIGVETILSGKARICIVGGYDDFQEEGSFEFGNMKATSNTLEE 1355

Query: 237  ---------ISRPFDTQRSGFVLGEGCGMIVMESLEHAQKRNANIISELVGYGLSSDACH 287
                     +SRP  T R+GF+  +G G+ ++   + A K    I      YG+ + A  
Sbjct: 1356 FEHGRTPAEMSRPATTTRNGFMEAQGAGIQIIMQADLALKMGVPI------YGIVAMAAT 1409

Query: 288  IT-----SPPADGNG 297
             T     S PA G G
Sbjct: 1410 ATDKIGRSVPAPGKG 1424

>Kwal_56.24248
          Length = 877

 Score = 37.0 bits (84), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 81/217 (37%), Gaps = 18/217 (8%)

Query: 93  LALRTTYEALHNAGLLNPNDITINTSLCNLDHFGCLIGSGIGSIQDIYQTSLQFHNDNKR 152
             L +  EA  ++G+ +P ++       ++   G   GSG+G +  +       + D   
Sbjct: 203 FVLVSVVEAFISSGITDPYEMY---QYVHVSEVGNCSGSGMGGVSALRGMFKDRYKDQPV 259

Query: 153 INPYFVPKILTNMAAGNVSIKFNLRGLSHSVSTACATGNNSIGDAFNFIRLGMQDICVAG 212
            N       +  M+A    +  +  G   +   ACAT   S+      I  G   IC+ G
Sbjct: 260 QNDILQESFINTMSAWVNMLLISSSGPIKTPVGACATAVESLDVGVETILSGKAKICIVG 319

Query: 213 A----SETSLHPL--------SLAGFIRAKSITTNGISRPFDTQRSGFVLGEGCGMIVME 260
                 E   +          SL  F   +  T   +SRP  T R+GF+  +G GM V+ 
Sbjct: 320 GYDDFQEEGSYEFGNMGATSNSLDEFDHGR--TPAEMSRPATTSRNGFMEAQGSGMQVIM 377

Query: 261 SLEHAQKRNANIISELVGYGLSSDACHITSPPADGNG 297
           + + A      I   L     ++D     S PA G G
Sbjct: 378 NADLALNMGVPIYGILAMTATATDKIG-RSVPAPGKG 413

>AFL138W [3057] [Homologous to ScYPL231W (FAS2) - SH]
            complement(171276..176951) [5676 bp, 1891 aa]
          Length = 1891

 Score = 37.0 bits (84), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 54/250 (21%), Positives = 93/250 (37%), Gaps = 19/250 (7%)

Query: 58   ITVGKIPENFQNENSAINKLLFTSQDERRTSSFIKLALRTTYEALHNAGLLNPNDITINT 117
            +  G+IP  +  +   I++   +  D           L +  EA   +G+ +P ++    
Sbjct: 1187 LVAGQIPTGWNAKTYGISEDTISQVD-----PITLFVLVSVVEAFIASGISDPYEMY--- 1238

Query: 118  SLCNLDHFGCLIGSGIGSIQDIYQTSLQFHNDNKRINPYFVPKILTNMAAGNVSIKFNLR 177
               ++   G   GSG+G +  +       + D    N       +  M+A    +  +  
Sbjct: 1239 KYVHVSEVGNCSGSGMGGVSALRGMFKDRYKDKPVQNDILQESFINTMSAWVNMLLISST 1298

Query: 178  GLSHSVSTACATGNNSIGDAFNFIRLGMQDICVAGASETSLHPLSLA-GFIRAKS----- 231
            G   +   ACAT   S+      I  G   IC+ G  +      S   G + A S     
Sbjct: 1299 GPIKTPVGACATAVESMDIGVETILSGKAKICIVGGYDDFQEEGSFEFGSMNATSNSLEE 1358

Query: 232  ----ITTNGISRPFDTQRSGFVLGEGCGMIVMESLEHAQKRNANIISELVGYGLSSDACH 287
                 T   +SRP  T RSGF+  +G G+ ++ + + A K    I   +     ++D   
Sbjct: 1359 FEHGRTPAEMSRPTTTTRSGFMEAQGAGIQIIMNADLALKMGVPIYGIVALTATATDKIG 1418

Query: 288  ITSPPADGNG 297
              S PA G G
Sbjct: 1419 -RSVPAPGQG 1427

 Score = 29.6 bits (65), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 45/117 (38%), Gaps = 7/117 (5%)

Query: 315  DVDYVNAHATSTLLGDKAECLAVASALLP-GRSKSKPLYISSNKGAIGHLLGARGAVESI 373
            D+   + H TST   DK E   +   L   GRS+  P+     K   GH  GA GA    
Sbjct: 1538 DLGVASFHGTSTKANDKNESATINQMLKHLGRSEGNPIIGVFQKYLTGHPKGAAGAWMMN 1597

Query: 374  FTICSLKDDKMPHTLNLDNVLTLENNEADKLHFI--RDKPIVGANPKYALCNSFGFG 428
              I  L    +P   N DN+    +   ++  +I      I     K     SFGFG
Sbjct: 1598 GAIQILNSGIVPGNRNADNI----DEVMEQFEYILYPSHSIKTDGIKAVSVTSFGFG 1650

>CAGL0E06138g complement(611598..617249) highly similar to sp|P19097
            Saccharomyces cerevisiae YPL231w FAS2, start by
            similarity
          Length = 1883

 Score = 35.8 bits (81), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 53/250 (21%), Positives = 94/250 (37%), Gaps = 19/250 (7%)

Query: 58   ITVGKIPENFQNENSAINKLLFTSQDERRTSSFIKLALRTTYEALHNAGLLNPNDITINT 117
            +  G++P  +  +   I+  + +  D           L +  EA   +G+ +P ++    
Sbjct: 1183 LVAGQVPTGWNAKTYGISDDIISQVD-----PITLFVLVSVVEAFITSGISDPYEMY--- 1234

Query: 118  SLCNLDHFGCLIGSGIGSIQDIYQTSLQFHNDNKRINPYFVPKILTNMAAGNVSIKFNLR 177
               ++   G   GSG+G +  +       + D    N       +  M+A    +  +  
Sbjct: 1235 KYVHVSEVGNCSGSGMGGVSALRGMFKDRYKDMPVQNDILQESFINTMSAWVNMLLISSS 1294

Query: 178  GLSHSVSTACATGNNSIGDAFNFIRLGMQDICVAGASETSLHPLSLA-GFIRAKSITTNG 236
            G   +   ACAT   S+      I  G   IC+ G  +      S   G ++A S T   
Sbjct: 1295 GPIKTPVGACATSVESVDIGVETILSGKAKICIVGGYDDFQEEGSYEFGNMKATSNTLEE 1354

Query: 237  ---------ISRPFDTQRSGFVLGEGCGMIVMESLEHAQKRNANIISELVGYGLSSDACH 287
                     +SRP  T R+GF+  +G G+ V+ + + A K    I   +     ++D   
Sbjct: 1355 FEHGRTPAEMSRPATTSRNGFMEAQGAGIQVIMNADLALKMGVPIYGIVALTATATDKIG 1414

Query: 288  ITSPPADGNG 297
              S PA G G
Sbjct: 1415 -RSVPAPGKG 1423

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 46/117 (39%), Gaps = 7/117 (5%)

Query: 315  DVDYVNAHATSTLLGDKAECLAVASALLP-GRSKSKPLYISSNKGAIGHLLGARGAVESI 373
            D+   + H TST   DK E   +   +   GRS+  P+     K   GH  GA GA    
Sbjct: 1534 DLGVASFHGTSTKANDKNESATINEMMKHLGRSEGNPVIGVFQKFLTGHPKGAAGAWMLN 1593

Query: 374  FTICSLKDDKMPHTLNLDNVLTLENNEADKLHFI--RDKPIVGANPKYALCNSFGFG 428
              I  L    +P   N DNV  L     ++  ++    K I     K     SFGFG
Sbjct: 1594 GAIQILNSGIVPGNRNADNVDKL----LEQFDYVLYPSKSIKTDGIKAVSVTSFGFG 1646

>YLR106C (MDN1) [3521] chr12 complement(349007..363739) Nuclear
            protein that may act as a chaperone [14733 bp, 4910 aa]
          Length = 4910

 Score = 33.1 bits (74), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 8/58 (13%)

Query: 115  INTSLCNLDHFGCLIGSGIGSIQDIYQTSLQFHNDNKRINPYFVPKILTNMAAGNVSI 172
            IN  + +L+HF CL G       DI  +SL+ + DN R+   ++P +L + AA  +S+
Sbjct: 3770 INGMMLDLEHFTCLKG-------DIVHSSLKANVDNVRLFEKWLPSLL-DYAAQTLSV 3819

>ADR165C [1907] [Homologous to ScYPL028W (ERG10) - SH]
           (991934..993127) [1194 bp, 397 aa]
          Length = 397

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 51/114 (44%), Gaps = 22/114 (19%)

Query: 179 LSHSVSTACATGNNSIGDAFNFIRLGMQDICVAGASETSLH-----PLSLAG--FIRAK- 230
           ++ +V+  CA+G  ++  A   I+ G  DI VAG +E+  +     P +  G  F  AK 
Sbjct: 82  VATTVNKVCASGMKALILAAQAIKCGTADIVVAGGAESMTNTPYYMPAARGGARFGEAKL 141

Query: 231 --SITTNGISRPFDTQRSGFVLGEGCGM-----------IVMESLEHAQKRNAN 271
              I  +G++  +D Q  G V  E C               +ES + AQK +A 
Sbjct: 142 IDGIQRDGLNDAYDHQAMG-VHAEKCASDHSITREEQDNFAIESYQKAQKAHAE 194

>KLLA0C06336g 561371..562930 highly similar to sp|P32340
           Saccharomyces cerevisiae YML120c NDI1 NADH-ubiquinone-6
           oxidoreductase, start by similarity
          Length = 519

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 79/205 (38%), Gaps = 24/205 (11%)

Query: 202 RLGMQDICVAGASETSLH--------PLSLAGFIRAKSITTNGISRPFDTQRSGFVLGEG 253
           RL    + V  +S +++H        P   A F   K I  N  ++P     +  +LG G
Sbjct: 14  RLSSVSLAVRHSSTSTVHSAKDGSKVPAGSASFTTTKLIENNADNKP-----NVVILGSG 68

Query: 254 CGMIVMESLEHAQKRNANIISELVGYGLSSDACHITSPPADGNGAKRAIEMALKMARLEP 313
            G I       A+K N +I+S    Y L +    + S P      K  IE  +  A  + 
Sbjct: 69  WGAISFLQHIDAKKYNVSIVSPR-NYFLFTPL--LPSTPVGTVDEKSIIEPVVNFALKKK 125

Query: 314 TDVDYVNAHATSTLLGDKAECLAVASALLPGRSKSKPLYISSNKGA---IGHLLGARGAV 370
            +V Y  A ATS         +   S +       K L +S    A     +LL A GA 
Sbjct: 126 GNVSYYEAEATSINPDRNTVTIKSVSTVSQLYQPEKHLGLSQEDTAEIKYDYLLTAVGAE 185

Query: 371 ESIFTICSLKD-----DKMPHTLNL 390
            + F I  ++       ++PH+L +
Sbjct: 186 PNTFGIPGVEQYGNFLKEIPHSLQI 210

>Kwal_27.11303
          Length = 479

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%)

Query: 374 FTICSLKDDKMPHTLNLDNVL 394
           F IC+  DDK+PH +  D+VL
Sbjct: 276 FIICTKGDDKLPHVVKRDDVL 296

>Sklu_1799.2 YDR235W, Contig c1799 1242-2870 reverse complement
          Length = 542

 Score = 29.3 bits (64), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 10 LGCVTPLGRSLSESWGNLLSS--KNGLTPITSLPNYNEDYKLREKSIPSTITVGKI 63
          +G VTPL +++ +   NL+ S  ++ L+    L NY  DY L E  +    ++ KI
Sbjct: 38 IGKVTPLNKAIDKQLANLIRSTYESMLSHFPFLENYYVDYALFEYKLGDIKSMHKI 93

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,209,637
Number of extensions: 615549
Number of successful extensions: 1716
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1724
Number of HSP's successfully gapped: 29
Length of query: 435
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 330
Effective length of database: 12,961,219
Effective search space: 4277202270
Effective search space used: 4277202270
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)