Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER059W (PCL6)42041318600.0
Scas_704.354482476311e-77
CAGL0M12342g4572556251e-76
KLLA0C08305g4092496028e-74
YIL050W (PCL7)2852765596e-69
Scas_715.513411954435e-51
ADL075W2072554185e-49
Kwal_23.58074652744096e-45
Sklu_2373.4307601304e-08
ACR001C346651297e-08
KLLA0D01287g345591271e-07
Kwal_56.22443280601261e-07
Kwal_56.24151480601272e-07
YGL134W (PCL10)433671262e-07
YOL001W (PHO80)293601207e-07
CAGL0E02541g342671181e-06
YPL219W (PCL8)492661145e-06
Scas_392.1303651136e-06
Scas_706.3451801111e-05
Scas_720.47473711111e-05
CAGL0H08998g547481092e-05
AFL115W386541065e-05
CAGL0E05918g481681031e-04
KLLA0B02024g52759994e-04
YNL289W (PCL1)27961830.029
Sklu_2426.923361810.040
Kwal_34.1599623152810.043
YHR071W (PCL5)22975800.051
CAGL0J09328g29768701.1
Sklu_2028.343087663.4
Scas_688.22187651664.1
AEL195W23762644.6
Kwal_23.462892682647.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER059W
         (413 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER059W (PCL6) [1489] chr5 (272622..273884) Cyclin that associat...   721   0.0  
Scas_704.35                                                           247   1e-77
CAGL0M12342g complement(1232642..1234015) weakly similar to sp|P...   245   1e-76
KLLA0C08305g complement(728996..730225) some similarities with s...   236   8e-74
YIL050W (PCL7) [2617] chr9 (258912..259769) Cyclin, associates w...   219   6e-69
Scas_715.51                                                           175   5e-51
ADL075W [1666] [Homologous to ScYIL050W (PCL7) - SH; ScYER059W (...   165   5e-49
Kwal_23.5807                                                          162   6e-45
Sklu_2373.4 YOL001W, Contig c2373 11960-12883                          55   4e-08
ACR001C [1049] [Homologous to ScYOL001W (PHO80) - SH] (357962..3...    54   7e-08
KLLA0D01287g 112866..113903 some similarities with sp|P20052 Sac...    54   1e-07
Kwal_56.22443                                                          53   1e-07
Kwal_56.24151                                                          54   2e-07
YGL134W (PCL10) [1853] chr7 (255666..256967) Cyclin that associa...    53   2e-07
YOL001W (PHO80) [4815] chr15 (325249..326130) Cyclin that intera...    51   7e-07
CAGL0E02541g 244577..245605 similar to sp|P20052 Saccharomyces c...    50   1e-06
YPL219W (PCL8) [5230] chr16 (136749..138227) Cyclin that associa...    49   5e-06
Scas_392.1                                                             48   6e-06
Scas_706.3                                                             47   1e-05
Scas_720.47                                                            47   1e-05
CAGL0H08998g 877952..879595 weakly similar to tr|Q08966 Saccharo...    47   2e-05
AFL115W [3080] [Homologous to ScYPL219W (PCL8) - SH; ScYGL134W (...    45   5e-05
CAGL0E05918g complement(585723..587168) some similarities with t...    44   1e-04
KLLA0B02024g 176585..178168 some similarities with sp|P53124 Sac...    43   4e-04
YNL289W (PCL1) [4322] chr14 (87895..88734) G1/S-specific cyclin ...    37   0.029
Sklu_2426.9 YHR071W, Contig c2426 11461-12162                          36   0.040
Kwal_34.15996                                                          36   0.043
YHR071W (PCL5) [2359] chr8 (237005..237694) Cyclin that associat...    35   0.051
CAGL0J09328g 918579..919472 similar to sp|P25693 Saccharomyces c...    32   1.1  
Sklu_2028.3 YHL014C, Contig c2028 4688-5980 reverse complement         30   3.4  
Scas_688.22                                                            30   4.1  
AEL195W [2311] [Homologous to ScYNL289W (PCL1) - SH] complement(...    29   4.6  
Kwal_23.4628                                                           29   7.0  

>YER059W (PCL6) [1489] chr5 (272622..273884) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           utilization of alternative carbon and nitrogen sources
           [1263 bp, 420 aa]
          Length = 420

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/413 (85%), Positives = 354/413 (85%)

Query: 1   MSIKGDXXXXXXXXXXXXXXXXIQSDDKANLGSGNVDIRTDNSQQDSNNRRDIVVVTRVA 60
           MSIKGD                IQSDDKANLGSGNVDIRTDNSQQDSNNRRDIVVVTRVA
Sbjct: 1   MSIKGDSPSSTNASSSPKSTYSIQSDDKANLGSGNVDIRTDNSQQDSNNRRDIVVVTRVA 60

Query: 61  XXXXXXXXXXXXXMGIRPESSFNYEDASNQARVEMNNRVHGSNMNTINKYYPVRFPKNNE 120
                        MGIRPESSFNYEDASNQARVEMNNRVHGSNMNTINKYYPVRFPKNNE
Sbjct: 61  SEETLESQSSTSSMGIRPESSFNYEDASNQARVEMNNRVHGSNMNTINKYYPVRFPKNNE 120

Query: 121 RQLSDTNNLNEKVQGTHTVQSSTQEDKILDGDTSNSQVTPSLNIAEFPTDXXXXXXXXXX 180
           RQLSDTNNLNEKVQGTHTVQSSTQEDKILDGDTSNSQVTPSLNIAEFPTD          
Sbjct: 121 RQLSDTNNLNEKVQGTHTVQSSTQEDKILDGDTSNSQVTPSLNIAEFPTDKLLKMLTALL 180

Query: 181 XXXXXSNDRTAATNPSLTQEIENGRCLALSDNEKKYLSPVLGFRGKHVPQIGLDQYFQRI 240
                SNDRTAATNPSLTQEIENGRCLALSDNEKKYLSPVLGFRGKHVPQIGLDQYFQRI
Sbjct: 181 TKIIKSNDRTAATNPSLTQEIENGRCLALSDNEKKYLSPVLGFRGKHVPQIGLDQYFQRI 240

Query: 241 QKYCPTTNDVFLSLLVYFDRISKRCNSVTTTPKTNTAKHESPSNESSLDKANRGADKMSA 300
           QKYCPTTNDVFLSLLVYFDRISKRCNSVTTTPKTNTAKHESPSNESSLDKANRGADKMSA
Sbjct: 241 QKYCPTTNDVFLSLLVYFDRISKRCNSVTTTPKTNTAKHESPSNESSLDKANRGADKMSA 300

Query: 301 CXXXXXXXXXXXXXXXTGVQRDSRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNS 360
           C               TGVQRDSRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNS
Sbjct: 301 CNSNENNENDDSDDENTGVQRDSRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNS 360

Query: 361 RYSRVGGISLQELNHLELQFLVLCDFELLISVNELQRYADLLYRFWNNAKAQS 413
           RYSRVGGISLQELNHLELQFLVLCDFELLISVNELQRYADLLYRFWNNAKAQS
Sbjct: 361 RYSRVGGISLQELNHLELQFLVLCDFELLISVNELQRYADLLYRFWNNAKAQS 413

>Scas_704.35
          Length = 448

 Score =  247 bits (631), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 132/247 (53%), Positives = 155/247 (62%), Gaps = 51/247 (20%)

Query: 161 SLNIAEFPTDXXXXXXXXXXXXXXXSNDRTAATNPSLTQEIENGRCLALSDNEK-KYLSP 219
           S+NIAEFPT+               SND+   ++ S ++ I++   L   DN    Y+  
Sbjct: 223 SINIAEFPTNKLLEMLTALLDKIVKSNDKLNVSS-SNSESIDD--ILRSEDNSNNAYVGS 279

Query: 220 VLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSVTTTPKTNTAKH 279
           +L FRGKHVPQI L QYFQRIQKYCPTTNDVFLSLLVYFDRISKRCN+  T      ++ 
Sbjct: 280 ILAFRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVT------SQG 333

Query: 280 ESPSNESSLDKANRGADKMSACXXXXXXXXXXXXXXXTGVQRDSRAHPQMFVMDSHNIHR 339
           +SP+N+S                                         Q+FVMDS+NIHR
Sbjct: 334 DSPTNKS-----------------------------------------QLFVMDSYNIHR 352

Query: 340 LIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELLISVNELQRYA 399
           LIIAG+TV TKF SDFFYSNSRY+RVGG+SLQELNHLELQFLVLCDFEL+I   ELQRYA
Sbjct: 353 LIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELMIPTEELQRYA 412

Query: 400 DLLYRFW 406
           DLL RFW
Sbjct: 413 DLLSRFW 419

>CAGL0M12342g complement(1232642..1234015) weakly similar to
           sp|P40038 Saccharomyces cerevisiae YER059w PCL6 cyclin
           like protein interacting with PHO85P, hypothetical start
          Length = 457

 Score =  245 bits (625), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 131/255 (51%), Positives = 154/255 (60%), Gaps = 56/255 (21%)

Query: 162 LNIAEFPTDXXXXXXXXXXXXXXXSNDR-------TAATNPSLTQEIENGRCLALSDNEK 214
           LNIAEFPTD               SND+           +    + + + + +++   +K
Sbjct: 236 LNIAEFPTDKLLEMLTALLNKIIKSNDQMEPYKDKDKDEDHDDDESLTDSKLMSVKGTDK 295

Query: 215 -KYLSPVLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSVTTTPK 273
            KYL  +L F+GKHVPQI L QYFQRIQKYCPTTNDVFLSLLVYFDRISK+CNS      
Sbjct: 296 EKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNS------ 349

Query: 274 TNTAKHESPSNESSLDKANRGADKMSACXXXXXXXXXXXXXXXTGVQRDSRAHPQMFVMD 333
                                +D  SA                     D+    Q+FVMD
Sbjct: 350 ---------------------SDSESA---------------------DTSPADQLFVMD 367

Query: 334 SHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELLISVN 393
           S+NIHRL+IAG+TV TKF SDFFYSNSRY+RVGGISL ELNHLELQFLVLCDFELLISV+
Sbjct: 368 SYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELLISVD 427

Query: 394 ELQRYADLLYRFWNN 408
           +LQRYA+LL RFWNN
Sbjct: 428 KLQRYANLLLRFWNN 442

>KLLA0C08305g complement(728996..730225) some similarities with
           sp|P40038 Saccharomyces cerevisiae YER059w PCL6 cyclin
           like protein interacting with PHO85P, hypothetical start
          Length = 409

 Score =  236 bits (602), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 151/249 (60%), Gaps = 44/249 (17%)

Query: 162 LNIAEFPTDXXXXXXXXXXXXXXXSNDRTAATNPSLTQEIENGRCLALSDNEKKYLSPVL 221
           ++IA FPT                SND   +T P+   E   G+ + L       +  +L
Sbjct: 189 MDIATFPTYKLLDMLTGLLTKIIKSNDSLGST-PNF--ETSQGKNIPL-------MREIL 238

Query: 222 GFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSVTTTPKTNTAKHES 281
            FRGK VP I L QYFQRIQKYCPTTNDV LSLLV+FDRI+K+CN++        A+   
Sbjct: 239 SFRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAI--------AQEYM 290

Query: 282 PSNESSLDKANRGADKMSACXXXXXXXXXXXXXXXTGVQRDSRAHPQMFVMDSHNIHRLI 341
            S  S+ DK        S+                          PQ+FVMDSHNIHRLI
Sbjct: 291 VSVVSTPDKTTASLAHQSS--------------------------PQLFVMDSHNIHRLI 324

Query: 342 IAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELLISVNELQRYADL 401
           IA ITVSTKF+SDFFYSNSRY+RVGGISLQELNHLELQFL+LCDF L+ISV ELQRYADL
Sbjct: 325 IAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLIISVEELQRYADL 384

Query: 402 LYRFWNNAK 410
           LY+FW+  K
Sbjct: 385 LYKFWDKEK 393

>YIL050W (PCL7) [2617] chr9 (258912..259769) Cyclin, associates with
           the Pho85p cyclin-dependent kinase, involved in
           utilization of alternate carbon sources [858 bp, 285 aa]
          Length = 285

 Score =  219 bits (559), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 122/276 (44%), Positives = 153/276 (55%), Gaps = 62/276 (22%)

Query: 133 VQGTHTVQSSTQEDKILDGDTSNSQVTPSLNIAEFPTDXXXXXXXXXXXXXXXSNDRTAA 192
           VQ       S  +   LD +T+       LNIA+FPTD               +ND T  
Sbjct: 71  VQAVKKSLESEAKTHSLDEETNEQTDVKILNIADFPTDELILMISALLNRIITANDETTD 130

Query: 193 TNPSLTQEIENGRCLALSDNEKKYLSPVLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVFL 252
            +  ++ E E+           + L+P+L F GK+VP+I + QY +RIQKYCPTTND+FL
Sbjct: 131 VSQQVSDETED-----------ELLTPILAFYGKNVPEIAVVQYLERIQKYCPTTNDIFL 179

Query: 253 SLLVYFDRISKRCNSVTTTPKTNTAKHESPSNESSLDKANRGADKMSACXXXXXXXXXXX 312
           SLLVYFDRISK               H S  N         G  K               
Sbjct: 180 SLLVYFDRISKNYG------------HSSERN---------GCAK--------------- 203

Query: 313 XXXXTGVQRDSRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQE 372
                          Q+FVMDS NIHRL+I G+T+ TKFLSDFFYSNSRY++VGGISLQE
Sbjct: 204 ---------------QLFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQE 248

Query: 373 LNHLELQFLVLCDFELLISVNELQRYADLLYRFWNN 408
           LNHLELQFL+LCDF+LL+SV E+Q+YA+LLY+FWN+
Sbjct: 249 LNHLELQFLILCDFKLLVSVEEMQKYANLLYKFWND 284

>Scas_715.51
          Length = 341

 Score =  175 bits (443), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 121/195 (62%), Gaps = 35/195 (17%)

Query: 212 NEKKYLSPVLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSVTTT 271
           +E K +  +  FRGKH+P I L+QYF RIQKYCPT N V L++L+YFDRISK  N     
Sbjct: 173 DESKLVRSIKSFRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNG---- 228

Query: 272 PKTNTAKHESPSNESSLDKANRGADKMSACXXXXXXXXXXXXXXXTGVQRDSRAHPQMFV 331
               + ++ES  N S+     R  D    C                            F+
Sbjct: 229 ----SKENESDPNISTHHHLLRNYD----CKIEDK-----------------------FL 257

Query: 332 MDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELLIS 391
           +DS+NIHRLII+ ITVSTKF SDFFYSNSRY++VGGISL E+N+LELQFL++ +F+L+IS
Sbjct: 258 LDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFLLISNFDLIIS 317

Query: 392 VNELQRYADLLYRFW 406
             E+QRY+ LL +F+
Sbjct: 318 SEEIQRYSGLLSKFY 332

>ADL075W [1666] [Homologous to ScYIL050W (PCL7) - SH; ScYER059W
           (PCL6) - SH] complement(550944..551567) [624 bp, 207 aa]
          Length = 207

 Score =  165 bits (418), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 107/255 (41%), Positives = 129/255 (50%), Gaps = 72/255 (28%)

Query: 162 LNIAEFPTDXXXXXXXXXXXXXXXSNDRTAATNPSLTQEIENGRCLALSDNEKKYLSPVL 221
           ++IA+FPTD               SNDR    +    QE          D   KY++ VL
Sbjct: 16  MDIAQFPTDKLLEMLTGLLYKIIKSNDRLKPFD----QEKH--------DINNKYVAHVL 63

Query: 222 GFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSVTTTPKTNTAKHES 281
            FRGKH+P I L  YF R                     I K C      P TN      
Sbjct: 64  SFRGKHIPTITLGDYFAR---------------------IQKYC------PITNDV---- 92

Query: 282 PSNESSLDKANRGADKMSACXXXXXXXXXXXXXXXTGVQRDSRAHPQMFVMDSHNIHRLI 341
               S L   +R A + +A                          PQ+FVMDS+NIHRLI
Sbjct: 93  --FLSLLVYFDRIAKRCNALD------------------------PQLFVMDSYNIHRLI 126

Query: 342 IAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELLISVNELQRYADL 401
           IA +TVSTKF SDFFYSNSRY+RVGGISL+ELN LELQF +LCDFEL++S+ ELQRYADL
Sbjct: 127 IAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELIVSIQELQRYADL 186

Query: 402 LYRFWNN---AKAQS 413
           LY+FW+    AKA +
Sbjct: 187 LYKFWHREHLAKAST 201

>Kwal_23.5807
          Length = 465

 Score =  162 bits (409), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 111/274 (40%), Positives = 133/274 (48%), Gaps = 59/274 (21%)

Query: 136 THTVQSSTQEDKILDGDTSNSQVTPSLNIAEFPTDXXXXXXXXXXXXXXXSNDRTAATNP 195
           TH  +   Q   + + +   S+V   + IA FPTD               SND+     P
Sbjct: 235 THNDRPLKQRAPVPNSEPKLSEVPELIQIATFPTDRLLSMLTALLDKIVKSNDQLNRDRP 294

Query: 196 -SLTQEIENGRCL-ALSDNEKKYLSPVLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLS 253
               Q + + R   A +D      S +L FRGKHVP I L QY                 
Sbjct: 295 FDEDQFLASARTEDADNDTRPNIASEILSFRGKHVPAITLQQY----------------- 337

Query: 254 LLVYFDRISKRCNSVTTTPKTNTAKHESPSNESSLDKANRGADKMSACXXXXXXXXXXXX 313
               F RI K C      P TN          S L   +R A     C            
Sbjct: 338 ----FQRIQKYC------PTTNDVFL------SLLVYFDRIA---KTC------------ 366

Query: 314 XXXTGVQRDSRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQEL 373
                    +    Q+FVMDS+NIHRLII+ +TVSTKF SDFFYSNSRY+RVGGISL+EL
Sbjct: 367 ---------NHGKEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKEL 417

Query: 374 NHLELQFLVLCDFELLISVNELQRYADLLYRFWN 407
           NHLELQFLVLCDFEL+ISV ELQ+Y+DLL  FWN
Sbjct: 418 NHLELQFLVLCDFELIISVEELQKYSDLLRDFWN 451

>Sklu_2373.4 YOL001W, Contig c2373 11960-12883
          Length = 307

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%)

Query: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389
           F ++S  +HR ++   TV++K LSD F +N  Y++VGG+   ELN LE +FL   ++ ++
Sbjct: 135 FTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194

>ACR001C [1049] [Homologous to ScYOL001W (PHO80) - SH]
           (357962..359002) [1041 bp, 346 aa]
          Length = 346

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 42/65 (64%), Gaps = 1/65 (1%)

Query: 325 AHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLC 384
            +P+ F +DS  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE +FL   
Sbjct: 101 VYPE-FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERV 159

Query: 385 DFELL 389
           ++ +L
Sbjct: 160 NYRIL 164

>KLLA0D01287g 112866..113903 some similarities with sp|P20052
           Saccharomyces cerevisiae YOL001w PHO80 cyclin,
           hypothetical start
          Length = 345

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 39/59 (66%), Gaps = 1/59 (1%)

Query: 323 SRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFL 381
           S  +P+ F ++S  +HR ++   T+++K L D F +N+ YS+VGG+   ELN LE +FL
Sbjct: 102 SAVYPE-FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFL 159

 Score = 32.3 bits (72), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 20/40 (50%)

Query: 223 FRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRIS 262
           F  K  P I + QY  R+ KY    + V LS + Y D +S
Sbjct: 63  FHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLS 102

>Kwal_56.22443
          Length = 280

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%)

Query: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389
           F ++S  +HR ++   TV++K L D F +NS Y++VGG+   EL+ LE +FL   ++ +L
Sbjct: 120 FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRIL 179

>Kwal_56.24151
          Length = 480

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 40/60 (66%)

Query: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389
           + +D+  +HRLIIA I ++TK L D  +S++ +SR+ GIS + L  LE+ FL   +FE L
Sbjct: 399 YHLDNCQVHRLIIASIRLATKLLEDCVHSHTCFSRICGISKKLLTKLEIAFLNCINFEGL 458

>YGL134W (PCL10) [1853] chr7 (255666..256967) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           glycogen accumulation [1302 bp, 433 aa]
          Length = 433

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 44/67 (65%), Gaps = 1/67 (1%)

Query: 337 IHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLV-LCDFELLISVNEL 395
           +HR+IIA + +STK L DF +S+  +S+V GIS + L  LE+  L+ +C+ +L++S  +L
Sbjct: 359 VHRMIIAAVRLSTKLLEDFVHSHEYFSKVCGISKRLLTKLEVSLLICVCNTKLMVSNRKL 418

Query: 396 QRYADLL 402
                LL
Sbjct: 419 AASKLLL 425

>YOL001W (PHO80) [4815] chr15 (325249..326130) Cyclin that interacts
           with Pho85p cyclin-dependent kinase, regulates the
           phosphate pathway through phosphorylation of Pho4p [882
           bp, 293 aa]
          Length = 293

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (61%)

Query: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389
           F ++S   HR ++   TV+TK L D F +N+ Y++VGG+   ELN LE  FL   ++ ++
Sbjct: 112 FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171

>CAGL0E02541g 244577..245605 similar to sp|P20052 Saccharomyces
           cerevisiae YOL001w PHO80 cyclin, start by similarity
          Length = 342

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 323 SRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLV 382
           S  +P  F ++S   HR ++   T+++K L D F +N+ YS+VGG+   ELN LE +FL 
Sbjct: 101 SNVYPA-FNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLR 159

Query: 383 LCDFELL 389
             ++ ++
Sbjct: 160 KVNYRII 166

 Score = 35.0 bits (79), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 209 LSDNEKKYLSPVLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRIS 262
           + +NE+KY   +  F  K  P I +  YF R+ KY    + V LS + Y D +S
Sbjct: 50  IKENERKY--GLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLS 101

>YPL219W (PCL8) [5230] chr16 (136749..138227) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           control of glycogen accumulation [1479 bp, 492 aa]
          Length = 492

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 42/66 (63%), Gaps = 1/66 (1%)

Query: 338 HRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFE-LLISVNELQ 396
           HR+II+ I ++TK L DF +S +   +V GIS + L  LE+ F+   +F+ L+I+  +L+
Sbjct: 417 HRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFMASVNFDGLMITCEKLE 476

Query: 397 RYADLL 402
           +   +L
Sbjct: 477 KTLHIL 482

>Scas_392.1
          Length = 303

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 41/65 (63%), Gaps = 1/65 (1%)

Query: 325 AHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLC 384
           A+P  F  +S   HR ++  ITV+ K L D F + ++Y+++GG+  +ELN LE  FL + 
Sbjct: 141 AYPT-FTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIV 199

Query: 385 DFELL 389
           ++ ++
Sbjct: 200 NYRII 204

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 223 FRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFD 259
           F  +  P I +  Y  R+ KYC   + V LS++ Y D
Sbjct: 100 FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYID 136

>Scas_706.3
          Length = 451

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 45/80 (56%), Gaps = 3/80 (3%)

Query: 319 VQRDSRAHPQMFV--MDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHL 376
           + RD R  P      +  + +HR+IIA I V TK + DF +S+  + +V G+S + L+ L
Sbjct: 358 LDRDERDGPIKLKHKLQENEVHRMIIATIRVGTKLVEDFVHSHQYFCKVCGVSRKLLSKL 417

Query: 377 ELQFLVLCDFE-LLISVNEL 395
           E+  L+    + ++I+  EL
Sbjct: 418 EVTLLLCLKHDKIIITTEEL 437

>Scas_720.47
          Length = 473

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 40/71 (56%)

Query: 320 QRDSRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQ 379
           +  SR     F  +  ++HRLIIA + ++TK L D  +S+  + +V GIS + L+ LE+ 
Sbjct: 383 EEHSRKLKLRFKFEKSDVHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLEVS 442

Query: 380 FLVLCDFELLI 390
            L+    E L+
Sbjct: 443 LLLCLKNECLL 453

>CAGL0H08998g 877952..879595 weakly similar to tr|Q08966
           Saccharomyces cerevisiae YPL219w PCL8, hypothetical
           start
          Length = 547

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 34/48 (70%), Gaps = 1/48 (2%)

Query: 337 IHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLC 384
           IHRLII+ + VS K + DF +S+  +S+V G+S + L+ LE+  L++C
Sbjct: 474 IHRLIISTVRVSAKLVEDFVHSHEYFSKVCGVSKKLLSKLEVS-LIMC 520

>AFL115W [3080] [Homologous to ScYPL219W (PCL8) - SH; ScYGL134W
           (PCL10) - SH] complement(221235..222395) [1161 bp, 386
           aa]
          Length = 386

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 337 IHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELLI 390
           +HRLI+A I VSTK + D  +S+  +S+V GIS + L  LEL  +++   E L+
Sbjct: 305 VHRLIVALIRVSTKIVEDTVHSHEYFSKVCGISKKLLMRLELALILVLRGEGLM 358

>CAGL0E05918g complement(585723..587168) some similarities with
           tr|Q08966 Saccharomyces cerevisiae YPL219w PCL8,
           hypothetical start
          Length = 481

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 40/68 (58%), Gaps = 3/68 (4%)

Query: 337 IHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLC--DFELLISVNE 394
           +HR+I+  I ++TK L DF +S+    +V GIS + +  LEL  L+ C  D  LLI+  +
Sbjct: 406 VHRVIVGTIRIATKLLEDFVHSHQYICKVCGISKKLMTKLELA-LIFCLKDNNLLINSEK 464

Query: 395 LQRYADLL 402
           L   A +L
Sbjct: 465 LSATACIL 472

>KLLA0B02024g 176585..178168 some similarities with sp|P53124
           Saccharomyces cerevisiae YGL134w PCL10 cyclin like
           protein interacting with PHO85P, hypothetical start
          Length = 527

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 38/59 (64%), Gaps = 1/59 (1%)

Query: 338 HRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQF-LVLCDFELLISVNEL 395
           HRL+IA I ++ K L D  +S+S +S+V GIS + L+ LEL   L+L D +  + + EL
Sbjct: 454 HRLLIAFIRLAAKLLEDHVHSHSYFSKVCGISKKLLSKLELNLVLILQDTQDGLLITEL 512

>YNL289W (PCL1) [4322] chr14 (87895..88734) G1/S-specific cyclin
           that interacts with the Cdc28p-like kinase Pho85p [840
           bp, 279 aa]
          Length = 279

 Score = 36.6 bits (83), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 37/61 (60%), Gaps = 2/61 (3%)

Query: 337 IHRLIIAGITVSTKFLSDFFYSNSRYSRV--GGISLQELNHLELQFLVLCDFELLISVNE 394
           IHR+ +A + +S KF +D    N  ++R   G  +L+++N +E Q L L +++L ++  +
Sbjct: 98  IHRIFLACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNWDLRVNTED 157

Query: 395 L 395
           L
Sbjct: 158 L 158

>Sklu_2426.9 YHR071W, Contig c2426 11461-12162
          Length = 233

 Score = 35.8 bits (81), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 33/61 (54%)

Query: 339 RLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELLISVNELQRY 398
           R+ +  + +S KFL D  +S   + R+ G+  +++  +E   L   D+EL +  + LQ +
Sbjct: 125 RIYLVCLILSHKFLKDQTFSMKSWQRISGLPTKDIATMERWCLGKLDYELFLEESALQEW 184

Query: 399 A 399
           A
Sbjct: 185 A 185

>Kwal_34.15996
          Length = 231

 Score = 35.8 bits (81), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 33/52 (63%)

Query: 339 RLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELLI 390
           R+ +  + ++ KFL+D  +S + + R+ G+S ++L+ +E   L   D+ELLI
Sbjct: 127 RVYLCCLILAHKFLNDQTFSMNSWQRISGLSSKDLSTMERWCLSKLDYELLI 178

>YHR071W (PCL5) [2359] chr8 (237005..237694) Cyclin that associates
           with the Pho85p cyclin-dependent kinase and regulates
           Gcn4p stability [690 bp, 229 aa]
          Length = 229

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 4/75 (5%)

Query: 321 RDSRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQF 380
           RD  + P+     SH   R+ +  + +S KFL+D  YS   +  + G+  ++L+ +E   
Sbjct: 115 RDESSLPEF----SHCSRRIFLCCLILSHKFLNDNTYSMKNWQIISGLHAKDLSLMERWC 170

Query: 381 LVLCDFELLISVNEL 395
           L   ++EL I  +E 
Sbjct: 171 LGKLNYELAIPYDEF 185

>CAGL0J09328g 918579..919472 similar to sp|P25693 Saccharomyces
           cerevisiae YDL127w PCL2 or tr|Q12477 Saccharomyces
           cerevisiae YDL179w PCL9, start by similarity
          Length = 297

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 338 HRLIIAGITVSTKFLSDFFYSNSRYSRV--GGISLQELNHLELQFLVLCDFELLISVNEL 395
           HR+ +  + +S K L+D    N  +++   G + L+E+N +E + L   D+ L +S N+L
Sbjct: 93  HRIFLGCLILSAKTLNDSSPLNKHWAQYTDGLLHLKEVNTIERELLEYFDWNLTLSTNDL 152

Query: 396 -QRYADLL 402
            Q  A  L
Sbjct: 153 IQSLAPFL 160

>Sklu_2028.3 YHL014C, Contig c2028 4688-5980 reverse complement
          Length = 430

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 36/87 (41%), Gaps = 12/87 (13%)

Query: 320 QRDSRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQ 379
           Q + +    + + D   + R    G  +  KFL+D  +++  Y  V G + QE+ H+E  
Sbjct: 96  QSEKKIPATLTIYDIAGLTRGASQGEGLGNKFLNDIRHTDGIYQVVRGFTKQEITHIEGS 155

Query: 380 F------------LVLCDFELLISVNE 394
                        LVL D E L  + E
Sbjct: 156 VDPVRDLSVVQDELVLKDLEFLEGIRE 182

>Scas_688.22
          Length = 1876

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 7/51 (13%)

Query: 362 YSRVGGISLQELNHLELQFLVLCDFELLIS-------VNELQRYADLLYRF 405
           Y  + G+SLQEL  LEL    + D++ L         VN+ Q + DLL  F
Sbjct: 278 YQLLAGLSLQELRKLELTSKSVSDYKYLSKSNPSIPGVNDAQDFQDLLKAF 328

>AEL195W [2311] [Homologous to ScYNL289W (PCL1) - SH]
           complement(266347..267060) [714 bp, 237 aa]
          Length = 237

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 338 HRLIIAGITVSTKFLSDFFYSNSRYSRV--GGISLQELNHLELQFLVLCDFELLISVNEL 395
           HR+ +A + +S KF +D    N  +++   G  + Q++N +E Q L L D+ + +   +L
Sbjct: 98  HRIFLACLILSAKFHNDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDL 157

Query: 396 QR 397
            R
Sbjct: 158 CR 159

>Kwal_23.4628
          Length = 926

 Score = 29.3 bits (64), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 3/82 (3%)

Query: 209 LSDNEKKYLSPVLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYF-DRISKRCNS 267
           LS  EK+++          +PQI L   F   +K+ P T  VF  L+V   D  S   ++
Sbjct: 691 LSSEEKEFVQKFYQRAISEIPQILLSNCFPSFKKFFPIT--VFRDLVVLTSDEASSHNST 748

Query: 268 VTTTPKTNTAKHESPSNESSLD 289
           ++T P   + +   P     LD
Sbjct: 749 LSTPPFVGSLQKIPPRAPPKLD 770

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.129    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,964,646
Number of extensions: 484898
Number of successful extensions: 1726
Number of sequences better than 10.0: 45
Number of HSP's gapped: 1760
Number of HSP's successfully gapped: 53
Length of query: 413
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 309
Effective length of database: 12,995,837
Effective search space: 4015713633
Effective search space used: 4015713633
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 63 (28.9 bits)