Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER058W (PET117)1071065533e-75
Scas_715.521071053903e-50
Sklu_2193.41021033702e-47
KLLA0C08327g1031063546e-45
CAGL0J02926g1271033472e-43
Kwal_23.58051021003348e-42
ADL076W1131023028e-37
AFR566C171619630.84
KLLA0C10571g117765621.2
CAGL0C05423g33754592.6
Kwal_56.2260586551583.1
YOR048C (RAT1)100645574.5
Scas_624.1592754575.3
KLLA0C13607g53780565.7
CAGL0I10670g55548566.9
CAGL0M01694g94438567.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER058W
         (106 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER058W (PET117) [1488] chr5 (271766..272089) Protein involved i...   217   3e-75
Scas_715.52                                                           154   3e-50
Sklu_2193.4 YER058W, Contig c2193 6568-6876                           147   2e-47
KLLA0C08327g complement(730884..731195) similar to sp|Q02771 Sac...   140   6e-45
CAGL0J02926g 281301..281684 similar to sp|Q02771 Saccharomyces c...   138   2e-43
Kwal_23.5805                                                          133   8e-42
ADL076W [1665] [Homologous to ScYER058W (PET117) - SH] complemen...   120   8e-37
AFR566C [3758] [Homologous to ScYMR229C (RRP5) - SH] (1449324..1...    29   0.84 
KLLA0C10571g 906848..910381 similar to sp|P24276 Saccharomyces c...    28   1.2  
CAGL0C05423g complement(516403..517416) similar to sp|P25044 Sac...    27   2.6  
Kwal_56.22605                                                          27   3.1  
YOR048C (RAT1) [4859] chr15 complement(418630..421650) 5'-3' exo...    27   4.5  
Scas_624.15                                                            27   5.3  
KLLA0C13607g complement(1164479..1166092) similar to sgd|S000561...    26   5.7  
CAGL0I10670g 1045681..1047348 similar to tr|Q06512 Saccharomyces...    26   6.9  
CAGL0M01694g complement(187841..190675) highly similar to sp|P09...    26   7.5  

>YER058W (PET117) [1488] chr5 (271766..272089) Protein involved in
           assembly of cytochrome oxidase [324 bp, 107 aa]
          Length = 107

 Score =  217 bits (553), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 106/106 (100%), Positives = 106/106 (100%)

Query: 1   MSRASKITFAASCLITAATVVGVHYVQEMERETLHQGPIKDAKRVEEKRLRKTNGVASLD 60
           MSRASKITFAASCLITAATVVGVHYVQEMERETLHQGPIKDAKRVEEKRLRKTNGVASLD
Sbjct: 1   MSRASKITFAASCLITAATVVGVHYVQEMERETLHQGPIKDAKRVEEKRLRKTNGVASLD 60

Query: 61  PTKERKRYFNMSEHEEQKELRKKYETMQPLSGEVVTKDGEVVKESK 106
           PTKERKRYFNMSEHEEQKELRKKYETMQPLSGEVVTKDGEVVKESK
Sbjct: 61  PTKERKRYFNMSEHEEQKELRKKYETMQPLSGEVVTKDGEVVKESK 106

>Scas_715.52
          Length = 107

 Score =  154 bits (390), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 86/105 (81%), Gaps = 3/105 (2%)

Query: 1   MSRASKITFAASCLITAATVVGVHYVQEMERETLHQGPIKDAKRVEEKRLRKTNGVASLD 60
           MSRASKITFA +C+ T  T VGVHYVQ MER+TLHQGPIKDAKRV EK+  K +G   LD
Sbjct: 1   MSRASKITFALTCVFTITTTVGVHYVQGMERDTLHQGPIKDAKRVAEKKRLKESG---LD 57

Query: 61  PTKERKRYFNMSEHEEQKELRKKYETMQPLSGEVVTKDGEVVKES 105
           P KE+KR FN SEHE QKEL+K+YE  QPLSGEVVTKDGEVVKE+
Sbjct: 58  PAKEKKRMFNQSEHELQKELKKQYEQQQPLSGEVVTKDGEVVKEA 102

>Sklu_2193.4 YER058W, Contig c2193 6568-6876
          Length = 102

 Score =  147 bits (370), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 72/103 (69%), Positives = 83/103 (80%), Gaps = 2/103 (1%)

Query: 1   MSRASKITFAASCLITAATVVGVHYVQEMERETLHQGPIKDAKRVEEKRLRKTNGVASLD 60
           MSRASKIT A SCL+T  TV+GVH VQ+MER+TLHQGPIKDAKRV EK+L K     + D
Sbjct: 1   MSRASKITLALSCLLTTTTVIGVHIVQDMERQTLHQGPIKDAKRVAEKKLAKEE--QNQD 58

Query: 61  PTKERKRYFNMSEHEEQKELRKKYETMQPLSGEVVTKDGEVVK 103
           P+K+R +  N  EHE Q+ELRKKYE MQPLSGEV+TKDGEVVK
Sbjct: 59  PSKQRMKLVNKGEHELQQELRKKYEAMQPLSGEVLTKDGEVVK 101

>KLLA0C08327g complement(730884..731195) similar to sp|Q02771
           Saccharomyces cerevisiae YER058w PET117 cytochrome c
           oxidase assembly factor singleton, start by similarity
          Length = 103

 Score =  140 bits (354), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 83/106 (78%), Gaps = 3/106 (2%)

Query: 1   MSRASKITFAASCLITAATVVGVHYVQEMERETLHQGPIKDAKRVEEKRLRKTNGVASLD 60
           MSRASKIT   + L TA  VVGVH+VQE+ER+TLHQGPIKDA+RV EK+L + NGV   D
Sbjct: 1   MSRASKITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEKKLARQNGV---D 57

Query: 61  PTKERKRYFNMSEHEEQKELRKKYETMQPLSGEVVTKDGEVVKESK 106
           P KER+R  N +EHE Q ELRKKYE MQPLSGEV TKD E++++ K
Sbjct: 58  PEKERQRMVNKNEHEYQLELRKKYEQMQPLSGEVRTKDNELIEQKK 103

>CAGL0J02926g 281301..281684 similar to sp|Q02771 Saccharomyces
           cerevisiae YER058w PET117, start by similarity
          Length = 127

 Score =  138 bits (347), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 69/103 (66%), Positives = 79/103 (76%), Gaps = 7/103 (6%)

Query: 1   MSRASKITFAASCLITAATVVGVHYVQEMERETLHQGPIKDAKRVEEKRLRKTNGVASLD 60
           MSRASKITF  SC +T AT++GVHYVQE+ERETLHQGPIKDAKRV EK+     G     
Sbjct: 32  MSRASKITFGVSCAVTLATIIGVHYVQELERETLHQGPIKDAKRVAEKKKLMPAGT---- 87

Query: 61  PTKERKRYFNMSEHEEQKELRKKYETMQPLSGEVVTKDGEVVK 103
              + K+  N SEHE Q+ELRKKYE+MQPLSGEVVT+DGE VK
Sbjct: 88  ---DEKKLLNRSEHELQQELRKKYESMQPLSGEVVTQDGERVK 127

>Kwal_23.5805
          Length = 102

 Score =  133 bits (334), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 78/100 (78%), Gaps = 9/100 (9%)

Query: 1   MSRASKITFAASCLITAATVVGVHYVQEMERETLHQGPIKDAKRVEEKRLRKTNGVASLD 60
           MS ASKIT A SC++T ATV+GVHYVQE+ER+TLHQGPIKDAKR+ +++    N      
Sbjct: 1   MSTASKITLALSCVLTTATVIGVHYVQELERDTLHQGPIKDAKRIADRKAEMEN------ 54

Query: 61  PTKERKRYFNMSEHEEQKELRKKYETMQPLSGEVVTKDGE 100
              ERK+ FN SEHE Q+ELR+KYE +QPLSGEV+TKDGE
Sbjct: 55  ---ERKKRFNESEHELQQELRRKYEALQPLSGEVLTKDGE 91

>ADL076W [1665] [Homologous to ScYER058W (PET117) - SH]
           complement(550058..550399) [342 bp, 113 aa]
          Length = 113

 Score =  120 bits (302), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 63/102 (61%), Positives = 70/102 (68%), Gaps = 5/102 (4%)

Query: 1   MSRASKITFAASCLITAATVVGVHYVQEMERETLHQGPIKDAKRVEEKRLRKTNGVASLD 60
           MSRASKIT A     +AATVV VH VQEMER+ L QGPIKDA R  EKR  +       D
Sbjct: 14  MSRASKITLALCTAASAATVVTVHLVQEMERDALKQGPIKDALRTAEKRAER-----DAD 68

Query: 61  PTKERKRYFNMSEHEEQKELRKKYETMQPLSGEVVTKDGEVV 102
           P   RK+  N SEHE Q ELR+KY  MQPLSGEVVT+DG+VV
Sbjct: 69  PEAARKKMLNASEHELQLELRRKYAAMQPLSGEVVTQDGDVV 110

>AFR566C [3758] [Homologous to ScYMR229C (RRP5) - SH]
            (1449324..1454474) [5151 bp, 1716 aa]
          Length = 1716

 Score = 28.9 bits (63), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 16/19 (84%)

Query: 78   KELRKKYETMQPLSGEVVT 96
            KE +K Y+TMQP++G+VV 
Sbjct: 1198 KEWKKFYKTMQPITGKVVN 1216

>KLLA0C10571g 906848..910381 similar to sp|P24276 Saccharomyces
           cerevisiae YDR293c SSD1 involved in the tolerance to
           high concentration of Ca2+, start by similarity
          Length = 1177

 Score = 28.5 bits (62), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 7/65 (10%)

Query: 37  GPIKDAKRVEEKRLRKTNGVAS--LDP---TKERKRYFNMSEHEEQKELRKKYETMQPLS 91
           G + D K   +  LR  N ++   LDP   TKER  +  +   EEQ + R+ YE +  +S
Sbjct: 576 GDVNDPKTEIDSILRDNNFLSDEYLDPQDRTKERDSFAPVLLSEEQSKTRRTYENVIAIS 635

Query: 92  --GEV 94
             GEV
Sbjct: 636 ETGEV 640

>CAGL0C05423g complement(516403..517416) similar to sp|P25044
          Saccharomyces cerevisiae YDL230w PTP1 protein tyrosine
          phosphatase, hypothetical start
          Length = 337

 Score = 27.3 bits (59), Expect = 2.6,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 25 YVQEMERETLHQGPIKDAKRVEEKRLRKTNGVASLDPTKERKRYFNMSEHEEQK 78
          ++Q  E E L +  I  A    EKR   + GV+ L+    R RY N+  +E  +
Sbjct: 19 FIQNQEDERLREATIVTADVEVEKRW--SLGVSILEKNDARNRYVNIMPYERNR 70

>Kwal_56.22605
          Length = 865

 Score = 26.9 bits (58), Expect = 3.1,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 49  RLRKTNGVASLDPTKERKRYF-NMSEHEEQKELRKKYETMQPLSGEVVTKD 98
           R ++T+G   + P  ++KRYF ++        LRK+ ET + +SG V   D
Sbjct: 133 RSQRTSGTPDMSPAPKQKRYFTSLLTKRRVAWLRKQAETFR-ISGGVELGD 182

>YOR048C (RAT1) [4859] chr15 complement(418630..421650) 5'-3'
           exoribonuclease (exonuclease II), required for efficient
           nucleocytoplasmic RNA trafficking and for ribosomal RNA
           processing [3021 bp, 1006 aa]
          Length = 1006

 Score = 26.6 bits (57), Expect = 4.5,   Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 24/45 (53%)

Query: 62  TKERKRYFNMSEHEEQKELRKKYETMQPLSGEVVTKDGEVVKESK 106
           +K  K  FN++E  +QK + KK+   +    E + KD + VK  K
Sbjct: 496 SKANKTNFNLAEVMKQKIINKKHRLEKDNEEEEIAKDSKKVKTEK 540

>Scas_624.15
          Length = 927

 Score = 26.6 bits (57), Expect = 5.3,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 48  KRLRKTNGVASLDPTKERKRYFNMSEHEEQKELRKK----YETMQPLSGEVVTK 97
           +R+ + NG    +  +E+  + + +EH+ +K+LR      +E  +P+ G   ++
Sbjct: 170 QRVTQNNGNTKQNKKREQSLFTSPAEHQSRKQLRNGMRSFFEDGEPIHGNTGSR 223

>KLLA0C13607g complement(1164479..1166092) similar to sgd|S0005618
           Saccharomyces cerevisiae YOR092w ECM3 involved in cell
           wall biogenesis and architecture, start by similarity
          Length = 537

 Score = 26.2 bits (56), Expect = 5.7,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 38/80 (47%), Gaps = 10/80 (12%)

Query: 26  VQEMERETLHQGPIKDAKRVEEKRLRKTNGVASLDPTKERKRYFNMSEHEEQKELRKKYE 85
           ++ M  E +H   IK+   V++   R+ +  +++ P          +E   Q  LRK++ 
Sbjct: 257 LRSMPPENVHD-LIKEYSNVDQYGARRNSVTSTIKPE---------TEDSGQVPLRKEFT 306

Query: 86  TMQPLSGEVVTKDGEVVKES 105
           T++ +     T  G+ +KES
Sbjct: 307 TLKRIVTSDATVTGQDIKES 326

>CAGL0I10670g 1045681..1047348 similar to tr|Q06512 Saccharomyces
           cerevisiae YPR144c, start by similarity
          Length = 555

 Score = 26.2 bits (56), Expect = 6.9,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 4/48 (8%)

Query: 5   SKITFAASCLITAATVVGVHYVQEMERETLHQGPIKDAKRVEEKRLRK 52
           SK+ F  S  +    V    Y+Q +E+E++H    KDA     K  RK
Sbjct: 102 SKVEFECSLTLDCLDV----YMQLLEQESIHFASSKDATYFPNKSFRK 145

>CAGL0M01694g complement(187841..190675) highly similar to sp|P09440
           Saccharomyces cerevisiae YBR084w MIS1
           C1-tetrahydrofolate synthase precursor or sp|P07245
           Saccharomyces cerevisiae YGR204w ADE3, hypothetical
           start
          Length = 944

 Score = 26.2 bits (56), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 20/38 (52%)

Query: 29  MERETLHQGPIKDAKRVEEKRLRKTNGVASLDPTKERK 66
           ++   LH+  IK+  +  +K + K NG+ S  P   R+
Sbjct: 463 IDTRMLHESTIKNDAKFYDKLVPKKNGIRSFSPAMTRR 500

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.125    0.333 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,262,575
Number of extensions: 127630
Number of successful extensions: 682
Number of sequences better than 10.0: 75
Number of HSP's gapped: 664
Number of HSP's successfully gapped: 78
Length of query: 106
Length of database: 16,596,109
Length adjustment: 76
Effective length of query: 30
Effective length of database: 13,965,141
Effective search space: 418954230
Effective search space used: 418954230
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 54 (25.4 bits)