Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER057C (HMF1)1291285913e-80
Scas_715.531281264906e-65
CAGL0M12386g1421264604e-60
KLLA0C08349g1401254482e-58
ADL077C1421274474e-58
Sklu_2193.31281274455e-58
YIL051C (MMF1)1451274413e-57
Kwal_23.58041411274352e-56
Scas_704.341481274344e-56
Kwal_23.28071291051842e-18
Kwal_47.16590126991702e-16
Kwal_55.21247134991615e-15
KLLA0B14817g1311061521e-13
KLLA0E03894g137991416e-12
CAGL0M04521g6881051124e-07
Scas_506.3689901027e-06
AGL164W68676931e-04
KLLA0D16984g696102840.002
CAGL0K06303g324786602.9
AGR390C37837594.3
CAGL0L04862g60355585.0
YMR110C53280578.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER057C
         (128 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein th...   232   3e-80
Scas_715.53                                                           193   6e-65
CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces...   181   4e-60
KLLA0C08349g 731629..732051 highly similar to sp|P40185 Saccharo...   177   2e-58
ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C (...   176   4e-58
Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement        176   5e-58
YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein im...   174   3e-57
Kwal_23.5804                                                          172   2e-56
Scas_704.34                                                           171   4e-56
Kwal_23.2807                                                           75   2e-18
Kwal_47.16590                                                          70   2e-16
Kwal_55.21247                                                          67   5e-15
KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia c...    63   1e-13
KLLA0E03894g complement(364475..364888) some similarities with s...    59   6e-12
CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces c...    48   4e-07
Scas_506.3                                                             44   7e-06
AGL164W [4148] [Homologous to ScYLR143W - SH] complement(388842....    40   1e-04
KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomy...    37   0.002
CAGL0K06303g 610605..620348 similar to tr|Q03280 Saccharomyces c...    28   2.9  
AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH] (1446842..1...    27   4.3  
CAGL0L04862g complement(554884..556695) similar to sp|P48837 Sac...    27   5.0  
YMR110C (YMR110C) [4067] chr13 complement(490393..491991) Protei...    27   8.3  

>YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein that
           inhibits cell growth and contributes to cell death at
           high temperature, member of the p14.5 family [390 bp,
           129 aa]
          Length = 129

 Score =  232 bits (591), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 116/128 (90%), Positives = 116/128 (90%)

Query: 1   MVTTLTPVICEXXXXXXXXXXXXMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNI 60
           MVTTLTPVICE            MKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNI
Sbjct: 1   MVTTLTPVICESAPAAAASYSHAMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNI 60

Query: 61  KNVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDME 120
           KNVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDME
Sbjct: 61  KNVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDME 120

Query: 121 MEAIAAER 128
           MEAIAAER
Sbjct: 121 MEAIAAER 128

>Scas_715.53
          Length = 128

 Score =  193 bits (490), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 104/126 (82%)

Query: 2   VTTLTPVICEXXXXXXXXXXXXMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIK 61
           +TTLTPV C+            MK NNLIFLSGQIP+T +NK VEGSIADKAEQVIQNIK
Sbjct: 1   MTTLTPVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIK 60

Query: 62  NVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEM 121
           NVLEASNSSL+++VKVNIFLADIN FAEFN+VYAKYFN HKPARSCVAVAALPL  D+EM
Sbjct: 61  NVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEM 120

Query: 122 EAIAAE 127
           E IA E
Sbjct: 121 EVIAVE 126

>CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces
           cerevisiae YER057c HIG1 Heat-shock induceable Inhibiter
           of cell Growth, hypothetical start
          Length = 142

 Score =  181 bits (460), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 102/126 (80%)

Query: 2   VTTLTPVICEXXXXXXXXXXXXMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIK 61
           ++ LTPVI              MKVNNLI++SGQIP T DNK VEGSI+DKAEQVIQN++
Sbjct: 15  LSKLTPVISANAPPAAASYSHAMKVNNLIYVSGQIPYTKDNKPVEGSISDKAEQVIQNVQ 74

Query: 62  NVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEM 121
           N+L+ SNS L+R+VKVNIFLAD+N+FAEFN VYAKYFN HKPARSCVAVAALPLGVD+EM
Sbjct: 75  NILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAKYFNVHKPARSCVAVAALPLGVDLEM 134

Query: 122 EAIAAE 127
           E IA E
Sbjct: 135 EVIATE 140

>KLLA0C08349g 731629..732051 highly similar to sp|P40185
           Saccharomyces cerevisiae YIL051c MMD1 required for
           maintenance of mitochondrial DNA, start by similarity
          Length = 140

 Score =  177 bits (448), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 87/125 (69%), Positives = 98/125 (78%)

Query: 4   TLTPVICEXXXXXXXXXXXXMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNV 63
           TLTPV  +            +KVNNLIF+SGQIP T +NK VEGSIADKAEQVIQN+KN+
Sbjct: 15  TLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEGSIADKAEQVIQNVKNI 74

Query: 64  LEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEA 123
           L  +NS LD++VKVNIFLADIN FAEFNSVYAKYFN HKPARSCVA  ALPL VD+EME 
Sbjct: 75  LVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSCVAAKALPLNVDLEMEV 134

Query: 124 IAAER 128
           IA E+
Sbjct: 135 IAVEK 139

>ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C
           (HMF1) - SH] (549526..549954) [429 bp, 142 aa]
          Length = 142

 Score =  176 bits (447), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 97/127 (76%)

Query: 2   VTTLTPVICEXXXXXXXXXXXXMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIK 61
           +++LTPV               M+ N ++F+SGQIP TPDNK VEGS+ADK EQVI N++
Sbjct: 15  MSSLTPVRTTAAPPPAASYSQAMRANGMVFVSGQIPYTPDNKPVEGSVADKTEQVIANVR 74

Query: 62  NVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEM 121
           NVLEASNS LDRV KVN+FLAD+ +FAEFNSVYAKYF  HKPARSCVAV ALPL VD+EM
Sbjct: 75  NVLEASNSGLDRVAKVNVFLADMAYFAEFNSVYAKYFGEHKPARSCVAVRALPLNVDLEM 134

Query: 122 EAIAAER 128
           E IA ER
Sbjct: 135 EVIALER 141

>Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement
          Length = 128

 Score =  176 bits (445), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 102/127 (80%)

Query: 2   VTTLTPVICEXXXXXXXXXXXXMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIK 61
           ++TLTPV  +            +KVNN++F+SGQIP T +NK VEGSIADKAEQVIQN+K
Sbjct: 1   MSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVK 60

Query: 62  NVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEM 121
           N+LE +NSSL+++VKVN+FLADIN FAEFN VYAKYFN HKPARSCVAV +LPL VD+EM
Sbjct: 61  NILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEM 120

Query: 122 EAIAAER 128
           E IA E+
Sbjct: 121 EVIAVEK 127

>YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein
           important for maintenance of mitochondrial DNA, may be
           involved in isoleucine-dependent transaminase activity,
           member of the p14.5 family [438 bp, 145 aa]
          Length = 145

 Score =  174 bits (441), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 81/127 (63%), Positives = 100/127 (78%)

Query: 2   VTTLTPVICEXXXXXXXXXXXXMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIK 61
           +TTLTPV  +            MK NN +++SGQIP TPDNK V+GSI++KAEQV QN+K
Sbjct: 18  ITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVK 77

Query: 62  NVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEM 121
           N+L  SNSSLD +VKVN+FLAD+ +FAEFNSVYAK+F+THKPARSCV VA+LPL VD+EM
Sbjct: 78  NILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEM 137

Query: 122 EAIAAER 128
           E IA E+
Sbjct: 138 EVIAVEK 144

>Kwal_23.5804
          Length = 141

 Score =  172 bits (435), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 80/127 (62%), Positives = 98/127 (77%)

Query: 2   VTTLTPVICEXXXXXXXXXXXXMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIK 61
           ++TLTPV  +            M+VN ++F+SGQIP T +NK VEG+IADKAEQVIQN++
Sbjct: 14  MSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKRVEGTIADKAEQVIQNVR 73

Query: 62  NVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEM 121
           N+LE +NS LD++VKVNIFLADI  FAEFN VY KYFN HKPARSCVAV ALPL VD+EM
Sbjct: 74  NILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPARSCVAVKALPLDVDLEM 133

Query: 122 EAIAAER 128
           E +A E+
Sbjct: 134 EVVAVEK 140

>Scas_704.34
          Length = 148

 Score =  171 bits (434), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 80/127 (62%), Positives = 98/127 (77%)

Query: 2   VTTLTPVICEXXXXXXXXXXXXMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIK 61
           +TTLTPV  +            MK NN +++SGQIP TP+NK VEG+I+DKAEQV QNIK
Sbjct: 18  LTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKPVEGTISDKAEQVFQNIK 77

Query: 62  NVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEM 121
           N+L+ S SS+D++VKVN+FLADIN+F EFN VYAKYFN HKPARSCVAV  LPL VD+E+
Sbjct: 78  NILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPARSCVAVKDLPLNVDLEV 137

Query: 122 EAIAAER 128
           E IA E+
Sbjct: 138 EVIAVEK 144

>Kwal_23.2807
          Length = 129

 Score = 75.5 bits (184), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 67/105 (63%), Gaps = 9/105 (8%)

Query: 25  KVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVI----QNIKNVLEASNSSLDRVVKVNIF 80
           K N+L+F SG +   P    V G++ +  EQ I    +N+KNVL AS SSL+RV+KV +F
Sbjct: 27  KSNDLVFTSGCVGTDP----VTGNLPEDLEQQIINALENLKNVLHASGSSLERVLKVLLF 82

Query: 81  LADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEAIA 125
           ++D ++ +  N VY++YF  + PARSC+ VA     + +E+E IA
Sbjct: 83  VSDASYASTVNEVYSRYF-PNAPARSCIVVAFPAPALKVELECIA 126

>Kwal_47.16590
          Length = 126

 Score = 70.1 bits (170), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 54/99 (54%), Gaps = 1/99 (1%)

Query: 27  NNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNVLEASNSSLDRVVKVNIFLADINH 86
           N  +F SG I        V   I D+    I+N++ VL A  SSL +V KV +F++  ++
Sbjct: 26  NGHVFTSGIIGANYGTGEVPHEIEDQVHLAIKNLETVLVAGGSSLSKVFKVTMFISHADY 85

Query: 87  FAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEAIA 125
               N +Y  YF  HKPARSCV VA +   +  E+EAIA
Sbjct: 86  SKVVNEIYGHYF-PHKPARSCVVVAFMDAAIKYELEAIA 123

>Kwal_55.21247
          Length = 134

 Score = 66.6 bits (161), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 60/99 (60%), Gaps = 1/99 (1%)

Query: 27  NNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNVLEASNSSLDRVVKVNIFLADINH 86
           ++L+F SG +   P    +   +  +    ++N+KNVL AS SSL++V+KV +F++D ++
Sbjct: 28  SDLVFTSGCVGTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSY 87

Query: 87  FAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEAIA 125
               N VY++YF    PARSC+ V+     + +E+E IA
Sbjct: 88  APAVNKVYSEYF-PGAPARSCIVVSFPNASLKVELECIA 125

>KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia coli
           O157:H7 Orf, hypothetical protein, start by similarity
          Length = 131

 Score = 63.2 bits (152), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 64/106 (60%), Gaps = 9/106 (8%)

Query: 25  KVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQN----IKNVLEASNSSLDRVVKVNIF 80
           K   L++ SG +     + L+ G I +  E+ ++N    +  VL+ASNSS D V+K+ +F
Sbjct: 27  KDTELVYTSGCV----GSDLLTGEIPEDLEKQVRNALDNLGRVLKASNSSFDDVLKILLF 82

Query: 81  LADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEAIAA 126
           +AD ++ +  N+VY +YF   +PARSC+ V+     + +E+E +AA
Sbjct: 83  VADGSYASTVNAVYKEYF-PERPARSCIVVSFPDPTLKVELECVAA 127

>KLLA0E03894g complement(364475..364888) some similarities with
           sp|Q87LF6 Vibrio parahaemolyticus Conserved hypothetical
           protein, hypothetical start
          Length = 137

 Score = 58.9 bits (141), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 58/99 (58%), Gaps = 1/99 (1%)

Query: 27  NNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNVLEASNSSLDRVVKVNIFLADINH 86
           N L+F SG +   P    +   +  +A   + N+K VLE S SS+D V+K+ +F++D ++
Sbjct: 29  NQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGSY 88

Query: 87  FAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEAIA 125
               N V+ ++F  ++PARSC+ VA     + +E+E IA
Sbjct: 89  AGIVNKVFKEFF-PNQPARSCIVVAFPNNKLKVELECIA 126

>CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces
           cerevisiae YLR143w, hypothetical start
          Length = 688

 Score = 47.8 bits (112), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 57/105 (54%), Gaps = 10/105 (9%)

Query: 25  KVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNVLEASNSSLDRVVKVNIFLADI 84
           ++ NL+++S   P   D     G++ ++ + V+Q + N+L+ ++ +   V+  ++ L D+
Sbjct: 318 RIGNLLYISNIQPQYKD-----GTVQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDM 372

Query: 85  NHFAEFNSVYAKYFNTHK-----PARSCVAVAALPLGVDMEMEAI 124
           + FA  N  Y+K+F+  K     PAR+C+    +  G  +++  +
Sbjct: 373 SLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLSVV 417

>Scas_506.3
          Length = 689

 Score = 43.9 bits (102), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 51/90 (56%), Gaps = 10/90 (11%)

Query: 25  KVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNVLEASNSSLDRVVKVNIFLADI 84
           KV NL+++S   P     K  E ++  +A+QV Q +  +++ ++    +++  ++ LA++
Sbjct: 319 KVGNLLYISNLCP-----KDSELNVEQQAKQVFQQLDKIMKENSLFPSQILFSSLILANM 373

Query: 85  NHFAEFNSVYAKYFNTHK-----PARSCVA 109
           ++FA  N VY  +F  +K     P+R+CV 
Sbjct: 374 SNFATVNQVYNDFFRINKWGPLPPSRACVG 403

>AGL164W [4148] [Homologous to ScYLR143W - SH]
           complement(388842..390902) [2061 bp, 686 aa]
          Length = 686

 Score = 40.4 bits (93), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 12/76 (15%)

Query: 61  KNVLEASNSSLDR--VVKVNIF-----LADINHFAEFNSVYAKYFNTHK-----PARSCV 108
           ++V +  N SL R  VVK  +      LAD+  FAE N+ Y  YF+  +     P+R+C+
Sbjct: 334 RDVFDQLNESLTRHGVVKAQVLSSVLLLADMGTFAEINTAYNGYFSIQEIGPLPPSRACI 393

Query: 109 AVAALPLGVDMEMEAI 124
              +L  G+ +++  +
Sbjct: 394 ESKSLAPGIGLQLSVV 409

>KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomyces
           cerevisiae YLR143w, start by similarity
          Length = 696

 Score = 37.0 bits (84), Expect = 0.002,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 52/102 (50%), Gaps = 11/102 (10%)

Query: 25  KVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNVLEASNSSLDRVVKVNIFLADI 84
           +V  L+++S   P   +      S+ +K   V   + ++L + +    +++  ++ L+D+
Sbjct: 320 EVGKLLYISNIAPSKGE------SLKEKCLDVFSQLTSILSSRSIFACQILSSSLLLSDM 373

Query: 85  NHFAEFNSVYAKYFNTHK-----PARSCVAVAALPLGVDMEM 121
           N+F E NS Y +YFN  K     PAR+CV  + L   V + +
Sbjct: 374 NNFQEVNSYYNEYFNVTKIGPLPPARACVESSFLKHPVQLSV 415

>CAGL0K06303g 610605..620348 similar to tr|Q03280 Saccharomyces
            cerevisiae YDR457w ubiqitin ligase, start by similarity
          Length = 3247

 Score = 27.7 bits (60), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 37/86 (43%), Gaps = 5/86 (5%)

Query: 38   VTPDNKLVEGSIADKAEQVIQNIKNVLEASNSSL-----DRVVKVNIFLADINHFAEFNS 92
            VT    L+E SI+D    V Q I++V    N  L     D V + +      NH   F S
Sbjct: 2062 VTHGVDLIEDSISDSERGVFQGIEHVFHTENQPLFRVQNDSVARHHDRSFRRNHGISFGS 2121

Query: 93   VYAKYFNTHKPARSCVAVAALPLGVD 118
                 FN+ + +++ +     P G++
Sbjct: 2122 PALTLFNSSRRSQNNLINPLGPTGLE 2147

>AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH]
           (1446842..1447978) [1137 bp, 378 aa]
          Length = 378

 Score = 27.3 bits (59), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 2/37 (5%)

Query: 80  FLADINHFAEFNSVYAKYFNTHKPARSC-VAVAALPL 115
           F+ D  H+AE    + KY +TH  A  C VA+A  P 
Sbjct: 296 FIIDFKHYAEKGCCFIKY-DTHDQAALCIVALANFPF 331

>CAGL0L04862g complement(554884..556695) similar to sp|P48837
           Saccharomyces cerevisiae YGR119c NUP57 nuclear pore
           protein, start by similarity
          Length = 603

 Score = 26.9 bits (58), Expect = 5.0,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 10/55 (18%)

Query: 33  SGQIPVTPDNKLVEGSIADKAEQVIQNIKN----------VLEASNSSLDRVVKV 77
           +G+   + DN  V   + D+ +++ + +KN          VLE  N +LD VV++
Sbjct: 548 TGKPSASGDNNRVSDEVYDRIDKIAEILKNQQSGIAYLNDVLEKDNKALDSVVEL 602

>YMR110C (YMR110C) [4067] chr13 complement(490393..491991) Protein
           with similarity to aldehyde dehydrogenases [1599 bp, 532
           aa]
          Length = 532

 Score = 26.6 bits (57), Expect = 8.3,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 34/80 (42%), Gaps = 14/80 (17%)

Query: 4   TLTPVICEXXXXXXXXXXXXMKVNNL------IFL-----SGQIPVTPDNKLVEGSIADK 52
           +LTP + E             K +N+      IF      SGQI V+PD  LV  SI  K
Sbjct: 229 SLTPCVLELGGKSPTFITENFKASNIKIALKRIFFGAFGNSGQICVSPDYLLVHKSIYPK 288

Query: 53  AEQVIQNIKNVLEASNSSLD 72
              VI+  ++VL     S D
Sbjct: 289 ---VIKECESVLNEFYPSFD 305

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.132    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,347,122
Number of extensions: 114858
Number of successful extensions: 412
Number of sequences better than 10.0: 29
Number of HSP's gapped: 406
Number of HSP's successfully gapped: 29
Length of query: 128
Length of database: 16,596,109
Length adjustment: 89
Effective length of query: 39
Effective length of database: 13,515,107
Effective search space: 527089173
Effective search space used: 527089173
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)