Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER056C-A (RPL34A)121944973e-66
YIL052C (RPL34B)121944965e-66
CAGL0M12408g128944645e-61
ADL078C126944411e-57
KLLA0C08371g125944323e-56
Scas_704.33*124944193e-54
Scas_715.54*125944193e-54
Kwal_23.579969381749e-18
Scas_20.1*59211112e-08
Scas_430.144649690.14
CAGL0I07205g60334660.41
YDL177C17054583.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER056C-A
         (120 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER056C-A (RPL34A) [1486] chr5 complement(269421..269749,270147....   196   3e-66
YIL052C (RPL34B) [2615] chr9 complement(256224..256552,257025..2...   195   5e-66
CAGL0M12408g join(1236607..1236643,1237307..1237656) highly simi...   183   5e-61
ADL078C [1663] [Homologous to ScYIL052C (RPL34B) - SH; ScYER056C...   174   1e-57
KLLA0C08371g join(732878..732914,733482..733822) highly similar ...   171   3e-56
Scas_704.33*                                                          166   3e-54
Scas_715.54*                                                          166   3e-54
Kwal_23.5799                                                           72   9e-18
Scas_20.1*                                                             47   2e-08
Scas_430.1                                                             31   0.14 
CAGL0I07205g 694434..696245 similar to tr|Q12242 Saccharomyces c...    30   0.41 
YDL177C (YDL177C) [695] chr4 complement(141210..141722) Member o...    27   3.3  

>YER056C-A (RPL34A) [1486] chr5
          complement(269421..269749,270147..270183) Ribosomal
          protein L34 (rat L34), nearly identical to Rpl34Bp [366
          bp, 121 aa]
          Length = 121

 Score =  196 bits (497), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 94/94 (100%), Positives = 94/94 (100%)

Query: 1  MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR 60
          MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR
Sbjct: 1  MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR 60

Query: 61 QYATVSKTHKTVSRAYGGSRCANCVKERIIRAFL 94
          QYATVSKTHKTVSRAYGGSRCANCVKERIIRAFL
Sbjct: 61 QYATVSKTHKTVSRAYGGSRCANCVKERIIRAFL 94

>YIL052C (RPL34B) [2615] chr9
          complement(256224..256552,257025..257061) Ribosomal
          protein L34 (rat L34), nearly identical to Rpl34Ap [366
          bp, 121 aa]
          Length = 121

 Score =  195 bits (496), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 93/94 (98%), Positives = 94/94 (100%)

Query: 1  MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR 60
          MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR
Sbjct: 1  MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR 60

Query: 61 QYATVSKTHKTVSRAYGGSRCANCVKERIIRAFL 94
          QYATVSKTHKTVSRAYGGSRCANCVKERI+RAFL
Sbjct: 61 QYATVSKTHKTVSRAYGGSRCANCVKERIVRAFL 94

>CAGL0M12408g join(1236607..1236643,1237307..1237656) highly
          similar to sp|P40525 Saccharomyces cerevisiae YIL052c
          RPL34B or sp|P87262 Saccharomyces cerevisiae YER056BC
          RPL34A
          Length = 128

 Score =  183 bits (464), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 87/94 (92%), Positives = 91/94 (96%)

Query: 1  MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR 60
          MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCG AL GI+TLRPR
Sbjct: 1  MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGIALPGIATLRPR 60

Query: 61 QYATVSKTHKTVSRAYGGSRCANCVKERIIRAFL 94
          QYA++SKTHKTVSR YGGSRCANCVKERI+RAFL
Sbjct: 61 QYASISKTHKTVSRVYGGSRCANCVKERIVRAFL 94

>ADL078C [1663] [Homologous to ScYIL052C (RPL34B) - SH;
          ScYER056C-A (RPL34A) - SH]
          (548697..549040,549209..549245) [381 bp, 126 aa]
          Length = 126

 Score =  174 bits (441), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 90/94 (95%)

Query: 1  MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR 60
          MAQRVTFRRRNP+NT++NKIKVVKTPGG+LRAQHVKKLATR KCGDCG AL GIS+LRPR
Sbjct: 1  MAQRVTFRRRNPFNTKTNKIKVVKTPGGVLRAQHVKKLATRHKCGDCGIALDGISSLRPR 60

Query: 61 QYATVSKTHKTVSRAYGGSRCANCVKERIIRAFL 94
          QYA+VSKTHKTVSR YGGSRCANCVK+RI+RAFL
Sbjct: 61 QYASVSKTHKTVSRPYGGSRCANCVKQRIVRAFL 94

>KLLA0C08371g join(732878..732914,733482..733822) highly similar
          to sp|P40525 Saccharomyces cerevisiae YIL052c RPL34B
          ribosomal protein or sp|P87262 Saccharomyces cerevisiae
          YER056ca ribosomal protein, start by similarity
          Length = 125

 Score =  171 bits (432), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 87/94 (92%)

Query: 1  MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR 60
          MAQRVTFRRRNPYNT+SNKIKVVKTPGG LR+QHVKKLATRPKCGD G  LQG+STLRPR
Sbjct: 1  MAQRVTFRRRNPYNTKSNKIKVVKTPGGALRSQHVKKLATRPKCGDTGVPLQGVSTLRPR 60

Query: 61 QYATVSKTHKTVSRAYGGSRCANCVKERIIRAFL 94
          QYATVS+T KTVSRAYGGS+ AN VKERI+RAFL
Sbjct: 61 QYATVSRTKKTVSRAYGGSKSANAVKERIVRAFL 94

>Scas_704.33*
          Length = 124

 Score =  166 bits (419), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 78/94 (82%), Positives = 86/94 (91%)

Query: 1  MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR 60
          MAQRVTFRRRNP NT+SNKIKVVKTPGGILRAQHVKK A+RPKCGDCG  L G++ LRPR
Sbjct: 1  MAQRVTFRRRNPCNTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIPLPGVAALRPR 60

Query: 61 QYATVSKTHKTVSRAYGGSRCANCVKERIIRAFL 94
          QYA++SKT KTVSR YGGSRC+NCVKERI+RAFL
Sbjct: 61 QYASISKTSKTVSRVYGGSRCSNCVKERIVRAFL 94

>Scas_715.54*
          Length = 125

 Score =  166 bits (419), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 78/94 (82%), Positives = 86/94 (91%)

Query: 1  MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR 60
          MAQRVTFRRRNP NT+SNKIKVVKTPGGILRAQHVKK A+RPKCGDCG  L G++ LRPR
Sbjct: 1  MAQRVTFRRRNPCNTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIPLPGVAALRPR 60

Query: 61 QYATVSKTHKTVSRAYGGSRCANCVKERIIRAFL 94
          QYA++SKT KTVSR YGGSRC+NCVKERI+RAFL
Sbjct: 61 QYASISKTSKTVSRVYGGSRCSNCVKERIVRAFL 94

>Kwal_23.5799
          Length = 69

 Score = 71.6 bits (174), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 35/38 (92%)

Query: 57 LRPRQYATVSKTHKTVSRAYGGSRCANCVKERIIRAFL 94
          +RPR+YATVSKTHKTVSRAYGG  CAN VKERI+RAFL
Sbjct: 1  MRPREYATVSKTHKTVSRAYGGVLCANAVKERIVRAFL 38

>Scas_20.1*
          Length = 59

 Score = 47.4 bits (111), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 21/21 (100%)

Query: 74 RAYGGSRCANCVKERIIRAFL 94
          RAYGGSRCANCVKERI+RAFL
Sbjct: 39 RAYGGSRCANCVKERIVRAFL 59

>Scas_430.1
          Length = 446

 Score = 31.2 bits (69), Expect = 0.14,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 6/49 (12%)

Query: 3   QRVTFRRRNPYNTRSNKIKVVKTP------GGILRAQHVKKLATRPKCG 45
           Q +T + RNP  T ++     K P       G++R  H+  L + P CG
Sbjct: 206 QVITVKERNPQETVTDDASFSKIPEDYDMTNGVIRTIHIGNLDSNPCCG 254

>CAGL0I07205g 694434..696245 similar to tr|Q12242 Saccharomyces
           cerevisiae YOR138c, hypothetical start
          Length = 603

 Score = 30.0 bits (66), Expect = 0.41,   Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 18/34 (52%)

Query: 9   RRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRP 42
           R NP+NT  +KI V K  G     QHVK   T P
Sbjct: 514 RFNPFNTAEDKISVGKCDGPGEVIQHVKNSTTVP 547

>YDL177C (YDL177C) [695] chr4 complement(141210..141722) Member of
           the UPF0029 uncharacterized protein family, has low
           similarity to a region of S. cerevisiae Yih1p, which may
           function in general amino acid control response [513 bp,
           170 aa]
          Length = 170

 Score = 26.9 bits (58), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 8/54 (14%)

Query: 34  HVKK---LATRPK-----CGDCGSALQGISTLRPRQYATVSKTHKTVSRAYGGS 79
           HV K   +  +PK     C DCG A  G   L   + A +      V+R YGG+
Sbjct: 92  HVNKSRNITVQPKNIEQGCADCGEAGAGQRLLTLLERANIFNVLVIVTRWYGGT 145

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.133    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,637,526
Number of extensions: 77938
Number of successful extensions: 251
Number of sequences better than 10.0: 15
Number of HSP's gapped: 251
Number of HSP's successfully gapped: 15
Length of query: 120
Length of database: 16,596,109
Length adjustment: 88
Effective length of query: 32
Effective length of database: 13,549,725
Effective search space: 433591200
Effective search space used: 433591200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 54 (25.4 bits)