Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER056C (FCY2)53352427410.0
YER060W-A (FCY22)53051522280.0
YER060W (FCY21)52851620520.0
Scas_704.3654551620050.0
CAGL0L00671g54352319670.0
Scas_715.4953251619380.0
Scas_715.47d53352419110.0
CAGL0J02948g51550618190.0
Sklu_1893.251352318150.0
Kwal_23.581951651717540.0
KLLA0C08283g51950017010.0
Scas_715.47d152351916170.0
Kwal_34.1573051852015570.0
CAGL0C00231g54052015590.0
ADL074W52450315360.0
Scas_715.54d2322366914e-88
KLLA0D05060g5235056093e-72
Kwal_47.172165425416009e-71
YGL186C (TPN1)5795514928e-55
CAGL0L06138g6314474623e-50
Scas_710.305844324297e-46
Scas_701.168592208e-22
Scas_690.1*636592371e-20
KLLA0C14135g27181710.94
KLLA0D12716g59548683.1
KLLA0E05808g62951666.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER056C
         (524 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER056C (FCY2) [1485] chr5 complement(266511..268112) Cytosine/p...  1060   0.0  
YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine p...   862   0.0  
YER060W (FCY21) [1490] chr5 (274565..276151) Protein with simila...   795   0.0  
Scas_704.36                                                           776   0.0  
CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomy...   762   0.0  
Scas_715.49                                                           751   0.0  
Scas_715.47d                                                          740   0.0  
CAGL0J02948g 282559..284106 highly similar to sp|P40039 Saccharo...   705   0.0  
Sklu_1893.2 YER056C, Contig c1893 1725-3266                           703   0.0  
Kwal_23.5819                                                          680   0.0  
KLLA0C08283g complement(725563..727122) similar to sp|P17064 Sac...   659   0.0  
Scas_715.47d1                                                         627   0.0  
Kwal_34.15730                                                         604   0.0  
CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces cer...   605   0.0  
ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH] complement(...   596   0.0  
Scas_715.54d                                                          270   4e-88
KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces c...   239   3e-72
Kwal_47.17216                                                         235   9e-71
YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of ...   194   8e-55
CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces c...   182   3e-50
Scas_710.30                                                           169   7e-46
Scas_701.1                                                             89   8e-22
Scas_690.1*                                                            96   1e-20
KLLA0C14135g complement(1221902..1222717) similar to sp|P53335 S...    32   0.94 
KLLA0D12716g complement(1084062..1085849) similar to sp|P39709 S...    31   3.1  
KLLA0E05808g complement(520702..522591) similar to sp|P47147 Sac...    30   6.2  

>YER056C (FCY2) [1485] chr5 complement(266511..268112)
           Cytosine/purine permease, member of the purine/cytosine
           permease family of membrane transporters [1602 bp, 533
           aa]
          Length = 533

 Score = 1060 bits (2741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/524 (100%), Positives = 524/524 (100%)

Query: 1   MLEEGNNVYEIQDLEKRSPVIGSSLENEKKVAASETFTATSEDDQQYIVESSEATKLSWF 60
           MLEEGNNVYEIQDLEKRSPVIGSSLENEKKVAASETFTATSEDDQQYIVESSEATKLSWF
Sbjct: 1   MLEEGNNVYEIQDLEKRSPVIGSSLENEKKVAASETFTATSEDDQQYIVESSEATKLSWF 60

Query: 61  HKFFASLNAETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQ 120
           HKFFASLNAETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQ
Sbjct: 61  HKFFASLNAETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQ 120

Query: 121 SVLVIIFFNIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIV 180
           SVLVIIFFNIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIV
Sbjct: 121 SVLVIIFFNIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIV 180

Query: 181 NTSVSAQLLNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFL 240
           NTSVSAQLLNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFL
Sbjct: 181 NTSVSAQLLNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFL 240

Query: 241 VIIAQLSRSGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYK 300
           VIIAQLSRSGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYK
Sbjct: 241 VIIAQLSRSGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYK 300

Query: 301 IFFSLVAGLAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQ 360
           IFFSLVAGLAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQ
Sbjct: 301 IFFSLVAGLAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQ 360

Query: 361 FCCVLLALSTIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFD 420
           FCCVLLALSTIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFD
Sbjct: 361 FCCVLLALSTIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFD 420

Query: 421 GFMENFMDSIGYYLAIYIAISCSEHFFYRRSFSAYNIDDWDNWEHLPIGIAGTAALIVGA 480
           GFMENFMDSIGYYLAIYIAISCSEHFFYRRSFSAYNIDDWDNWEHLPIGIAGTAALIVGA
Sbjct: 421 GFMENFMDSIGYYLAIYIAISCSEHFFYRRSFSAYNIDDWDNWEHLPIGIAGTAALIVGA 480

Query: 481 FGVALGMCQTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILR 524
           FGVALGMCQTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILR
Sbjct: 481 FGVALGMCQTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILR 524

>YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine
           permease with similarity to Fcy2p, member of the
           purine/cytosine subfamily of the nucleobase:cation
           symporter-1 (NCS1) family [1593 bp, 530 aa]
          Length = 530

 Score =  862 bits (2228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/515 (82%), Positives = 459/515 (89%), Gaps = 11/515 (2%)

Query: 10  EIQDLEKRSPVIGSSLENEKKVAASETFTATSEDDQQYIVESSEATKLSWFHKFFASLNA 69
           E++DLE       S   + K  AA   +           +++    K S+F++  A+LNA
Sbjct: 18  ELRDLE-------SGALDTKSSAADVYYEGVELHRTNEFIDN----KPSFFNRIAAALNA 66

Query: 70  ETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVIIFFN 129
           ETKG+EPVTEDEK DDSILNAA++WFSANMVI +Y++GALGP+VFGLNFGQSVLVIIFFN
Sbjct: 67  ETKGIEPVTEDEKNDDSILNAATIWFSANMVIVAYSVGALGPLVFGLNFGQSVLVIIFFN 126

Query: 130 IMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSAQLL 189
           I+GLI VA FS+FG ELGLRQMILSRYL GN+TAR FSL+NVIACVGW ++N SVSAQLL
Sbjct: 127 ILGLIPVALFSLFGVELGLRQMILSRYLAGNITARFFSLVNVIACVGWCVLNISVSAQLL 186

Query: 190 NMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQLSRS 249
           NMVNEGSGH CPIWAGCLII GGTVLVTFFGYSV+HAYEKWSWVPNFA FLVIIAQLSRS
Sbjct: 187 NMVNEGSGHNCPIWAGCLIIAGGTVLVTFFGYSVVHAYEKWSWVPNFAAFLVIIAQLSRS 246

Query: 250 GKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSLVAGL 309
           GKFKGGEWVGGATTAG VLSFGSS+FG AAGW TYAADYTVYMPK+T+KYKIFFS+VAGL
Sbjct: 247 GKFKGGEWVGGATTAGGVLSFGSSVFGSAAGWATYAADYTVYMPKTTSKYKIFFSVVAGL 306

Query: 310 AFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLALS 369
           AFPLFFTMILGAA  MAALNDPTWK+YYDKNAMGGVIYAILVPNSLNGFGQFCCVLLALS
Sbjct: 307 AFPLFFTMILGAACGMAALNDPTWKSYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLALS 366

Query: 370 TIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMDS 429
           T+ANN+P MYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMDS
Sbjct: 367 TVANNVPGMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMDS 426

Query: 430 IGYYLAIYIAISCSEHFFYRRSFSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVALGMCQ 489
           IGYYLAIYIAI+CSEHF YRRSFSAYNIDDWDNWEHLPIGIAGTAALI GAFGVALGMCQ
Sbjct: 427 IGYYLAIYIAIACSEHFIYRRSFSAYNIDDWDNWEHLPIGIAGTAALIAGAFGVALGMCQ 486

Query: 490 TYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILR 524
           TYWVGEI RLIG+YGGDIGFELG SWAFIIYNI+R
Sbjct: 487 TYWVGEISRLIGEYGGDIGFELGGSWAFIIYNIVR 521

>YER060W (FCY21) [1490] chr5 (274565..276151) Protein with
           similarity to Fcy2p, member of the purine/cytosine
           family of secondary active transporters [1587 bp, 528
           aa]
          Length = 528

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/516 (73%), Positives = 440/516 (85%), Gaps = 13/516 (2%)

Query: 9   YEIQDLEKRSPVIGSSLENEKKVAASETFTATSEDDQQYIVESSEATKLSWFHKFFASLN 68
           YE++DLE R+        + K  + +E +        + +VE+    KLS+ ++  A L+
Sbjct: 17  YELKDLESRA-------HDAKTPSTNEFYDDVESHGTEELVEA----KLSFLNRIAAGLS 65

Query: 69  AETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVIIFF 128
           AETKG+EP+TEDEKTDDSILNAASMWFSANMV+ +YA+GALGPMVF LNFGQSV VIIFF
Sbjct: 66  AETKGIEPITEDEKTDDSILNAASMWFSANMVLPAYAIGALGPMVFDLNFGQSVFVIIFF 125

Query: 129 NIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSAQL 188
           N++GL+ VAFFSVFGAELGLRQMILSRYLVGN+ ARIFS IN IAC+GWGIVNT  S+Q+
Sbjct: 126 NLLGLVSVAFFSVFGAELGLRQMILSRYLVGNIAARIFSFINFIACIGWGIVNTVASSQV 185

Query: 189 LNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQLSR 248
           LNMVN G  H CP+WAGC++IIG TV+VTFFGY VIHAYEKW+WVPNFAVFLVIIA+L+R
Sbjct: 186 LNMVNPG--HQCPLWAGCIVIIGATVIVTFFGYGVIHAYEKWAWVPNFAVFLVIIARLAR 243

Query: 249 SGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSLVAG 308
           S KF  GEW  G TTAG+VLSFGS+++GFAAGWTTYAADYTVYMP+ TNKYKIFFSLV G
Sbjct: 244 SKKFVLGEWTSGPTTAGNVLSFGSTVYGFAAGWTTYAADYTVYMPRKTNKYKIFFSLVVG 303

Query: 309 LAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLAL 368
           LA PL+FTMILGAA AMAA+ DP WK YYD+N++GG+ +A+LVPNS++GFGQFCCVLL+L
Sbjct: 304 LATPLYFTMILGAAVAMAAIGDPAWKTYYDENSIGGLTFAVLVPNSVHGFGQFCCVLLSL 363

Query: 369 STIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMD 428
           STIANN+PNMYT+ALS QA W PLAK+PRV+WT+ GNAA LGI+IPA YYF  FM  FMD
Sbjct: 364 STIANNVPNMYTIALSVQATWEPLAKVPRVIWTLLGNAAALGIAIPACYYFSTFMNYFMD 423

Query: 429 SIGYYLAIYIAISCSEHFFYRRSFSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVALGMC 488
           SIGYYLAIYIAI+CSEHF YRRSFSAYN+DDWD+WE LPIGIAGTAALIVGAFGVALGMC
Sbjct: 424 SIGYYLAIYIAIACSEHFIYRRSFSAYNVDDWDSWERLPIGIAGTAALIVGAFGVALGMC 483

Query: 489 QTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILR 524
           QTYWVGEI RLIG YGGDIGFELG SWAFI+YNI R
Sbjct: 484 QTYWVGEISRLIGDYGGDIGFELGLSWAFIVYNIAR 519

>Scas_704.36
          Length = 545

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/516 (73%), Positives = 436/516 (84%), Gaps = 6/516 (1%)

Query: 13  DLEKRSPVIGSSLENEKKVAASETFTATSEDDQQYIVESSEA----TKLSWFHKFFASLN 68
           DLE+ +    +S   +   A  +      + D+   ++  E     TKLS+F++F ASLN
Sbjct: 23  DLERETGYEMNSFGEKASSADIKVIPGVPDYDEYESIQEPETYMEETKLSFFNRFVASLN 82

Query: 69  AETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVIIFF 128
           AETKGVEPVT++EKTDDSI+NAASMWFSAN+VIASYALG LGP+VF LNFG SVLVIIFF
Sbjct: 83  AETKGVEPVTDEEKTDDSIINAASMWFSANLVIASYALGGLGPIVFNLNFGTSVLVIIFF 142

Query: 129 NIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSAQL 188
           NI+GL+ +AFFSVFGAE GLRQMILSRYL+GN+TARIF++IN+IACVGWG+VNT  S+QL
Sbjct: 143 NILGLLSIAFFSVFGAEFGLRQMILSRYLLGNITARIFAIINIIACVGWGVVNTVASSQL 202

Query: 189 LNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQLSR 248
           LNMVN  + + CP+WAGCLII+G TVLVTFFGY+VIHAYEKWSWVPNFAVFLVIIA+L  
Sbjct: 203 LNMVN--TPNNCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNFAVFLVIIARLKM 260

Query: 249 SGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSLVAG 308
           SG F GGEW  G TTAG+VLSFG ++FGFAAGWTTYAADYTVYMP+STNKY IFFSL AG
Sbjct: 261 SGAFTGGEWTSGPTTAGNVLSFGGAVFGFAAGWTTYAADYTVYMPRSTNKYTIFFSLTAG 320

Query: 309 LAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLAL 368
           L+ PLFFTMILGAASAM A+N+P W  YY  N MGGV YAILVP+SL+GFGQFCCVLLA+
Sbjct: 321 LSLPLFFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILVPDSLHGFGQFCCVLLAM 380

Query: 369 STIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMD 428
           ST+ANNIPNMYT+ALS QAL+ P +K+PRV WTMAGNA TLGISI A YYF GFMENFM+
Sbjct: 381 STVANNIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGISIAACYYFQGFMENFMN 440

Query: 429 SIGYYLAIYIAISCSEHFFYRRSFSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVALGMC 488
           SIGYYLAIYIAIS SEHF YR+ F  YN++DW+ W  LPIGIAGT+ALIVGAFGVALGM 
Sbjct: 441 SIGYYLAIYIAISLSEHFIYRKGFQGYNVEDWNTWSKLPIGIAGTSALIVGAFGVALGMS 500

Query: 489 QTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILR 524
           Q+YWVGEIG+LIG +GGDIGFELGASWAFI+YN+LR
Sbjct: 501 QSYWVGEIGKLIGDHGGDIGFELGASWAFIVYNVLR 536

>CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomyces
           cerevisiae YER056c FCY2 purine-cytosine permease or
           sp|P40039 Saccharomyces cerevisiae YER060w FCY21,
           hypothetical start
          Length = 543

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/523 (70%), Positives = 442/523 (84%), Gaps = 10/523 (1%)

Query: 6   NNVYEIQDLEKRSPVIGSSLEN----EKKVAASETFTATSEDDQQYIVESSEATKLSWFH 61
           +N YE+ ++EK+ PV      N    + +    + FT +SE      VE ++  KL +  
Sbjct: 18  SNDYELNEVEKQ-PVEDVKTTNVNTNDFEYDYGDDFTNSSE---AATVEETK-LKLGFIS 72

Query: 62  KFFASLNAETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQS 121
           +    +NAETKGVEPVT++EKTDDS+LNAASMWFSAN+V+ASYALGALGP+VF LNFG S
Sbjct: 73  RLALKMNAETKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTS 132

Query: 122 VLVIIFFNIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVN 181
           VL I+FFN++GL+ VAFFSVFGAE GLRQMILSR+LVGNVTAR+F+ INV+ACVGWG+VN
Sbjct: 133 VLTIVFFNMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVN 192

Query: 182 TSVSAQLLNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLV 241
           T V+AQLL++VN+GS H  P+W GCL+I+GGTV+VTFFGYS+IHAYE+WSWVPNFAVFLV
Sbjct: 193 TVVAAQLLHIVNQGS-HQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLV 251

Query: 242 IIAQLSRSGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKI 301
           IIA+L +SG+F  G W  GATTAG VLSFGS+I+GFAAGWTTYAADYTVYMP++ NK+KI
Sbjct: 252 IIARLHKSGQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMPRTMNKFKI 311

Query: 302 FFSLVAGLAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQF 361
           FF L AGLAFPL FTMILGAASAM A+N+P W A YDK+ MGG+ YAILVPNSL+GFG+F
Sbjct: 312 FFFLCAGLAFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPNSLHGFGEF 371

Query: 362 CCVLLALSTIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDG 421
           CCVLLA+STIANNIPNMYT+ALS QAL+ P +++PRVVWT+AGNAA +GISIPA+YYF+G
Sbjct: 372 CCVLLAMSTIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISIPASYYFEG 431

Query: 422 FMENFMDSIGYYLAIYIAISCSEHFFYRRSFSAYNIDDWDNWEHLPIGIAGTAALIVGAF 481
           F+ENFMDSIGYYLAIYIAIS SEHF YRR F  YNI+DW+NW+ LPIGIAG +AL VGAF
Sbjct: 432 FLENFMDSIGYYLAIYIAISLSEHFIYRRGFKGYNIEDWNNWDRLPIGIAGCSALFVGAF 491

Query: 482 GVALGMCQTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILR 524
           GVALGM QTYW GEI R IGK+GGDIGFELG SWAFI++NI+R
Sbjct: 492 GVALGMSQTYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVR 534

>Scas_715.49
          Length = 532

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/516 (68%), Positives = 432/516 (83%), Gaps = 9/516 (1%)

Query: 9   YEIQDLEKRSPVIGSSLENEKKVAASETFTATSEDDQQYIVESSEATKLSWFHKFFASLN 68
           YE+ DLE+ S      L++  K  +S+ +        + ++E    TKL+ F++  A L+
Sbjct: 17  YEMNDLERNS----KDLKSPSKNLSSDYYVDIDSHASEEVLE----TKLNLFNRIAAGLS 68

Query: 69  AETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVIIFF 128
           AETKG+EP+T++EK D S+LNAASMWFSANMVIA+YA+G LGP+VFGLNFG S LVIIFF
Sbjct: 69  AETKGIEPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIFF 128

Query: 129 NIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSAQL 188
           NI+GL+ VAFFS+FGA+LGLRQM+LSR+L+GN TARIFS+IN +ACVGWGIVNT  S+QL
Sbjct: 129 NILGLLPVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQL 188

Query: 189 LNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQLSR 248
           LNMVN+G  H CP+WAGC++IIG T+L+TFFGY VIH++EKW WVPNFA FLVIIA+L++
Sbjct: 189 LNMVNQGP-HKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARLAK 247

Query: 249 SGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSLVAG 308
           SG F  GEW  G TTAG+VLSFGS++FGFA GWTTYAADYTVYMP++TNK+KIFFSLVAG
Sbjct: 248 SGNFSNGEWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLVAG 307

Query: 309 LAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLAL 368
           L+FPLFF MILGAASAM A+N+P W  YY +N MGG+ YAILVPNSL+GFG+FCCV+L++
Sbjct: 308 LSFPLFFVMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVLSI 367

Query: 369 STIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMD 428
           S +ANN+PNMYT+ALS QA+WAPLAKIPRV WTMAGN ATLGI+IPA Y+FD FME FMD
Sbjct: 368 SIVANNVPNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYFMD 427

Query: 429 SIGYYLAIYIAISCSEHFFYRRSFSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVALGMC 488
           SI YYLAIYI+I+ SEHF YRRSF AYN++DWD+   LPIGIAG  A  VG  GVALGMC
Sbjct: 428 SIAYYLAIYISIALSEHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMC 487

Query: 489 QTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILR 524
           QTYW G+IGRLIG+YGGD+GFELGA W+FI+YN++R
Sbjct: 488 QTYWTGQIGRLIGEYGGDLGFELGAGWSFIVYNLVR 523

>Scas_715.47d
          Length = 533

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/524 (68%), Positives = 432/524 (82%), Gaps = 11/524 (2%)

Query: 6   NNVYEIQDLE---KRSPVIGSSLENEKKVAASETFTATSEDDQQYIVESSEAT--KLSWF 60
            NVYEIQDLE   +R+    S+L N+KK+    TF+    ++    +E +E T  K S+F
Sbjct: 7   KNVYEIQDLEMDLERNSEF-SNLPNDKKIDLGPTFS----NEPASFIEITEETGSKFSFF 61

Query: 61  HKFFASLNAETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQ 120
           ++  + LNAETKG+E +T++EKTD SIL+A SMWFSANMVI++Y LG +GP+V+GLNFG 
Sbjct: 62  NRLASQLNAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFGT 121

Query: 121 SVLVIIFFNIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIV 180
            VL IIFF+I+GL+ VAFFS+FGA+ GLRQM+LSR+L+GN TARI ++INVI+ VGWG+V
Sbjct: 122 CVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGVV 181

Query: 181 NTSVSAQLLNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFL 240
           N+  S+QLLNMVN+G  H CP+WAGC+IIIG T+LVTFFGYS IHAYE+WSWVPNFAVFL
Sbjct: 182 NSVASSQLLNMVNQGH-HSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFL 240

Query: 241 VIIAQLSRSGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYK 300
           VIIA+L  SG F GGEW  G TTAG+VLSFG +IFGFA GWT YAADYTVYMP+ TNK+K
Sbjct: 241 VIIARLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFK 300

Query: 301 IFFSLVAGLAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQ 360
           IFFSLV GL+FPLFF +ILGAASAM A+N+PTW  YY  N MGGV YAILVP+SL+GFG+
Sbjct: 301 IFFSLVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGE 360

Query: 361 FCCVLLALSTIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFD 420
           FCCVLLALSTIANNIPNMY++ L+ QA+W PLAK+PR +WT+AGNAATL ISIPA YYFD
Sbjct: 361 FCCVLLALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFD 420

Query: 421 GFMENFMDSIGYYLAIYIAISCSEHFFYRRSFSAYNIDDWDNWEHLPIGIAGTAALIVGA 480
           GFME+FM+SIGYYLAIY A + +EHF +RR F  YN++DWD+   LP+GIAG AAL VGA
Sbjct: 421 GFMEDFMNSIGYYLAIYSATALAEHFIFRRGFKGYNVEDWDDNSKLPMGIAGCAALFVGA 480

Query: 481 FGVALGMCQTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILR 524
           FGVALGM QTYWVGEI R IG+YGGDIGFELGA WAF++Y ILR
Sbjct: 481 FGVALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILR 524

>CAGL0J02948g 282559..284106 highly similar to sp|P40039
           Saccharomyces cerevisiae YER060w or sp|P17064
           Saccharomyces cerevisiae YER056c FCY2, hypothetical
           start
          Length = 515

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/506 (67%), Positives = 414/506 (81%), Gaps = 6/506 (1%)

Query: 24  SLENEKKVAASETFTATSEDDQQYIVESSEAT----KLSWFHKFFASLNAETKGVEPVTE 79
           S E++K +   E    +S +        ++AT    KLS  ++  A ++AETKG+EP+T+
Sbjct: 2   SYEDKKDLYDMEMQVESSANSHVETDGYNDATVLETKLSLLNRLAAMISAETKGIEPITD 61

Query: 80  DEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVIIFFNIMGLIFVAFF 139
           DEK DDS++NAASMWFSANMV+ + A+G LGP+VFGLNFG SVL I+FFNI+GL  VAFF
Sbjct: 62  DEKNDDSLINAASMWFSANMVLPALAIGGLGPLVFGLNFGVSVLTIVFFNILGLFAVAFF 121

Query: 140 SVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSAQLLNMVNEGSGHV 199
           SVFGA+ GLRQM+LSRYLVGN+TARIF+LIN +ACVGWGIVNT  ++QLLN +N GS H 
Sbjct: 122 SVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGS-HQ 180

Query: 200 CPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQLSRSGKFKGGEWVG 259
            P+W GCL+IIG T+LV+FFGY VIH YEK+SWVPNFAVFLV+IA+L  SGKF  G W  
Sbjct: 181 LPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGAWGS 240

Query: 260 GATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSLVAGLAFPLFFTMIL 319
           G TTAGSVLSFGS++FGFA+GWTTYAADYTVYMP++TN YKIFF+LVAGLAFPLFFTMIL
Sbjct: 241 GPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFFTMIL 300

Query: 320 GAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLALSTIANNIPNMY 379
           G+A A AA++   W+ +Y+KN MGG+ +AILVP+SL+GFGQFCCV+LA+STIANN+PNMY
Sbjct: 301 GSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNVPNMY 360

Query: 380 TVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMDSIGYYLAIYIA 439
           T+ALSAQ++W P AKIPRVVWTM GN A LGISIPA YYF  FM+ FMDSI YYL+IYI+
Sbjct: 361 TIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDSIAYYLSIYIS 420

Query: 440 ISCSEHFFYRR-SFSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVALGMCQTYWVGEIGR 498
           I+  EH  YR  SFS YN++DW+N++ LPIGIAGT +L+VGAFGVALGM Q+YWVGEI R
Sbjct: 421 IALCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIAR 480

Query: 499 LIGKYGGDIGFELGASWAFIIYNILR 524
            IG+YGGDI  ELGA WAFI YNI R
Sbjct: 481 HIGEYGGDIAIELGAGWAFIAYNICR 506

>Sklu_1893.2 YER056C, Contig c1893 1725-3266
          Length = 513

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/523 (65%), Positives = 413/523 (78%), Gaps = 19/523 (3%)

Query: 2   LEEGNNVYEIQDLEKRSPVIGSSLENEKKVAASETFTATSEDDQQYIVESSEATKLSWFH 61
           +      Y IQD+EK++P+                    +E D   +VES+E T +S+  
Sbjct: 1   MSSSKEEYAIQDMEKQNPL------------------ELTETDSTPVVESTEYTTVSFID 42

Query: 62  KFFASLNAETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQS 121
           ++ A L AETKG+EP+T++EK DDSILNAASMWFSANMVIA+YALG LG  VFGLNF +S
Sbjct: 43  RWAAKLKAETKGIEPITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWES 102

Query: 122 VLVIIFFNIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVN 181
           VL IIFF+ +GLI VAFFSVFGAELG+RQM+LSR+L+GNVTARIF+LINVIACVGWG VN
Sbjct: 103 VLTIIFFSFLGLIPVAFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVN 162

Query: 182 TSVSAQLLNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLV 241
           T  SA LL+M+N G G  CP WA CLII+  T++VTFFGY VIHAYEKWSWVPNFAVFLV
Sbjct: 163 TIASASLLHMINPG-GAQCPPWAACLIIVFSTIIVTFFGYRVIHAYEKWSWVPNFAVFLV 221

Query: 242 IIAQLSRSGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKI 301
           IIA+L  SG F  GEW  GATTAG VLSFG SIFGFA+GWTTYAADYTVYMP+STNK+KI
Sbjct: 222 IIARLKISGNFSTGEWTSGATTAGGVLSFGGSIFGFASGWTTYAADYTVYMPRSTNKWKI 281

Query: 302 FFSLVAGLAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQF 361
           FF+LV GLAFPL F++ILGAAS      +  WK YY+ +++GG++YAILV +SL+GFG+F
Sbjct: 282 FFALVFGLAFPLCFSLILGAASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEF 341

Query: 362 CCVLLALSTIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDG 421
           CCVLLA+ST+ANNIPNMY++AL  Q++W PLAK+PRV WT+AGN  TL I+IPA Y F+ 
Sbjct: 342 CCVLLAMSTVANNIPNMYSIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFES 401

Query: 422 FMENFMDSIGYYLAIYIAISCSEHFFYRRSFSAYNIDDWDNWEHLPIGIAGTAALIVGAF 481
           FM +FM++I YYLAIYIAIS SEHFFYR+ F  YN+DDW+ W+ LPIG AG AAL +GAF
Sbjct: 402 FMSSFMEAIAYYLAIYIAISLSEHFFYRKGFKGYNVDDWNRWDRLPIGYAGCAALFIGAF 461

Query: 482 GVALGMCQTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILR 524
           GVA GM QTYW G+I R IG+YGGDIGFELG  ++FI YNILR
Sbjct: 462 GVAFGMSQTYWEGQIARHIGEYGGDIGFELGMGFSFITYNILR 504

>Kwal_23.5819
          Length = 516

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/517 (64%), Positives = 406/517 (78%), Gaps = 18/517 (3%)

Query: 9   YEIQDLEKRSPVIGSSLENEKKVAASETFTATSEDDQQYIVESSEATKLSWFHKFFASLN 68
           YEIQD+EKR   + S  E              S+DD Q +VES+E TKLS   +  ASL 
Sbjct: 8   YEIQDVEKR---LNSRFE-------------ISDDDSQPVVESTEYTKLSIVDRIAASLR 51

Query: 69  AETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVIIFF 128
           AETKG+EPVTE+EK DDSI NAASMWFSANMVIA+++LG LGP+V+GLNF   VL ++ F
Sbjct: 52  AETKGIEPVTEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLF 111

Query: 129 NIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSAQL 188
           + +G+I VA++SVFGAELGLRQM+LSR+L+GNVTARIF+LIN+IACVGWG VNT  SAQL
Sbjct: 112 SALGVIPVAYYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQL 171

Query: 189 LNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQLSR 248
           L+M+N G G  CP WAGCLII+  T+LVTFFGY VIHAYEKWSW+PNFAVFLVIIA+L  
Sbjct: 172 LHMINPG-GARCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKI 230

Query: 249 SGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSLVAG 308
            G F  GEW+ G   A +VLSFG  IFGFA+GWTTYAADYTVYMP++TNK K+FF+++ G
Sbjct: 231 DGSFSSGEWISGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFG 290

Query: 309 LAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLAL 368
           L FPL F++ILGAA+AMA+ N+  +   +D   +GG+IYAILV NSL+GFGQFCCVLLA+
Sbjct: 291 LMFPLCFSIILGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAM 350

Query: 369 STIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMD 428
           ST+ANNIPNMY++AL  QALW PLAKIPRV WTMAGN  TL I+IPA Y F+ FM NFMD
Sbjct: 351 STVANNIPNMYSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMD 410

Query: 429 SIGYYLAIYIAISCSEHFFYRR-SFSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVALGM 487
           +I YYL+IYI IS SEH F+R+ +F  YN+DDW+ W+ LPIG AG  AL VGA GVA+GM
Sbjct: 411 AIAYYLSIYIGISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYAGCCALFVGAVGVAVGM 470

Query: 488 CQTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILR 524
            QTYW G+I R IG YG DIGFE+G  ++ I+YNILR
Sbjct: 471 EQTYWTGQIARKIGDYGADIGFEIGFCFSVIVYNILR 507

>KLLA0C08283g complement(725563..727122) similar to sp|P17064
           Saccharomyces cerevisiae YER056c FCY2 purine-cytosine
           permease, start by similarity
          Length = 519

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/500 (65%), Positives = 398/500 (79%), Gaps = 1/500 (0%)

Query: 25  LENEKKVAASETFTATSEDDQQYIVESSEATKLSWFHKFFASLNAETKGVEPVTEDEKTD 84
           L + +K   S+T      +++  IVE++E TKLSW     + L+AETKG+EP+T+DEK D
Sbjct: 12  LHDVEKQELSKTQFDEVLEEEPVIVETTEVTKLSWVDHLASKLHAETKGIEPITDDEKDD 71

Query: 85  DSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVIIFFNIMGLIFVAFFSVFGA 144
           D ILNAASMW SAN+VIA+++LG +G  VFGLNFG++VLVI+FF+ +GL+ VAFFSVFGA
Sbjct: 72  DDILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEAVLVIVFFSFLGLLPVAFFSVFGA 131

Query: 145 ELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSAQLLNMVNEGSGHVCPIWA 204
           ELGLRQ++LSR+L+GNVTARIF  IN+IACVGWG VNT  SA LL++VN  SG  CP WA
Sbjct: 132 ELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVNTIASASLLHIVNP-SGPDCPPWA 190

Query: 205 GCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQLSRSGKFKGGEWVGGATTA 264
           GCLIII GT++VTFFGY VIHAYEKWSWVPNFAVFLVIIA+L+++G F  G W  G+TTA
Sbjct: 191 GCLIIIFGTIIVTFFGYRVIHAYEKWSWVPNFAVFLVIIARLAKAGTFTAGSWGSGSTTA 250

Query: 265 GSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSLVAGLAFPLFFTMILGAASA 324
           G VLSFGSS+FGFA GWTTYA+DYTVYMP++TNK K+F ++V GLAFPL F+MILGAA+ 
Sbjct: 251 GGVLSFGSSVFGFATGWTTYASDYTVYMPRTTNKKKVFAAIVLGLAFPLCFSMILGAAAV 310

Query: 325 MAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLALSTIANNIPNMYTVALS 384
                +  W   YDK ++GG+ YAIL+ +SL GFG FCCV+LALSTI+NNIPNMY++AL 
Sbjct: 311 TGTRTNERWAELYDKYSVGGLCYAILIEDSLWGFGSFCCVVLALSTISNNIPNMYSIALG 370

Query: 385 AQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMDSIGYYLAIYIAISCSE 444
            QAL+ PLAK+PRV WT+ GN  TL I+IPA Y F+ FM  FMDSIGYYLAIY AI+ SE
Sbjct: 371 TQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFETFMTTFMDSIGYYLAIYSAIALSE 430

Query: 445 HFFYRRSFSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVALGMCQTYWVGEIGRLIGKYG 504
           HF YR  F  YN+DDWD W+ LPIG AGT AL +GAFGVA GM Q YW G+IGRLIG+ G
Sbjct: 431 HFIYRGGFKGYNVDDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQIYWQGQIGRLIGENG 490

Query: 505 GDIGFELGASWAFIIYNILR 524
           GDIGFELGA +AFI YNI R
Sbjct: 491 GDIGFELGAGFAFITYNIFR 510

>Scas_715.47d1
          Length = 523

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/519 (58%), Positives = 381/519 (73%), Gaps = 15/519 (2%)

Query: 9   YEIQDLEKRSP--VIGSSLENEKKVAASETFTATSEDDQQYIVESSEATKLSWFHKFFAS 66
           ++  DLEK+ P  V   ++ N+           T EDD    V SSEA+ +++  K    
Sbjct: 8   FKTTDLEKQDPAFVANEAISND----------TTGEDDFSKTV-SSEASNIAFLQKIATR 56

Query: 67  LNAETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVII 126
           LNAET+G+EPV +DEKTD +I N   +WFSAN VI++YA+GALGPMVFGLNFG + L I+
Sbjct: 57  LNAETRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIV 116

Query: 127 FFNIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSA 186
           FFNI+G++ VA+FS+FG ELGLRQM+LSRYLVGN+  R FS IN IACVGW ++N+  SA
Sbjct: 117 FFNIIGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSA 176

Query: 187 QLLNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQL 246
           QLLNMVN   GH CP WAG ++++ GT+LVTFFG  VI A+E+WSWVPN AVFLVIIA+L
Sbjct: 177 QLLNMVNL-HGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVIIARL 235

Query: 247 SRSGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSLV 306
            +SG+F GG+W  G TTAG+VLS G   +G+A  W TY+ADYTVYMP++TNK K+FF L 
Sbjct: 236 HKSGQFSGGKWTSGPTTAGNVLSLGCVAYGYAGAWATYSADYTVYMPRNTNKVKLFFGLC 295

Query: 307 AGLAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVLL 366
             L  PL FTMILGAA  M  +N+ TW  YY  N +GG+ Y +LVPNS++GFG+FCCVLL
Sbjct: 296 VALTVPLCFTMILGAAVGMGGVNNATWAKYYSSNGIGGLTYEVLVPNSVHGFGEFCCVLL 355

Query: 367 ALSTIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENF 426
           ALSTIANN PNMYT+  S QA+W PLA++PR   T+ GNAA   +   A YYFD FME F
Sbjct: 356 ALSTIANNTPNMYTLGFSFQAIWEPLARVPRAFCTLFGNAAVFVVGCCACYYFDSFMEKF 415

Query: 427 MDSIGYYLAIYIAISCSEHFFYRR-SFSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVAL 485
           MD++ YY AIYI++  +EH  +R+ SF AY++ DW  +  LPIGIAG     V AFGVAL
Sbjct: 416 MDTLAYYGAIYISLGMAEHLIFRKCSFKAYDVKDWKTFSKLPIGIAGGVGFFVAAFGVAL 475

Query: 486 GMCQTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILR 524
           GMCQ+YWVGEIGR IGK GGD+GFE+GA+W FI Y ++R
Sbjct: 476 GMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVR 514

>Kwal_34.15730
          Length = 518

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/520 (57%), Positives = 391/520 (75%), Gaps = 14/520 (2%)

Query: 6   NNVYEIQDLEKRSPVIGSSLENEKKVAASETFTATSEDDQQYIVESSEATKLSWFHKFFA 65
            + YE+QDLE        ++ +++  +A +    +S+       E      ++  ++   
Sbjct: 3   KDKYEVQDLEL-------NVYSQENTSADDATRGSSQAP-----EKLNGGGMAVLNRLAK 50

Query: 66  SLNAETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVI 125
            L AETKG+EPVTEDEK D SI NAA +WFSANMVIA++++G LGP+VF LNF   V+ I
Sbjct: 51  KLRAETKGIEPVTEDEKDDSSIWNAAFVWFSANMVIAAFSVGMLGPLVFSLNFWGCVVSI 110

Query: 126 IFFNIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVS 185
           + F  +G++ V  +SVFG +L LRQM+LSR+L+GNVTARIF+LINVIAC+GWG+VNT  S
Sbjct: 111 VIFTFIGVLPVCLYSVFGVQLSLRQMVLSRFLLGNVTARIFALINVIACIGWGVVNTVTS 170

Query: 186 AQLLNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQ 245
           AQLL+M+N   G  CP WAGCLII+  T+ VTFFGY VIH + K+SW+PNF VF+VIIA+
Sbjct: 171 AQLLHMINPTGGR-CPPWAGCLIIVFSTIFVTFFGYRVIHTFGKYSWIPNFIVFIVIIAR 229

Query: 246 LSRSGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSL 305
           L   G F  G+W  G+TTAGS+LS G  +FGFA GWTTYAAD+TVYMP++ N+ ++FF++
Sbjct: 230 LKIDGSFSVGKWESGSTTAGSILSLGGIVFGFATGWTTYAADFTVYMPRTVNRAEVFFAV 289

Query: 306 VAGLAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVL 365
           + GL FPL FT+ILGAA+  AALN+P +  +Y+ +  GG++YAILVP SL+GFGQFCCVL
Sbjct: 290 MLGLVFPLCFTIILGAAAGCAALNNPVYHEFYESDHAGGLVYAILVPRSLHGFGQFCCVL 349

Query: 366 LALSTIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMEN 425
           LA+ST+AN +PNMY++AL  QALW PLAK+PRV WT+AGN  TL I+IPA Y F+ FM N
Sbjct: 350 LAMSTVANMVPNMYSIALGTQALWEPLAKVPRVFWTLAGNLITLAIAIPAYYRFEAFMTN 409

Query: 426 FMDSIGYYLAIYIAISCSEHFFYRRS-FSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVA 484
           FMDSI YYL+IYI +S SEHF +R++ FS Y+  +W++W  LP+G AG AAL VGA GVA
Sbjct: 410 FMDSIAYYLSIYIGVSLSEHFIFRQNKFSNYDTSEWNDWHRLPLGYAGCAALFVGAIGVA 469

Query: 485 LGMCQTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILR 524
           LGM QTYW GEIGRLIG++GGDIGFELG +++ I+Y  LR
Sbjct: 470 LGMHQTYWTGEIGRLIGEFGGDIGFELGLAFSMIVYTALR 509

>CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces
           cerevisiae YER060w or sp|P17064 Saccharomyces cerevisiae
           YER056c, hypothetical start
          Length = 540

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/520 (57%), Positives = 383/520 (73%), Gaps = 16/520 (3%)

Query: 5   GNNVYEIQDLEKRSPVIGSSLENEKKVAASETFTATSEDDQQYIVESSEATKLSWFHKFF 64
           GNN YE  DLE +          EK        T T +D+  +     ++  + W  +  
Sbjct: 28  GNNHYE--DLELKDITF-----KEKFNELDNKSTETDKDETCF-----KSPFIIWLKR-- 73

Query: 65  ASLNAETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLV 124
            +LNAETKGVEP+ E+EK D +I  ++ +WFSAN+V+A+Y +G+LGP V+ LNF  SVL 
Sbjct: 74  -TLNAETKGVEPINENEKNDTNIFGSSFVWFSANLVLAAYGVGSLGPTVYHLNFAISVLT 132

Query: 125 IIFFNIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSV 184
           I+FFNI+GL+ V+FFSVFGAELGLRQMI+SRYLVGNVTARIF+ +N I CVGW ++N  +
Sbjct: 133 IVFFNILGLVSVSFFSVFGAELGLRQMIISRYLVGNVTARIFAALNCIGCVGWDVLNIYL 192

Query: 185 SAQLLNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIA 244
           +A+L  ++  G  H+ P+W GC++I+G TV +   GY  IH YEKWSW+PN AVFL+II+
Sbjct: 193 AAKLFAIIKTGGNHL-PLWGGCIVIVGSTVFIAALGYKFIHIYEKWSWIPNLAVFLIIIS 251

Query: 245 QLSRSGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFS 304
           ++  S +F  G W  G+TTAG+VLSFGS+IFG AAGW TY+ADYTVYMP+ TNK++IFF 
Sbjct: 252 RIKISREFSNGPWTSGSTTAGNVLSFGSAIFGSAAGWVTYSADYTVYMPRRTNKFRIFFF 311

Query: 305 LVAGLAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCV 364
              GLAF L FTMI+GAA+ + A+N+  W   Y++  +GGV YA+LVPNSL+GFG+FCCV
Sbjct: 312 NSIGLAFSLIFTMIVGAAAGICAVNNSKWMELYNEFQIGGVTYALLVPNSLHGFGKFCCV 371

Query: 365 LLALSTIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFME 424
           +LA+ST+ANN+P+MYT+ALS QALW PL  +PR +WT+  N   LGISIPA Y+F  FM+
Sbjct: 372 ILAMSTVANNVPSMYTIALSVQALWEPLTSVPRAIWTIFANIVVLGISIPACYFFQSFMQ 431

Query: 425 NFMDSIGYYLAIYIAISCSEHFFYRRSFSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVA 484
           NFM SIGY+ A+YI IS +EH  +RR F  YN++D  NWE LPIG AG  ALIVG+FGVA
Sbjct: 432 NFMGSIGYFYALYIGISLAEHCVFRRKFGNYNVNDHSNWEKLPIGFAGCIALIVGSFGVA 491

Query: 485 LGMCQTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILR 524
           LGM QTYWVGEI R IG YGGDIGFELG SWAF+ Y I+R
Sbjct: 492 LGMAQTYWVGEIARKIGTYGGDIGFELGMSWAFLTYIIIR 531

>ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH]
           complement(551981..553555) [1575 bp, 524 aa]
          Length = 524

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/503 (59%), Positives = 373/503 (74%), Gaps = 8/503 (1%)

Query: 22  GSSLENEKKVAASETFTATSEDDQQYIVESSEATKLSWFHKFFASLNAETKGVEPVTEDE 81
           GS  + EKK    + F + +E+     V+ +E T LSW +++ A LNAETKGV PVTEDE
Sbjct: 21  GSYGDLEKK----KGFLSDAEEPVTPQVDETEYTTLSWVNRWAARLNAETKGVSPVTEDE 76

Query: 82  KTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVIIFFNIMGLIFVAFFSV 141
             D S+LNAASMWFSAN+VIA++A+G L   VF LN  ++VL  + F+ MG++ VAFFSV
Sbjct: 77  CHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVAFFSV 136

Query: 142 FGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSAQLLNMVNEGSGHVCP 201
           FGAE GLRQMILSRYL+GN TARIF LINVIACVGW  VNT  S  LL+M+N  +G  CP
Sbjct: 137 FGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMINP-TGARCP 195

Query: 202 IWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQLSRSGKFKGGEWVGGA 261
            WA  LII+  TV +TFFGY VIHAYEKWSWVPN  VFL+IIA+L+ +G F  G  +GG 
Sbjct: 196 PWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFTAGSSLGGK 255

Query: 262 TTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSLVAGLAFPLFFTMILGA 321
            TAGS LS+GS +FGFA+GWTTYAADYTVYMPK++NKY+IFF ++AGLA PL FT+ILGA
Sbjct: 256 ATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLILGA 315

Query: 322 ASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLALSTIANNIPNMYTV 381
           A+      +PTW  YY K+++GG+ +AIL  N+L GFGQFCCV+LA+ST+ANNIPNMY++
Sbjct: 316 AAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNMYSI 375

Query: 382 ALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMDSIGYYLAIYIAIS 441
           ALS QALW+  A++PRV WT+ GNA +L I+I A Y F+ FM +FMDSIGYYL+IYI I 
Sbjct: 376 ALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYIVIC 435

Query: 442 CSEHFFYRRSFSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVALGMCQTYWVGEIGRLIG 501
            +EHF +R+ F  Y++  WD  + LP G AG AAL VGA GVA+GM   Y+ G I +L  
Sbjct: 436 VTEHFVFRKGFRGYDVSHWDRPDLLPAGYAGCAALCVGAVGVAMGMSHEYYTGPIAKLA- 494

Query: 502 KYGGDIGFELGASWAFIIYNILR 524
             GGDIGF L A ++FI+Y   R
Sbjct: 495 --GGDIGFLLAAGFSFIVYICCR 515

>Scas_715.54d
          Length = 232

 Score =  270 bits (691), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 136/236 (57%), Positives = 173/236 (73%), Gaps = 14/236 (5%)

Query: 9   YEIQDLEKRSP--VIGSSLENEKKVAASETFTATSEDDQQYIVESSEATKLSWFHKFFAS 66
           ++  DLEK+ P  V   ++ N+           TSEDD    V SSEA+ +++  K    
Sbjct: 9   FKTTDLEKQDPAFVANEAISND----------TTSEDDFSKTV-SSEASNIAFLQKIATR 57

Query: 67  LNAETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVII 126
           LNAET+G+EPV +DEKTD +I N   +WFSAN VI++YA+GALGPMVFGLNFG + L I+
Sbjct: 58  LNAETRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIV 117

Query: 127 FFNIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSA 186
           FFNI+G++ VA+FS+FG ELGLRQM+LSRYLVGN+  R FS IN IACVGW ++N+  SA
Sbjct: 118 FFNIIGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSA 177

Query: 187 QLLNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVI 242
           QLLNMVN   GH CP WAG ++++ GT+LVTFFG  VI A+E+WSWVPN AVFLVI
Sbjct: 178 QLLNMVNL-HGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232

>KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, hypothetical start
          Length = 523

 Score =  239 bits (609), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 162/505 (32%), Positives = 248/505 (49%), Gaps = 40/505 (7%)

Query: 53  EATKLSWFHKFFASLNAETKGVEPVTEDEK-TDDSILNAASMWFSANMVIASYALGALGP 111
            A+ +  F     +L  E +G++ +   E+ T     + A +W SA   ++S +   LGP
Sbjct: 17  SASSIRQFSDKLDALGVEARGIQRIQPYERGTAKQFWHVAGLWLSAAGGLSSMSSYFLGP 76

Query: 112 MVFGLNFGQSVLVIIFFNIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINV 171
           MVF L F Q ++  +    +G    A+ SV G + G RQ++ +RYL G    +  +L  +
Sbjct: 77  MVFQLTFNQCLVSGLISMWIGCGVAAYCSVMGPQSGCRQIVTARYLFGWWFVKFIALAAI 136

Query: 172 IACVGWGIVNTSVSAQLLNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWS 231
           +  +GW IVN  V  Q+L  V++G     P+W G +I+   ++LV+ FG   +   E   
Sbjct: 137 VGVMGWSIVNCVVGGQMLASVSDGK---VPLWVGIIIVTVVSLLVSIFGIKQVLKVETLF 193

Query: 232 WVPNFAVFLVIIAQLSRSGKFK-----GGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAA 286
            VP    FL++   +S S KFK         +   T  G  LSF S  +   + W +  A
Sbjct: 194 AVPVLTSFLLL--YISASDKFKYLYEFSNSDIDSLTVKGCWLSFFSLCYSITSTWGSITA 251

Query: 287 DYTVYMPKSTNKYKIFFSLVAGLAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVI 346
           DY +  P+ T + ++F     G A P  F  +LG   A  +L+   W+A YD+  MGG++
Sbjct: 252 DYYILFPEDTPQIQVFLLTFFGTAVPTTFVGVLGLLLASCSLSYEPWQAAYDEYGMGGLM 311

Query: 347 YAILVPNSLNGFGQFCCVLLALSTIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNA 406
            A    +  NGFG+F  V+L LS I+NNI N Y+ A S Q     LAK+PR +W +    
Sbjct: 312 NAGF--SRWNGFGKFLVVVLILSLISNNIVNTYSAAFSIQLSSVMLAKVPRWIWAIGCTI 369

Query: 407 ATLGISIPATYYFDGFMENFMDSIGYYLAIYIAISCSEHFFYR----------------- 449
             L  ++     F   + NF+  IGY++++Y  +   E+  +R                 
Sbjct: 370 FYLVCALVGRNSFSTILGNFLPMIGYWISMYFILLVEENVIFRNWFHHLYKLEFPNDIEV 429

Query: 450 ----------RSFSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVALGMCQTYWVGEIGRL 499
                     R    YN D+WDN E +  G+A +AA  +G  GV LGMCQTY+VG +   
Sbjct: 430 KPHHKLRKLPRHIHRYNWDEWDNSEVITRGLAASAAFCIGVAGVVLGMCQTYYVGPLAAK 489

Query: 500 IGKYGGDIGFELGASWAFIIYNILR 524
           IG+YGGD+G  LG  +A + Y  LR
Sbjct: 490 IGEYGGDLGMWLGMGFAGVSYPPLR 514

>Kwal_47.17216
          Length = 542

 Score =  235 bits (600), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 167/541 (30%), Positives = 253/541 (46%), Gaps = 49/541 (9%)

Query: 25  LENEK--KVAASETFTATSEDDQQYIVESSEATKLSWFHKFFASLNAETKGVEPVTEDEK 82
           +E EK   V  SET  +  E +Q   V      KLS   K   +L  E +G++ +   E+
Sbjct: 1   MEPEKVDDVVFSETEKSRGEGNQT--VFGKVLNKLSVASKRLDALGVEIRGIQRIPAYER 58

Query: 83  -TDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVIIFFNIMGLIFVAFFSV 141
            T    L+ A +W SA   ++S +   LGP++F L F QS++  +    +G    A+ S 
Sbjct: 59  GTSKQFLSVAGLWLSAAGGLSSMSSYFLGPLLFELTFRQSLVSGLVSMAIGCAVAAYLST 118

Query: 142 FGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSAQLLNMVNEGSGHVCP 201
            G + G RQM+ +RYL G    +  SL ++I  +GW IVN  V  Q+L  ++       P
Sbjct: 119 MGPQSGCRQMVTARYLFGWYFVKFVSLASIIGVMGWSIVNCVVGGQMLAAISNSK---IP 175

Query: 202 IWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQLSRS----GKFKGGEW 257
           +W G +I+   + +V  FG   +   E +  VP    FL++    S        FK  + 
Sbjct: 176 LWVGIIIVTAVSFIVAIFGIKQVLRVETFLSVPVLTCFLLLYIAASDKYYLLDTFKNDD- 234

Query: 258 VGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSLVAGLAFPLFFTM 317
           +   T  G+ LSF S  +   + W +  ADY +  P+ T  YK+F     G   P  F  
Sbjct: 235 IDPLTIKGNWLSFFSLCYSITSTWGSITADYYILFPEDTAHYKVFLLTFFGTLIPTTFVG 294

Query: 318 ILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLALSTIANNIPN 377
           +LG   A  A +   WKA Y K  MGG++++       NGFG+FC V+L  S I+NNI N
Sbjct: 295 VLGLILASCAASYEPWKAAYHKYGMGGLLFSGF--ERWNGFGKFCVVVLIFSLISNNIIN 352

Query: 378 MYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMDSIGYYLAIY 437
            Y+ A + Q     +A++PR +W +A     L  ++    +F   + NF+  IGY++++Y
Sbjct: 353 TYSAAFNIQLSSVHMARVPRWLWAIACTIFYLVCALVGRNHFSEILGNFLPMIGYWISMY 412

Query: 438 IAISCSEHFFYRRSFS----------------------------------AYNIDDWDNW 463
             I   E+  +R  F                                   AYN + W+N 
Sbjct: 413 FIILLEENLIFRSHFRHLYTEEFPPHPVEEGESPRALRDIKNKKVSSRKHAYNWEMWNNA 472

Query: 464 EHLPIGIAGTAALIVGAFGVALGMCQTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNIL 523
           E L  G A T A +VG  GVAL M Q YW+G I R  G +GGD+G  +   ++  +Y  L
Sbjct: 473 EVLTHGYAATFAFLVGVGGVALSMAQAYWIGPIARHFGDFGGDLGMWVSMGFSGTVYPAL 532

Query: 524 R 524
           R
Sbjct: 533 R 533

>YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of the
           purine/cytosine permease family of membrane transporters
           [1740 bp, 579 aa]
          Length = 579

 Score =  194 bits (492), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 158/551 (28%), Positives = 255/551 (46%), Gaps = 61/551 (11%)

Query: 28  EKKVAASETFTATSEDDQQYIVESSEATKLSWFHKFFASLNAETKGVEPVTEDEK--TDD 85
           E+  AAS    AT + +    +      + +W  K   ++  E+ G++ ++  E+  +  
Sbjct: 27  EEGTAASSLNIATEKANSSPSILRRIINRAAWLSKKVDAMGVESTGIQRISPYERGTSKK 86

Query: 86  SILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVIIFFNIMGLIFVAFFSVFGAE 145
             L+ A +W SA   ++S +   LGP++FGL+F +SV   +    +G +  A+ S+ G +
Sbjct: 87  QFLHVAGLWLSATGGLSSMSSFLLGPLLFGLSFRESVASSLISVTIGCLIAAYCSIMGPQ 146

Query: 146 LGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSAQLLNMVNEGSGHVCPIWAG 205
            G RQM+ +RYL G    ++ +L ++I  +GW +VN+ V  ++L  +   S    P+W G
Sbjct: 147 SGCRQMVTARYLFGWWFVKLVALASIIGVMGWSVVNSVVGGEMLAAI---SNDKVPLWVG 203

Query: 206 CLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQLSRSGKF------KGGEWVG 259
            +I+   + LV  FG   +   E +  VP    FL++    S    F      KG   + 
Sbjct: 204 IVIVTVCSFLVAIFGIKQVIKVETYLSVPVLTAFLLLYISSSDKYSFVNAYVSKGN--LD 261

Query: 260 GATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSLVAGLAFPLFFTMIL 319
            +T  G+ +SF S  +   A W +  ADY +  P+ T   +IF     G   P  F  IL
Sbjct: 262 SSTRKGNWMSFFSLCYSITATWGSITADYYILFPEDTPYIQIFCLTFFGTFLPTCFVGIL 321

Query: 320 GAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLALSTIANNIPNMY 379
           G   A  A++   W   YD + MGG+++A       NGFG+FC V+L  S ++NNI N Y
Sbjct: 322 GLLLASVAMSYKPWSVEYDSHGMGGLLWAGF--QRWNGFGKFCVVVLVFSLVSNNIINTY 379

Query: 380 TVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMDSIGYYLAIYIA 439
           + A S Q      AKIPR  W++      L  ++    +F   + NF+  IGY++++Y  
Sbjct: 380 SAAFSIQLSSVFCAKIPRWFWSIVCTIICLVCALIGRNHFSTILGNFLPMIGYWISMYFI 439

Query: 440 ISCSEHFFYRRSF----------------------------------------------S 453
           +   E+  +RR F                                               
Sbjct: 440 LLFEENLVFRRFFLHLYTKEFPTVTGEINGPELVGSSKEVEKDAVTNIHLLKRKHKVTKH 499

Query: 454 AYNIDDWDNWEHLPIGIAGTAALIVGAFGVALGMCQTYWVGEIGRLIGKYGGDIGFELGA 513
            YN D W+++E L  G A T A IVG  GV +GM Q YW+G I    G+YGGD+   L  
Sbjct: 500 RYNWDKWEDYEVLTHGYAATFAFIVGVAGVVVGMAQAYWIGPIAAKFGEYGGDVAMWLSM 559

Query: 514 SWAFIIYNILR 524
           +++ ++Y   R
Sbjct: 560 AFSGVVYPPCR 570

>CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, start by similarity
          Length = 631

 Score =  182 bits (462), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 133/447 (29%), Positives = 217/447 (48%), Gaps = 17/447 (3%)

Query: 13  DLEKRSPVIGSSLENEKKVAASETFTATSEDDQQYIVESSEATKLSWFHKFFASLNAETK 72
           DLEKRS    +  ++       + F     D    I     A  L W      S   ET 
Sbjct: 35  DLEKRS-THKTDPDSRTNRRNKKLFDLDRHDPNLNIFMKGLAYLL-WLSDKLDSFGVETS 92

Query: 73  GVEPVTEDEK-TDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVIIFFNIM 131
           G+E V   E+ T    L+ A +W SA   ++S +   LGP++F L+F Q++   +    +
Sbjct: 93  GIERVPPYERGTKKQFLHVAGLWLSATGGLSSMSSFLLGPLLFELSFQQALTSSMISVTV 152

Query: 132 GLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSAQLLNM 191
           G +  A+ S+ G + G RQM+ +RYL G    +  +L  +I  +GW + N+ V  ++L  
Sbjct: 153 GCLVAAYCSIMGPQSGCRQMVTARYLFGWWFVKFVALAAIIGVMGWSVTNSVVGGEMLAA 212

Query: 192 VNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVI-IAQLSRS- 249
           +   S    P+W G +I+   + +V  FG   +   E +  VP    FL++ I+  +R  
Sbjct: 213 I---SNDRVPLWVGIVIVTVCSFVVAIFGIKQVLRIETYISVPVLTSFLLLYISSGNRDY 269

Query: 250 --GKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSLVA 307
              ++K  + V   T  G+ +SF S  +   + W +  ADY +  P+ T  Y++F   +A
Sbjct: 270 LVREYKPID-VPSKTIKGNWISFFSLCYSITSTWGSITADYYILFPEDTPHYQVFLLTLA 328

Query: 308 GLAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLA 367
           G   P  F  ILG   A  A +   +   YD + MGG+++A    +  NGFG+F  V+L 
Sbjct: 329 GTLIPTTFVGILGLTLASIAKSYQPYGEEYDTHGMGGLLWAGF--SRWNGFGKFLVVVLI 386

Query: 368 LSTIANNIPNMYTVALSAQ--ALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMEN 425
           LS I+NNI N Y+ A   Q  A+WA  A++PR  W +      L  ++    +F   + N
Sbjct: 387 LSLISNNIINTYSAAFGIQLSAVWA--ARVPRWFWCIVCTIVYLVCALVGRNHFATILGN 444

Query: 426 FMDSIGYYLAIYIAISCSEHFFYRRSF 452
           F+  IGY++++Y  +   E+  +RR F
Sbjct: 445 FLPMIGYWISMYFILLFEENVIFRRYF 471

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 455 YNIDDWDNWEHLPIGIAGTAALIVGAFGVALGMCQTYWVGEIGR-LIGKYGGDIGFELGA 513
           YN D+WDN + L  G A T A + G  GV +GM QTYWVG I R L G YGGDI   L  
Sbjct: 552 YNWDEWDNPDVLTHGYAATFAFLCGVAGVVVGMAQTYWVGPIARKLGGPYGGDIAMWLSM 611

Query: 514 SWAFIIYNILR 524
            ++ I+Y  LR
Sbjct: 612 GFSGIVYPWLR 622

>Scas_710.30
          Length = 584

 Score =  169 bits (429), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 129/432 (29%), Positives = 211/432 (48%), Gaps = 18/432 (4%)

Query: 29  KKVAASETFTATSEDDQQYIVESSEATKLSWFHKFFASLNAETKGVEPVTEDEK--TDDS 86
           +K+  +ET   T +    Y+        L    K   SL  E  G+E ++  E+      
Sbjct: 7   EKIEVAETEFTTVKKSPSYLRRLLHTANL--LSKKLDSLGVEATGIERISPYERGSKRKQ 64

Query: 87  ILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVIIFFNIMGLIFVAFFSVFGAEL 146
            ++ A  W +A   ++S +   LGP++FGL F +S++  I    +G +  A+ S+ G + 
Sbjct: 65  FIHVAGYWLAATGSLSSMSSFLLGPLLFGLTFNESMVSGIVSMAIGCLVAAYCSIMGPQS 124

Query: 147 GLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSAQLLNMVNEGSGHVCPIWAGC 206
           G RQM+ +RYL G    +  +L  +I  +GW +VN+ V  ++L  +   S    P+W G 
Sbjct: 125 GCRQMVTARYLFGWWFVKFVALAAIIGVMGWSVVNSVVGGEMLASI---SNDKVPLWVGV 181

Query: 207 LIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQLSRSGKFK-----GGEWVGGA 261
           LI+   + LV  FG   +   E +  +P + +F  I+  +S S K+              
Sbjct: 182 LIVTLFSFLVAVFGIKQVLKVETYLSIPVWLMF--ILLYISSSDKYHYIDDFKSPIPDRL 239

Query: 262 TTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSLVAGLAFPLFFTMILGA 321
           T  G+ LSF S  +   A W +  ADY +  P+ T+K+++F     G   P  F  +LG 
Sbjct: 240 TLKGNWLSFFSLCYSITATWGSITADYYILFPEDTSKFQVFMLTFLGTVVPTLFVGVLGL 299

Query: 322 A-SAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLALSTIANNIPNMYT 380
             S +AA  +P W   Y+K  MGG+++A       NGFG+FC V+L LS I+NNI N Y+
Sbjct: 300 CLSTVAATYEP-WNDDYNKYGMGGLLHAGF--KRWNGFGKFCVVVLLLSLISNNIINTYS 356

Query: 381 VALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMDSIGYYLAIYIAI 440
            A S Q      AK+PR  W++      L  ++    +F   + NF+  IGY++++Y  +
Sbjct: 357 AAFSVQLASVKAAKVPRWFWSIVCMIICLVCALVGRNHFSTILGNFLPMIGYWISMYFIL 416

Query: 441 SCSEHFFYRRSF 452
              E+  +R  F
Sbjct: 417 LLEENVIFREYF 428

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 45/83 (54%), Gaps = 3/83 (3%)

Query: 445 HFFYRRSFSA---YNIDDWDNWEHLPIGIAGTAALIVGAFGVALGMCQTYWVGEIGRLIG 501
           H   RR  +    YN + WD+ E L  G A T A + G  GV +GM Q YW+G + R  G
Sbjct: 493 HLLKRRHLATSHKYNWNKWDDPEVLTHGYAATFAFLCGVAGVVVGMAQAYWIGPLARKFG 552

Query: 502 KYGGDIGFELGASWAFIIYNILR 524
           + GGDI   L  +++ ++Y  LR
Sbjct: 553 ETGGDIAMWLSMAFSGLVYPPLR 575

>Scas_701.1
          Length = 68

 Score = 89.4 bits (220), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 48/59 (81%)

Query: 466 LPIGIAGTAALIVGAFGVALGMCQTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILR 524
           LPIGIAG     V AFGVALGMCQ+YWVGEIGR IGK GGD+GFE+GA+W FI Y ++R
Sbjct: 1   LPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVR 59

>Scas_690.1*
          Length = 636

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 48/59 (81%)

Query: 466 LPIGIAGTAALIVGAFGVALGMCQTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILR 524
           LPIGIAG     V AFGVALGMCQ+YWVGEIGR IGK GGD+GFE+GA+W FI Y ++R
Sbjct: 569 LPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVR 627

>KLLA0C14135g complement(1221902..1222717) similar to sp|P53335
           Saccharomyces cerevisiae YGR280c singleton, start by
           similarity
          Length = 271

 Score = 32.0 bits (71), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 13/81 (16%)

Query: 44  DQQYIVESSEATKLSWFHKFFASLNAETKGVEPVTEDEKTDDSILNA------------A 91
           ++Q   +S E T L  F +    LN   + +    + ++TD +I+N             A
Sbjct: 74  EKQDEFDSGECTGLDVFQRLLGRLNGNEQTISDELDKQRTD-NIINGKWGIHFVKGEVLA 132

Query: 92  SMWFSANMVIASYALGALGPM 112
           S W + N  + SY++G   P+
Sbjct: 133 STWDAENKQLISYSMGKKRPV 153

>KLLA0D12716g complement(1084062..1085849) similar to sp|P39709
          Saccharomyces cerevisiae YAL067c SEO1 suppressor of
          sulfoxyde ethionine resistance, start by similarity
          Length = 595

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 27/48 (56%), Gaps = 4/48 (8%)

Query: 18 SPVIGSSL-ENEKKVAASETFTATSEDDQQYIVESSEATKLSWFHKFF 64
          S   GS L E+ KK + S+TF  TS+DD +Y     EA +  W  KFF
Sbjct: 54 SVTTGSELVESGKKSSQSDTFEVTSDDDTEYEYR-DEANRKWW--KFF 98

>KLLA0E05808g complement(520702..522591) similar to sp|P47147
           Saccharomyces cerevisiae YJR110w singleton, start by
           similarity
          Length = 629

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 33  ASETFTATSEDDQQYIVESSEATKLSWFHKFFASLNAETKGVEPVTEDEKT 83
           ++  +   S+D++ +I+   E  K+ W+ + F   +AE  G  P  EDE T
Sbjct: 556 SNPNYREPSDDEEDWILPDWE--KVEWWWQLFGRRDAEMNGPCPTHEDEDT 604

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.138    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,342,547
Number of extensions: 668417
Number of successful extensions: 2423
Number of sequences better than 10.0: 46
Number of HSP's gapped: 2441
Number of HSP's successfully gapped: 50
Length of query: 524
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 418
Effective length of database: 12,926,601
Effective search space: 5403319218
Effective search space used: 5403319218
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)