Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER055C (HIS1)29729315250.0
Scas_715.4729729312611e-177
KLLA0F27489g29729312451e-174
ADL081C29729311351e-158
CAGL0L00759g30630211311e-157
Kwal_23.57792482449891e-136
CAGL0B01573g223119690.82
YMR075W684123700.90
KLLA0D15334g267111671.6
KLLA0A11814g302108653.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER055C
         (293 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER055C (HIS1) [1484] chr5 complement(264891..265784) ATP phosph...   592   0.0  
Scas_715.47                                                           490   e-177
KLLA0F27489g 2544518..2545411 highly similar to sp|P00498 Saccha...   484   e-174
ADL081C [1660] [Homologous to ScYER055C (HIS1) - SH] (540943..54...   441   e-158
CAGL0L00759g 93848..94768 highly similar to sp|P00498 Saccharomy...   440   e-157
Kwal_23.5779                                                          385   e-136
CAGL0B01573g complement(144100..144771) highly similar to tr|Q03...    31   0.82 
YMR075W (YMR075W) [4034] chr13 (413981..416035) Protein containi...    32   0.90 
KLLA0D15334g complement(1300663..1301466) some similarities with...    30   1.6  
KLLA0A11814g 1021526..1022434 highly similar to sp|P20459 Saccha...    30   3.0  

>YER055C (HIS1) [1484] chr5 complement(264891..265784) ATP
           phosphoribosyltransferase, first step in histidine
           biosynthesis pathway [894 bp, 297 aa]
          Length = 297

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/293 (100%), Positives = 293/293 (100%)

Query: 1   MDLVNHLTDRLLFAIPKKGRLYSKSVSILNGADITFHRSQRLDIALSTSLPVALVFLPAA 60
           MDLVNHLTDRLLFAIPKKGRLYSKSVSILNGADITFHRSQRLDIALSTSLPVALVFLPAA
Sbjct: 1   MDLVNHLTDRLLFAIPKKGRLYSKSVSILNGADITFHRSQRLDIALSTSLPVALVFLPAA 60

Query: 61  DIPTFVGEGKCDLGITGVDQVRESNVDVDLAIDLQFGNCKLQVQVPVNGEYKKPEQLIGK 120
           DIPTFVGEGKCDLGITGVDQVRESNVDVDLAIDLQFGNCKLQVQVPVNGEYKKPEQLIGK
Sbjct: 61  DIPTFVGEGKCDLGITGVDQVRESNVDVDLAIDLQFGNCKLQVQVPVNGEYKKPEQLIGK 120

Query: 121 TIVTSFVKLAEKYFADLEGTTVEKMTTRIKFVSGSVEASCALGIGDAIVDLVESGETMRA 180
           TIVTSFVKLAEKYFADLEGTTVEKMTTRIKFVSGSVEASCALGIGDAIVDLVESGETMRA
Sbjct: 121 TIVTSFVKLAEKYFADLEGTTVEKMTTRIKFVSGSVEASCALGIGDAIVDLVESGETMRA 180

Query: 181 AGLVDIATVLSTSAYLIESKNPKSDKSLIATIKSRIEGVMTAQRFVSCIYNAPEDKLPEL 240
           AGLVDIATVLSTSAYLIESKNPKSDKSLIATIKSRIEGVMTAQRFVSCIYNAPEDKLPEL
Sbjct: 181 AGLVDIATVLSTSAYLIESKNPKSDKSLIATIKSRIEGVMTAQRFVSCIYNAPEDKLPEL 240

Query: 241 LKVTPGRRAPTISKIDDEGWVAVSSMIERKTKGVVLDELKRLGASDIMVFEIS 293
           LKVTPGRRAPTISKIDDEGWVAVSSMIERKTKGVVLDELKRLGASDIMVFEIS
Sbjct: 241 LKVTPGRRAPTISKIDDEGWVAVSSMIERKTKGVVLDELKRLGASDIMVFEIS 293

>Scas_715.47
          Length = 297

 Score =  490 bits (1261), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 232/293 (79%), Positives = 262/293 (89%)

Query: 1   MDLVNHLTDRLLFAIPKKGRLYSKSVSILNGADITFHRSQRLDIALSTSLPVALVFLPAA 60
           MDLVNHL DRLLFAIPKKGRLY KSV+ILNG+DI FHRSQRLDIAL T+LP+AL+FLPAA
Sbjct: 1   MDLVNHLNDRLLFAIPKKGRLYEKSVTILNGSDIKFHRSQRLDIALCTTLPIALIFLPAA 60

Query: 61  DIPTFVGEGKCDLGITGVDQVRESNVDVDLAIDLQFGNCKLQVQVPVNGEYKKPEQLIGK 120
           DIP FVGEG+CDLGITGVDQVRE+ +DVDL IDL+FG+CKLQVQVPVNG Y KPEQLIGK
Sbjct: 61  DIPMFVGEGRCDLGITGVDQVREAKMDVDLPIDLKFGSCKLQVQVPVNGPYTKPEQLIGK 120

Query: 121 TIVTSFVKLAEKYFADLEGTTVEKMTTRIKFVSGSVEASCALGIGDAIVDLVESGETMRA 180
           TIV+SF  L E+YFA LEG   EKMTT++K+V GSVEASCALG+ DAIVDLVESGETMRA
Sbjct: 121 TIVSSFTNLTEEYFAKLEGVPAEKMTTKVKYVGGSVEASCALGVADAIVDLVESGETMRA 180

Query: 181 AGLVDIATVLSTSAYLIESKNPKSDKSLIATIKSRIEGVMTAQRFVSCIYNAPEDKLPEL 240
           AGL+DIATVL TSA++IESKNP+SDK LI TIKSRIEGV+TAQR+V C YNAPEDKL +L
Sbjct: 181 AGLIDIATVLETSAHVIESKNPRSDKDLIETIKSRIEGVITAQRYVCCNYNAPEDKLSQL 240

Query: 241 LKVTPGRRAPTISKIDDEGWVAVSSMIERKTKGVVLDELKRLGASDIMVFEIS 293
           L +TPGRR PTISKID +GWVAV+SMIER  KG ++DELK+ GA+DIMVFEIS
Sbjct: 241 LTITPGRRGPTISKIDSDGWVAVNSMIERSKKGEIMDELKKKGAADIMVFEIS 293

>KLLA0F27489g 2544518..2545411 highly similar to sp|P00498
           Saccharomyces cerevisiae YER055c HIS1 ATP
           phosphoribosyltransferase singleton, start by similarity
          Length = 297

 Score =  484 bits (1245), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 232/293 (79%), Positives = 258/293 (88%)

Query: 1   MDLVNHLTDRLLFAIPKKGRLYSKSVSILNGADITFHRSQRLDIALSTSLPVALVFLPAA 60
           MDLVNHL D+LLFAIPKKGRLY KSVSIL G+DI FHRS RLDIA+ST++PVAL+FLPAA
Sbjct: 1   MDLVNHLNDKLLFAIPKKGRLYEKSVSILKGSDIKFHRSARLDIAISTNMPVALIFLPAA 60

Query: 61  DIPTFVGEGKCDLGITGVDQVRESNVDVDLAIDLQFGNCKLQVQVPVNGEYKKPEQLIGK 120
           DIP FVGEG+CDLGITGVDQVRES VDV+L IDLQFG CKLQVQVPV GEY  PEQLIGK
Sbjct: 61  DIPMFVGEGRCDLGITGVDQVRESEVDVNLPIDLQFGTCKLQVQVPVAGEYTSPEQLIGK 120

Query: 121 TIVTSFVKLAEKYFADLEGTTVEKMTTRIKFVSGSVEASCALGIGDAIVDLVESGETMRA 180
           TIV+SFV L +KYFA LEG    +M TR+K+V GSVEASCALG+ DAIVDLVESGETMRA
Sbjct: 121 TIVSSFVNLTKKYFAQLEGVPESEMVTRVKYVGGSVEASCALGVADAIVDLVESGETMRA 180

Query: 181 AGLVDIATVLSTSAYLIESKNPKSDKSLIATIKSRIEGVMTAQRFVSCIYNAPEDKLPEL 240
           AGL  IATVL TSA+LIESKNPK D  L+ TIKSRIEGVMTAQ++VSC YNAPE+KLPEL
Sbjct: 181 AGLTAIATVLDTSAHLIESKNPKGDVELLRTIKSRIEGVMTAQKYVSCSYNAPENKLPEL 240

Query: 241 LKVTPGRRAPTISKIDDEGWVAVSSMIERKTKGVVLDELKRLGASDIMVFEIS 293
           LK+TPGRRAPTIS+I+D GWVAVSSMIERK KG ++D+LK+ GA DIMVFEIS
Sbjct: 241 LKITPGRRAPTISQINDSGWVAVSSMIERKNKGDIMDDLKKNGAEDIMVFEIS 293

>ADL081C [1660] [Homologous to ScYER055C (HIS1) - SH]
           (540943..541836) [894 bp, 297 aa]
          Length = 297

 Score =  441 bits (1135), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 213/293 (72%), Positives = 243/293 (82%)

Query: 1   MDLVNHLTDRLLFAIPKKGRLYSKSVSILNGADITFHRSQRLDIALSTSLPVALVFLPAA 60
           MDLV  L DRLLFA+PKKGRLY KSV++LNGADI FHRS RLDIALSTS PVAL+FLPAA
Sbjct: 1   MDLVRQLNDRLLFAVPKKGRLYEKSVALLNGADILFHRSHRLDIALSTSTPVALIFLPAA 60

Query: 61  DIPTFVGEGKCDLGITGVDQVRESNVDVDLAIDLQFGNCKLQVQVPVNGEYKKPEQLIGK 120
           DIPTFVGEG+CDLGITGVDQVRES V+V+L  DL FG C+LQVQVP  G Y +PEQLIGK
Sbjct: 61  DIPTFVGEGRCDLGITGVDQVRESGVNVELLQDLDFGRCQLQVQVPAGGPYSQPEQLIGK 120

Query: 121 TIVTSFVKLAEKYFADLEGTTVEKMTTRIKFVSGSVEASCALGIGDAIVDLVESGETMRA 180
           TIVTSF +LA +YFA LEG     MTTR+K+V GSVEA+CALG+ DAIVDLVESGETMRA
Sbjct: 121 TIVTSFTRLAREYFARLEGVDEAAMTTRVKYVGGSVEAACALGVADAIVDLVESGETMRA 180

Query: 181 AGLVDIATVLSTSAYLIESKNPKSDKSLIATIKSRIEGVMTAQRFVSCIYNAPEDKLPEL 240
           AGL  I TVLSTSA+LI S NPKS  +L+ T+++RIEGV+ AQ +V C YNA  D LP L
Sbjct: 181 AGLTPIGTVLSTSAHLICSPNPKSSLALLDTVRARIEGVLAAQHYVYCTYNAHADALPAL 240

Query: 241 LKVTPGRRAPTISKIDDEGWVAVSSMIERKTKGVVLDELKRLGASDIMVFEIS 293
           L++TPGRRAPTISK+DD+ W AVSSMI R+ KG +LD+LK  GA DIMVFEIS
Sbjct: 241 LRITPGRRAPTISKLDDDNWYAVSSMIIRREKGRILDDLKASGAEDIMVFEIS 293

>CAGL0L00759g 93848..94768 highly similar to sp|P00498 Saccharomyces
           cerevisiae YER055c HIS1, start by similarity
          Length = 306

 Score =  440 bits (1131), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 216/302 (71%), Positives = 255/302 (84%), Gaps = 9/302 (2%)

Query: 1   MDLVNHLTDRLLFAIPKKGRLYSKSVSILNGADITFHRSQRLDIALSTSLPVALVFLPAA 60
           MD VNHL DRLLFA+PKKGRLY K+  +LNG+DI F+RS RLDIAL T+LP+AL+FLPAA
Sbjct: 1   MDFVNHLNDRLLFAVPKKGRLYEKTKQLLNGSDIKFNRSNRLDIALCTTLPIALIFLPAA 60

Query: 61  DIPTFVGEGKCDLGITGVDQVRESNV-DVDLAIDLQFGNCKLQVQVP-VNGEYKKPEQLI 118
           DIPTFVGEGKCDLGITG+DQV+ES + ++DL +DL FG CKLQVQVP  + +Y  P+QL+
Sbjct: 61  DIPTFVGEGKCDLGITGLDQVKESGIEEIDLLMDLGFGGCKLQVQVPEKDRKYTDPKQLV 120

Query: 119 GKTIVTSFVKLAEKYFADLE----GTTVEKMTTRIKFVSGSVEASCALGIGDAIVDLVES 174
           GKTIV+SFVKL+  YF  LE    G  V+K++T+IK+V GSVEASCALG+GDAIVDLVES
Sbjct: 121 GKTIVSSFVKLSRDYFQQLEEEVLGKPVDKLSTKIKYVGGSVEASCALGVGDAIVDLVES 180

Query: 175 GETMRAAGLVDIATVLSTSAYLIESKNPKSDKS---LIATIKSRIEGVMTAQRFVSCIYN 231
           GETMRAAGL+DIATVL TSAYLI+++ P+ DKS   LI  IKSRI+GV+TAQR+V C YN
Sbjct: 181 GETMRAAGLIDIATVLETSAYLIQARRPQQDKSREELIEVIKSRIQGVLTAQRYVCCSYN 240

Query: 232 APEDKLPELLKVTPGRRAPTISKIDDEGWVAVSSMIERKTKGVVLDELKRLGASDIMVFE 291
            PE  L ELLKVTPGRRAPTISK+DD+GWVAV+SMIERK K  ++DELKR GASDIMVFE
Sbjct: 241 TPEGNLKELLKVTPGRRAPTISKLDDDGWVAVNSMIERKRKADIMDELKRKGASDIMVFE 300

Query: 292 IS 293
           IS
Sbjct: 301 IS 302

>Kwal_23.5779
          Length = 248

 Score =  385 bits (989), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 185/244 (75%), Positives = 215/244 (88%)

Query: 50  LPVALVFLPAADIPTFVGEGKCDLGITGVDQVRESNVDVDLAIDLQFGNCKLQVQVPVNG 109
           +P+AL+FLPAADIP FVGEGKCDLGITGVDQV+ES+VDV L +DL FG+CKLQVQVP  G
Sbjct: 1   MPIALIFLPAADIPMFVGEGKCDLGITGVDQVQESDVDVLLPMDLNFGSCKLQVQVPNAG 60

Query: 110 EYKKPEQLIGKTIVTSFVKLAEKYFADLEGTTVEKMTTRIKFVSGSVEASCALGIGDAIV 169
            Y+KPEQLIGKTIV+SF  L ++YFA LEG  VEK+TT+I++V GSVEASCALGI DAIV
Sbjct: 61  PYEKPEQLIGKTIVSSFTNLTKQYFAKLEGVPVEKITTKIRYVGGSVEASCALGIADAIV 120

Query: 170 DLVESGETMRAAGLVDIATVLSTSAYLIESKNPKSDKSLIATIKSRIEGVMTAQRFVSCI 229
           DLVESGETMRAAGL DIATVL TSA+LIESKNPK D  L+ TIKSRIEGVMTAQ++V+C 
Sbjct: 121 DLVESGETMRAAGLKDIATVLETSAHLIESKNPKGDPELLQTIKSRIEGVMTAQKYVNCN 180

Query: 230 YNAPEDKLPELLKVTPGRRAPTISKIDDEGWVAVSSMIERKTKGVVLDELKRLGASDIMV 289
           YNAP   L ++LK+TPGRRAPTISKIDDEGWVAVS+MI+RK KG ++D+LK+ GA+DIMV
Sbjct: 181 YNAPVTALEKVLKITPGRRAPTISKIDDEGWVAVSAMIDRKQKGTIMDDLKKNGAADIMV 240

Query: 290 FEIS 293
           FEIS
Sbjct: 241 FEIS 244

>CAGL0B01573g complement(144100..144771) highly similar to tr|Q03920
           Saccharomyces cerevisiae YDR140w, start by similarity
          Length = 223

 Score = 31.2 bits (69), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 24/119 (20%), Positives = 49/119 (41%), Gaps = 16/119 (13%)

Query: 153 SGSVEASCALGIGDAIVDLVESGETMRAAGLVDIATVLSTSAYLIESKNPKSD-----KS 207
           S S+   C +G+G  IV       T+ +AG +++   +  + + +ES    +D     KS
Sbjct: 40  SKSLNVVCEIGVGSGIVTTFMMQNTIPSAGHLNLYYAIDVNPWALESTLTTADINNCKKS 99

Query: 208 LIATIKSRIEGVMTAQRFVSCIYNAPEDKLPELLKVTPGRRAPTISK--IDDEGWVAVS 264
            +  +++ +      +     I+N P           P    PTI +   D + W+ ++
Sbjct: 100 YLEPVQADLTSSFRTREIDLLIFNPP---------YVPAEDVPTIPEETDDQDKWLDLA 149

>YMR075W (YMR075W) [4034] chr13 (413981..416035) Protein containing
           a PHD-finger, which may be involved in
           chromatin-mediated transcriptional regulation, has a
           region of weak similarity to a region of PHD zinc finger
           transcription factor (human PF1), which acts as a
           transcriptional corepressor [2055 bp, 684 aa]
          Length = 684

 Score = 31.6 bits (70), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 26/123 (21%), Positives = 53/123 (43%), Gaps = 15/123 (12%)

Query: 30  NGADITFHRSQRLDIALSTSLPVALVFLPAADIPTFVGEG-------KCDLGITG--VDQ 80
           N +++T   S+R      T +P     L   D+ TF+ E        +  +G  G  +++
Sbjct: 140 NNSEMTLVPSKRF-----TQVPKNFQDLNRNDLKTFLTENMTEESNIRSTIGWNGDIINR 194

Query: 81  VRESNVDVDLAIDLQFGNCKLQVQVPVNGEYKKPEQLIGKTIVTSFVKLAEKYFADLEGT 140
            R+   + D   + +  N + ++ +  N  Y    +L G+  + S    +EK F D   +
Sbjct: 195 TRDREPESDRD-NKKLSNIRTKIILSTNATYDSKSKLFGQNSIKSTSNASEKIFRDKNNS 253

Query: 141 TVE 143
           T++
Sbjct: 254 TID 256

>KLLA0D15334g complement(1300663..1301466) some similarities with
           sp|P53262 Saccharomyces cerevisiae YGR106c hypothetical
           protein singleton, hypothetical start
          Length = 267

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 47/111 (42%), Gaps = 4/111 (3%)

Query: 143 EKMTTRIKFVSGSVEASCALGIGDAIVDLVESGETMRAAGLVDIATVLSTSAYLIESKNP 202
           EK      F++   E S    + +  VD ++SG     A L+ I  + ++++ L+  K  
Sbjct: 74  EKHAQTYPFLTALFETSLVTVLEEQNVDALKSG--FDHANLMQINEIPASASDLLRYKFS 131

Query: 203 KSDKSLIATIKSRIEGVMTAQRFVSCIYNAPEDKLPELLKVTPGRRAPTIS 253
            SDK+++         +     F+  +Y   ED L  +  +    R PT S
Sbjct: 132 SSDKAVVVEFTKENYDIAELDDFLQTMYAFMEDSLKNIDNIV--LRVPTSS 180

>KLLA0A11814g 1021526..1022434 highly similar to sp|P20459
           Saccharomyces cerevisiae YJR007w SUI2 translation
           initiation factor eIF2, alpha chain singleton, start by
           similarity
          Length = 302

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 53/108 (49%), Gaps = 3/108 (2%)

Query: 129 LAEKYFADLEGTTVEKMTTRIKFVSGSVEASCALGIG-DAIVDLVESGETMRAAGLVDIA 187
           ++++ F +L+G    ++T +   +   VE SC    G DAI + ++S E +    +    
Sbjct: 161 ISDEIFQELKGQITRRLTPQAVKIRADVEVSCFSYEGIDAIKEALKSAEELSTEQMQIKV 220

Query: 188 TVLSTSAYLIESKNPKSDK--SLIATIKSRIEGVMTAQRFVSCIYNAP 233
            +++   Y+I +++   D+   L+ T  ++IE V+     V  +  AP
Sbjct: 221 KLVAAPLYVITTQSLDKDQGVQLLETAIAKIEEVILKYNGVCNVTMAP 268

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,586,215
Number of extensions: 342681
Number of successful extensions: 898
Number of sequences better than 10.0: 10
Number of HSP's gapped: 894
Number of HSP's successfully gapped: 10
Length of query: 293
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 192
Effective length of database: 13,099,691
Effective search space: 2515140672
Effective search space used: 2515140672
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)