Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER054C (GIP2)54853926520.0
Scas_715.465705338681e-110
CAGL0J02904g5435497806e-97
CAGL0L00803g8275716311e-72
YIL045W (PIG2)5385405538e-64
Scas_704.415821825033e-56
Sklu_2260.63993354871e-55
Kwal_23.57644625364315e-47
ADL083C3543193773e-40
KLLA0F27533g4981012289e-20
YOR178C (GAC1)7931111212e-06
YLR273C (PIG1)6481191051e-04
CAGL0H04037g91535880.013
AGR275C67956860.026
Kwal_56.2326242977721.0
CAGL0F04917g68282711.4
Scas_526.491556702.2
Scas_521.157969682.8
Scas_659.2159436683.0
KLLA0C02519g33947664.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER054C
         (539 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER054C (GIP2) [1483] chr5 complement(262051..263697) Glc7p-inte...  1026   0.0  
Scas_715.46                                                           338   e-110
CAGL0J02904g complement(279516..281147) similar to sp|P40036 Sac...   305   6e-97
CAGL0L00803g 98548..101031 some similarities with sp|P40036 Sacc...   247   1e-72
YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interac...   217   8e-64
Scas_704.41                                                           198   3e-56
Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement       192   1e-55
Kwal_23.5764                                                          170   5e-47
ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C (...   149   3e-40
KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036 Saccha...    92   9e-20
YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulator...    51   2e-06
YLR273C (PIG1) [3666] chr12 complement(689085..691031) Protein t...    45   1e-04
CAGL0H04037g complement(379169..381916) weakly similar to sp|P28...    39   0.013
AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C (...    38   0.026
Kwal_56.23262                                                          32   1.0  
CAGL0F04917g complement(499132..501180) weakly similar to sp|P28...    32   1.4  
Scas_526.4                                                             32   2.2  
Scas_521.1                                                             31   2.8  
Scas_659.21                                                            31   3.0  
KLLA0C02519g complement(225470..226489) similar to sp|P53844 Sac...    30   4.4  

>YER054C (GIP2) [1483] chr5 complement(262051..263697)
           Glc7p-interacting protein, possible regulatory subunit
           for the PP1 family protein phosphatase Glc7p [1647 bp,
           548 aa]
          Length = 548

 Score = 1026 bits (2652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/539 (92%), Positives = 499/539 (92%)

Query: 1   MYIKAEQKPQQFERKNEKLDRNKNQQLPDLETDFKGYRVNSDLYNKERDGSTEETLNSLK 60
           MYIKAEQKPQQFERKNEKLDRNKNQQLPDLETDFKGYRVNSDLYNKERDGSTEETLNSLK
Sbjct: 1   MYIKAEQKPQQFERKNEKLDRNKNQQLPDLETDFKGYRVNSDLYNKERDGSTEETLNSLK 60

Query: 61  FLHKPQRVTQMRANRFPEEEVQRNTDLNKRIFSAGNDENVDNESGWSKIAAAKNHTSVES 120
           FLHKPQRVTQMRANRFPEEEVQRNTDLNKRIFSAGNDENVDNESGWSKIAAAKNHTSVES
Sbjct: 61  FLHKPQRVTQMRANRFPEEEVQRNTDLNKRIFSAGNDENVDNESGWSKIAAAKNHTSVES 120

Query: 121 LNGSTRPPFKIELPPLSPKSTVPKSFQAEYPEAKSPGNDMNFEYDEEILIPFAPPVYXXX 180
           LNGSTRPPFKIELPPLSPKSTVPKSFQAEYPEAKSPGNDMNFEYDEEILIPFAPPVY   
Sbjct: 121 LNGSTRPPFKIELPPLSPKSTVPKSFQAEYPEAKSPGNDMNFEYDEEILIPFAPPVYKKS 180

Query: 181 XXXXXXXXXXXXXXXPTTPGIRSGNGVQARDGSPMLIRSKSVHFDQAAPVKYFAEDESPI 240
                          PTTPGIRSGNGVQARDGSPMLIRSKSVHFDQAAPVKYFAEDESPI
Sbjct: 181 GELLKSSLKRRSKSLPTTPGIRSGNGVQARDGSPMLIRSKSVHFDQAAPVKYFAEDESPI 240

Query: 241 NVNKTEQHDNCLSFKHKPVNLMVDPEEETKMLSSGLETTSIDDDLTTVAPKGFAHPAKIS 300
           NVNKTEQHDNCLSFKHKPVNLMVDPEEETKMLSSGLETTSIDDDLTTVAPKGFAHPAKIS
Sbjct: 241 NVNKTEQHDNCLSFKHKPVNLMVDPEEETKMLSSGLETTSIDDDLTTVAPKGFAHPAKIS 300

Query: 301 NPXXXXXXXXXXLRKSKRFQNLLKNRTDMPPSKSNKKFVNGGGAHEISDRNSKNYHVVGL 360
           NP          LRKSKRFQNLLKNRTDMPPSKSNKKFVNGGGAHEISDRNSKNYHVVGL
Sbjct: 301 NPNNGKGTNNTKLRKSKRFQNLLKNRTDMPPSKSNKKFVNGGGAHEISDRNSKNYHVVGL 360

Query: 361 YSKNFPILSNKNPKSLKLNIFINLSQNKKVFLQELSLYIHRDXXXXXXXXXXXXIPNSHN 420
           YSKNFPILSNKNPKSLKLNIFINLSQNKKVFLQELSLYIHRD            IPNSHN
Sbjct: 361 YSKNFPILSNKNPKSLKLNIFINLSQNKKVFLQELSLYIHRDNNYFSNSSSFYNIPNSHN 420

Query: 421 GNDCNGVAKGYNAGCTRLIAGRILVKNIFYDKRVVVRYTWDSWRTTHEVECVYISDGDGI 480
           GNDCNGVAKGYNAGCTRLIAGRILVKNIFYDKRVVVRYTWDSWRTTHEVECVYISDGDGI
Sbjct: 421 GNDCNGVAKGYNAGCTRLIAGRILVKNIFYDKRVVVRYTWDSWRTTHEVECVYISDGDGI 480

Query: 481 LPGTNMDIFHFIIDDVSKVDPRGKLEFCIHYSTRNDYEREEYWDNNNGNNYKVDVVMDG 539
           LPGTNMDIFHFIIDDVSKVDPRGKLEFCIHYSTRNDYEREEYWDNNNGNNYKVDVVMDG
Sbjct: 481 LPGTNMDIFHFIIDDVSKVDPRGKLEFCIHYSTRNDYEREEYWDNNNGNNYKVDVVMDG 539

>Scas_715.46
          Length = 570

 Score =  338 bits (868), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 213/533 (39%), Positives = 287/533 (53%), Gaps = 104/533 (19%)

Query: 55  TLNSLKFLHKPQRVTQMRANRFPEEEVQRNTDLNK--RIFSAGNDENVDNESGWSKIAAA 112
           +LNS+ FL+KPQRVTQM  ++FPEEEV+RNTDLNK  R+ ++G+    + E+G   ++  
Sbjct: 86  SLNSMDFLYKPQRVTQMNVDKFPEEEVKRNTDLNKNIRLVTSGSVAKDEEETGREYMSP- 144

Query: 113 KNHTSVESLNGSTRPPFKIELPPLSPKSTVPKSFQAEYPEAKSPGNDMNFEYDEEILIPF 172
                             I+LP +SP+ST+  S   E+ +       ++  YD   + P 
Sbjct: 145 ------------------IDLPEISPRSTIQSS---EFIQNNKTQEGVDERYDG--ITPL 181

Query: 173 APPVYXXXXXXXXXXXXXXXXXXPTTPGIRSGNGVQARDGSPMLIRSKSVHFDQAAPVKY 232
           +P +Y                  P+T  I     ++  + +  ++RSKSVHFDQ APVKY
Sbjct: 182 SP-IYKKSGELLKSSLKRRSKSLPSTSEILQ-KSLRFENDAMEMVRSKSVHFDQKAPVKY 239

Query: 233 FAEDESPINVNKTEQHDNCLSFKHKPVNLMVDPEEETKMLSSGLETTSIDDDLTTVAPKG 292
           F EDESP  VN   + DN L+  HKPVN + +  ++       L    +D    T   KG
Sbjct: 240 FREDESPSTVNMMAEFDNLLNLMHKPVNRVFEYGDKE------LAALGLDKVGDTAVNKG 293

Query: 293 FAHPAKISNPXXXXXXXXXXLRKSKRFQNLLKNR----------------TDMPPSKSNK 336
                               LRKSKRFQN++K++                       + K
Sbjct: 294 ----------------AETKLRKSKRFQNVIKDKKKDNDANGNANGNDNDNINDRENNKK 337

Query: 337 KFVNGGGAHEI---SD---------------------RNSKNYHV------VGLYSKNFP 366
           K  N    +EI   SD                      NSK  +V      VGLY+ NFP
Sbjct: 338 KIKNEDSENEIRRVSDAIADNLKINTKKNNKIVTNPYSNSKRMNVITHTKVVGLYNINFP 397

Query: 367 ILSNKNPKSLKLNIFINLSQNKKVFLQELSLYIHRDXXXXXXXXXXXXIPNSHNGNDCNG 426
           ILSNKNPKSLKLNIFI LS++KK FLQE++L+I ++            +P   NG++   
Sbjct: 398 ILSNKNPKSLKLNIFIKLSKDKKCFLQEVTLHIEKENPLKRL------LP--ANGSNSEF 449

Query: 427 VAKGYNAGCTRLIAGRILVKNIFYDKRVVVRYTWDSWRTTHEVECVYISDGDGILPGTNM 486
                    TRLI G+ILVKNIFYDKRV+VRYTW+ WRT H+VEC+++SDGDGI+PGTNM
Sbjct: 450 GQGSIIQRSTRLITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDGDGIVPGTNM 509

Query: 487 DIFHFIIDDVSKVDPRGKLEFCIHYSTRNDYEREEYWDNNNGNNYKVDVVMDG 539
           D+F F+IDD +K++ R KLEFCI Y+ RND ER EYWDNN+G NYKV V+M+G
Sbjct: 510 DVFRFLIDDANKLEARAKLEFCIQYTARNDTERLEYWDNNDGKNYKVGVIMNG 562

>CAGL0J02904g complement(279516..281147) similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2, hypothetical
           start
          Length = 543

 Score =  305 bits (780), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 202/549 (36%), Positives = 274/549 (49%), Gaps = 120/549 (21%)

Query: 56  LNSLKFLHKPQRVTQMRANRFPEEEVQRNTDLNKRIFSAGNDENVDNESGWSKIAAAKNH 115
           L SL+FLHKPQRV+Q+  +RFPEEE+ RNT LNK +     D N    S       A   
Sbjct: 40  LTSLQFLHKPQRVSQLNKDRFPEEELLRNTQLNKNLHQV--DSNYREYSQGPGDGGA--- 94

Query: 116 TSVESLNGSTRPPFKIELPPLSPKSTVPKSFQAEYPEAKSPGNDMNFEYDEEILIPFAPP 175
                   S R   + +L PLSPKST+P+       +     N ++ +     L PF+PP
Sbjct: 95  --------SERQQARDDLIPLSPKSTLPEL------DTNMLDNTLDSDNSSNDLAPFSPP 140

Query: 176 VYXXXXXXXXXXXXXXXXXXPTTPGIRSGNGVQARDGSP--MLIRSKSVHFDQAAPVKYF 233
           VY                  P TPG+ +         SP   L+RSKSVHFDQ APV+YF
Sbjct: 141 VYKKSGEPVKSVLKRRSKSLPGTPGLNT----SMHGASPPNKLMRSKSVHFDQTAPVRYF 196

Query: 234 AEDESPINVNKTEQHDNCLSFKHK------------------PVNLMVDPEEETKMLSSG 275
            E+E PI+V+  + +    ++ ++                     + +D + + ++ +  
Sbjct: 197 NENERPIDVSNADIYQQYGAYLNEYGIEDRRKAGRAGGLSAMMQEMSLDDKTKERLRALE 256

Query: 276 LETTSIDDDL-TTVAPKGFAHPAKISNPXXXXXXXXXXLRKSKRFQNLLK---------- 324
           LE+  +D+   +T+A  G  +                 LRKSKRF  + K          
Sbjct: 257 LESKRVDEGYDSTIAAGGQGNAGP-------------KLRKSKRFHAIKKKDKDNENNKE 303

Query: 325 --------------------------NRTDMPPSK----SNKKFVNGGGAHEISDRNSKN 354
                                     N+ + P S     S     NGG     S    + 
Sbjct: 304 NVSNPNSTPSSANSSSTSLRDMGTAANQGNTPYSNYRTDSGASVSNGGSMFNGSYSGKQQ 363

Query: 355 YHVVGLYSKNFPILSNKNPKSLKLNIFINLSQNKKVFLQELSLYIHRDXXXXXXXXXXXX 414
             VVGLY++NFPILSNKNPKSLKLNIFINLSQ K+VFLQELSL+IHR+            
Sbjct: 364 QRVVGLYNENFPILSNKNPKSLKLNIFINLSQGKEVFLQELSLHIHRERAFYS------- 416

Query: 415 IPNSHNGNDCNGVAKGYNAGC---TRLIAGRILVKNIFYDKRVVVRYTWDSWRTTHEVEC 471
            P S           G + G    TRL++GR+LVKNIF+DKRV++RYTWD WR   +VE 
Sbjct: 417 -PGS-----------GVDIGTPINTRLLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEG 464

Query: 472 VYISDGDGILP-GTNMDIFHFIIDDVSKVDPRGKLEFCIHYSTRNDYEREEYWDNNNGNN 530
           V++S   G++P G  MD+FHF+IDD +K + +  LEFCI Y+TR+D +R E+WDNN G N
Sbjct: 465 VWVSSAQGLVPGGAAMDVFHFVIDDATKWEGKASLEFCIQYTTRDDTQRLEFWDNNCGKN 524

Query: 531 YKVDVVMDG 539
           Y VD+VMDG
Sbjct: 525 YCVDLVMDG 533

>CAGL0L00803g 98548..101031 some similarities with sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 or sp|P40187
           Saccharomyces cerevisiae YIL045w PIG2, hypothetical
           start
          Length = 827

 Score =  247 bits (631), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 192/571 (33%), Positives = 275/571 (48%), Gaps = 84/571 (14%)

Query: 23  KNQQLPDLETDFKGYRVNSDLYNKERDGSTEETLNSLKFLHKPQRVTQMRANRFPE-EEV 81
           K +  PDL T  +  R  S++      G+ +  +NSL FLHKPQRVTQM++  F   EE+
Sbjct: 282 KAETTPDLITGERNIRRTSNVI-----GTGKGRINSLDFLHKPQRVTQMKSEDFISPEEL 336

Query: 82  QRNTDLNKRIFSAG-------NDENVDNESGWSKIAAAKNHTSVESL-NGSTRPPF---- 129
           +RNTD+NK+I  A        ND+  D  +   +I   K+     S+ NGS   P     
Sbjct: 337 KRNTDMNKQILMAKILPDDRINDKIDDITTPEEEITGLKHELGKMSIGNGSANSPAINSI 396

Query: 130 -KIELPPLSPKSTVPKSFQAEYP---EAKSPGNDMNF----EYD----EEILIPFAPPVY 177
              E+  L+   ++  + +  YP    A     D+       YD    E+ ++P  PPVY
Sbjct: 397 KAEEIIELAQDESISPT-EHHYPILNRANQAQQDVCLPLHDSYDQSPVEDHMMPL-PPVY 454

Query: 178 XXXXXXXXXXXXXXXXXXPTTPG----IRSGNGVQARDGSPMLIRSKSVHFDQAAPVKYF 233
                             P TP      ++  GV+  +    LIRSKSVHFDQ  PVKYF
Sbjct: 455 KKSGELVKSSLKRRSKSLPVTPNSNRRTQNSRGVRMNNPRDQLIRSKSVHFDQRLPVKYF 514

Query: 234 AEDESPINVNKTEQHDNCLSFKHKPVNLMVDPEEETKM---LSSGLETTSIDDDLTTVAP 290
            ++ESP  V+  ++ D+ LSF+HKP+   +D     K    L+  LE   +DDD      
Sbjct: 515 FKEESPSVVSIRDEEDDVLSFQHKPLVRSIDRNNGRKKRLDLNRRLEGGFMDDD-----E 569

Query: 291 KGFAHPAKISNPXXXXXXXXXXLRKSKRFQNLLKNRTDMPPSKSNKKFVNGGGAHEISDR 350
            G+ +                 L    R+ +          S+ +  F  G  +  ++DR
Sbjct: 570 DGYPYSYDYDEDDDETTRGGTDL---DRYMDEYDYENGF--SQGDSIFSRGLKSLMMNDR 624

Query: 351 NS--------------------KNYHVVGLYSKNFPILSNKNPKSLKLNIFINLSQNKKV 390
            S                    K   +  L SKNFP L +K  KSLKLNIF+N + +KKV
Sbjct: 625 GSGLKDNFKDPTPPVSQSSTSKKEEKMTTLVSKNFPTLGSKTSKSLKLNIFLNSTSDKKV 684

Query: 391 FLQELSLYIHRDXXXXXXXXXXXXIPNSHNGNDCNGVAKGYNAGCTRLIAGRILVKNIFY 450
            LQE+SL + +               NS+ G    G + G +     +I G +LVKNI++
Sbjct: 685 LLQEVSLNVQKRKSNYY---------NSNFGGPGIGFSTGRDEDDKLIITGTVLVKNIYF 735

Query: 451 DKRVVVRYTWDSWRTTHEVECVYISDGDGILPGTNMDIFHFIIDDV-----SKVDPRGK- 504
           DK+V +RYTWD WR+ +EVE +Y+  G+  LPG+ MDIF F+ID+        V  R + 
Sbjct: 736 DKKVSIRYTWDHWRSCNEVESMYVGSGNNYLPGSQMDIFRFMIDNTVLSNGQYVSNRSRE 795

Query: 505 LEFCIHYSTRNDYEREEYWDNNNGNNYKVDV 535
           LEFCI Y+TR++  REEYWDNNNG NY V++
Sbjct: 796 LEFCIQYTTRSNTAREEYWDNNNGKNYIVEI 826

>YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interacts
           with Gsy2p, possible regulatory subunit for the
           PP1-family protein phosphatase Glc7p [1617 bp, 538 aa]
          Length = 538

 Score =  217 bits (553), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 170/540 (31%), Positives = 250/540 (46%), Gaps = 138/540 (25%)

Query: 56  LNSLKFLHKPQRVTQMRANRFPEEEVQRNTDLNKRIFSAGNDENVDNESGWSKIAAAKNH 115
           LNSL+FLHKP+R++ ++ +R P++E+QRNTD+NK ++  G   +  +    S      +H
Sbjct: 50  LNSLEFLHKPRRLSNVKLHRLPQDELQRNTDMNKGMYFNGKQVHAHHPFINSGANFNAHH 109

Query: 116 TSVESLNGSTRPPFKIELPPLSPKSTVPKSFQAEYPEAKSPGNDMNFEYDEEILIPFAPP 175
             V  L        + E+ PLS       +FQ E  E  +P                +PP
Sbjct: 110 QDVSKLGEE-----EDEISPLS-----HDNFQYESEENGNP----------------SPP 143

Query: 176 VYXXXXXXXXXXXXXXXXXXPTTP-GIRSGNGVQARD------GSPMLIRSKSVHFDQAA 228
           +Y                  P TP  I +  G +++        + +L RSKSVHFD+  
Sbjct: 144 IYKKSGELVKSSLKRRSKSLPITPKSIFNKTGSKSKHVNLDHVDTRLLQRSKSVHFDRVL 203

Query: 229 PVKYFAEDESPINVNKTEQHDNCLSFKHKPVNLMVDPEEETKMLSSGLETTSIDD----- 283
           P+K F E+E PI+V K     + L+FKHKP+  +         L+ G ++  I+D     
Sbjct: 204 PIKLFNENEKPIDVGKQMVQQDVLNFKHKPLTRL-------SALNGGSDSVPIEDLLSEN 256

Query: 284 ------DLTTVAPKGFA--------------------HPAKISNPXXXXXXXXXXLRKSK 317
                 D     PKG                        + I N           +R+  
Sbjct: 257 NQNEYGDTWLQNPKGVFLFGTNSNNRRNKKKKFKLSDDDSDIENDNDSDDAINRLVRQQD 316

Query: 318 R--------FQNLLKN--------RTDMPPSKSNKKFVNGGGAHEISDRNSKNYHVVGLY 361
           +         +NLL N        RT+   S +N  F+  G +  I    +KN+ ++   
Sbjct: 317 KDQAHLAHGLKNLLINDDDDYLETRTNSAKSGAN-LFI--GNSKRIVGLYNKNFPIL--- 370

Query: 362 SKNFPILSNKNPKSLKLNIFINLSQNKKVFLQELSLYIHRDXXXXXXXXXXXXIPNSHNG 421
                  S++N KSLKLNIF+NLS+ + VFLQE++L                 +   HN 
Sbjct: 371 -------SDRNRKSLKLNIFLNLSRGRPVFLQEITL-----------------LTGFHN- 405

Query: 422 NDCNGVAKGYNAGCTRLIAGRILVKNIFYDKRVVVRYTWDSWRTTHEVECVYISDGDGIL 481
                           +I G++ VKNI++DK+++VRYTWD+WRT HE ECVY S+ +GIL
Sbjct: 406 ---------------MVIIGKVFVKNIYFDKKIIVRYTWDAWRTFHESECVYFSNANGIL 450

Query: 482 PGTNMDIFHFIIDDVSKVDPR----GKLEFCIHYSTRN-DYEREEYWDNNNGNNYKVDVV 536
           PG+NMDIF F IDD+   + +     +LEFCI Y T   D  R+EYWDNN+  NYK+DVV
Sbjct: 451 PGSNMDIFKFSIDDIHNPNDKDSNISQLEFCIQYLTWGVDRSRKEYWDNNDSANYKIDVV 510

>Scas_704.41
          Length = 582

 Score =  198 bits (503), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 128/182 (70%), Gaps = 21/182 (11%)

Query: 357 VVGLYSKNFPILSNKNPKSLKLNIFINLSQNKKVFLQELSLYIHRDXXXXXXXXXXXXIP 416
           V+GLYSKNFP L+NKNP+SLKLNIF+N S+ KKVFLQ+L+L+I  D              
Sbjct: 411 VIGLYSKNFPTLNNKNPRSLKLNIFVNYSKGKKVFLQDLNLHIQNDYI------------ 458

Query: 417 NSHNGNDCNGVAKGYNAGCTRLIAGRILVKNIFYDKRVVVRYTWDSWRTTHEVECVYISD 476
           N+H GN         N    + I GR LV+NI++DK+VV++YTWD+WR+  ++E +Y+SD
Sbjct: 459 NNHVGN---------NNKQNKYIIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSD 509

Query: 477 GDGILPGTNMDIFHFIIDDVSKVDPRGKLEFCIHYSTRNDYEREEYWDNNNGNNYKVDVV 536
              I+PG+NMD+F F+IDDV+K   +  LEFCI Y TRN+ ER+E+WDNN+  NYKVDVV
Sbjct: 510 AKQIIPGSNMDVFKFLIDDVNKSVSKCHLEFCIQYQTRNEKERKEFWDNNDDKNYKVDVV 569

Query: 537 MD 538
            +
Sbjct: 570 TE 571

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 69/224 (30%), Positives = 104/224 (46%), Gaps = 31/224 (13%)

Query: 50  GSTEETLNSLKFLHKPQRVTQMRANRFPEEEVQRNTDLNKRIFSAGNDENVDNESGWSKI 109
           GS+ +  +SL FL +P+++ Q++ N  P+EE++RNT+LNK         N++      K 
Sbjct: 91  GSSTKPFSSLNFLQEPRKLDQLKLNALPQEELRRNTNLNK---------NINPIPTPIKP 141

Query: 110 AAAKNHTSVESLNGSTRPPFKIELP---PLSPKSTVPKSFQAEYPEAKSPGNDMNFEYDE 166
              KN      LN +    FK E      +SP + VP + +  +P   +   ++N     
Sbjct: 142 TIYKNSYY---LNDNDTDAFKEEQENEDEISPITQVPANAKIPFPVPNNAYMEVNR---- 194

Query: 167 EILIPFAPPVYXXXXXXXXXXXXXXXXXXPTTPGI-----RSGNG-VQARDGSPMLIRSK 220
                   PVY                  P TP I     R  NG     D +  L RSK
Sbjct: 195 ------IKPVYKKSGELLKPSLKRRSQSLPVTPNISNLNLRRINGHANGNDRAHHLARSK 248

Query: 221 SVHFDQAAPVKYFAEDESPINVNKTEQHDNCLSFKHKPVNLMVD 264
           SVHF    PV++F++DESPI V ++ +  N L+FKHKP+   +D
Sbjct: 249 SVHFANTLPVRFFSKDESPIIVAESHEITNELNFKHKPLQRSMD 292

>Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement
          Length = 399

 Score =  192 bits (487), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 122/335 (36%), Positives = 166/335 (49%), Gaps = 101/335 (30%)

Query: 218 RSKSVHFDQ--AAPVKYFAEDESPINVNKTEQHDNCLSFKHKPVNLMVDPEEETKMLSSG 275
           RSKSVHFDQ     VKYF +DE P+ V + E  ++ LSF  K ++ M             
Sbjct: 137 RSKSVHFDQRDVVSVKYFQKDERPVEVAQREVEEDQLSFTPKQLSFM------------- 183

Query: 276 LETTSIDDDLTTVAPKGFAHPAKISNPXXXXXXXXXXLRKSKRFQNLLKNRTDMPPSKSN 335
                 +  L+   P+    P                LR+SK+   ++            
Sbjct: 184 ------NSWLSNSTPEETKRP----------------LRRSKKHMMMM------------ 209

Query: 336 KKFVNGGGAHEISDRNSKNYHVV-GLYSKNFPILSNKNPKSLKLNIFINLSQNKKVFLQE 394
               NG G    +  +  +   V GLY+KNFPILSNKNP SLKLNIF+N++  K+VFLQ+
Sbjct: 210 ----NGSGPSPATTASGSSMPPVPGLYNKNFPILSNKNPTSLKLNIFLNIAHGKQVFLQD 265

Query: 395 LSLYIHRDXXXXXXXXXXXXIPNSHNGNDCNGVAKGYNAGCTRLIAGRILVKNIFYDKRV 454
           LSL                                    G    + G++LVKNI YDK+V
Sbjct: 266 LSL-----------------------------------LGDGNYVVGKVLVKNICYDKQV 290

Query: 455 VVRYTWDSWRTTHEVECVYISDGDGILPGTNMDIFHFIID--------DVSKVDPRG--- 503
           +VRYTWD W TTH+V+CV+ S GD +LPG NMD+F F++D         ++  DP     
Sbjct: 291 IVRYTWDQWNTTHDVQCVWFSSGDIVLPGMNMDMFKFVVDVPVDSAEATLATTDPDKEGG 350

Query: 504 -KLEFCIHYSTRNDYEREEYWDNNNGNNYKVDVVM 537
            +++FCI Y+TR+   REE+WDNNNG NY V VV+
Sbjct: 351 REVQFCIRYTTRDGNYREEHWDNNNGKNYIVAVVI 385

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 28/39 (71%), Gaps = 1/39 (2%)

Query: 51 STEETLNSLKFLHKPQRVTQMRANRFPEEEVQRNTDLNK 89
          S E    SL FLHKPQRVTQ++   + E+ +QRNT+LN+
Sbjct: 11 SGENKPRSLDFLHKPQRVTQLKT-LYAEDSLQRNTNLNR 48

>Kwal_23.5764
          Length = 462

 Score =  170 bits (431), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 157/536 (29%), Positives = 230/536 (42%), Gaps = 137/536 (25%)

Query: 41  SDLYNKERDGSTEETLNSLKFLHKPQRVTQMRANRFPEEEVQRNTDLNKRIFSAGN---- 96
           SDL  +  +G+   T  SL FLHKPQRVTQ RA  + +E ++RNTD+N+      N    
Sbjct: 8   SDLRREGSNGAF--TDRSLAFLHKPQRVTQPRA-LYADEWLRRNTDMNRGNVKVENCPED 64

Query: 97  --DENVDNESGWSKIAAAKNH----TSVESLNGSTRPPFKIELPPLSPKSTVPKSFQAEY 150
              +N   +    + AA++ +    ++  +  G T  P ++   P  P            
Sbjct: 65  YFSQNFKGDGPTKQTAASEANGFDPSASNASAGDTASPLRVN--PYFPA----------- 111

Query: 151 PEAKSPGNDMNFEYDEEILIPFAPPVYXXXXXXXXXXXXXXXXXXPTTPGIRSGNGVQAR 210
                       E D  +    APP+                    + P   S      R
Sbjct: 112 ------------EEDSVVADAAAPPLVRKKSGEVVRPSLKMAQRSRSLPATPSDREPDKR 159

Query: 211 DGSPMLI---RSKSVHFDQAAPVK--YFAEDESPINVNKTEQHDNCLSFKHKPVNLMVDP 265
            G P      RSKSVHFDQ   VK  YF +++SP++V + +  +  L  +      +V P
Sbjct: 160 LGGPPAAGPKRSKSVHFDQRDVVKFKYFWQEDSPLDVAEQDVLEGPLDDQR--AKTVVGP 217

Query: 266 EEETKMLS-----SGLETTSIDDDLTTVAPKGFAHPAKISNPXXXXXXXXXXLRKSKRFQ 320
               + L+      G +  ++  DLT ++        ++SN           LR+S+R+Q
Sbjct: 218 TSMARDLTVDDDDDGNDDRAVQRDLT-MSLSNLTFERRMSN------TSGGGLRRSRRYQ 270

Query: 321 NLLKNRTDMPPSKSNKKFVNGGGAHEISDRNSKNYHVVGLYSKNFPILSNKNPKSLKLNI 380
            L K +   PP++                         GLY  NF  L++ +  SLK NI
Sbjct: 271 KL-KAQGATPPTRP------------------------GLYHANFATLADDDQCSLKSNI 305

Query: 381 FINLSQNKKVFLQELSLYIHRDXXXXXXXXXXXXIPNSHNGNDCNGVAKGYNAGCTRLIA 440
           F+N++ N   FLQELSL                 I + H                   + 
Sbjct: 306 FLNIAHNSSCFLQELSL-----------------IGDQH------------------YLV 330

Query: 441 GRILVKNIFYDKRVVVRYTWDSWRTTHEVECVYISDGDGILPGTNMDIFHFIID------ 494
           G +LVKN++Y+K V+VRYT DSWRT+ ++ECV+ S GD +LPG +MD F  +ID      
Sbjct: 331 GHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLPGMHMDRFKLVIDLAGLQE 390

Query: 495 -DVSK-----VDPRG--------KLEFCIHYSTRNDYEREEYWDNNNGNNYKVDVV 536
            D S+      D  G        +L+FCI Y +R+   R EYWDNN G NY VDVV
Sbjct: 391 GDTSRDSTPSHDSAGHACQLSTVRLQFCIQYVSRDANSRVEYWDNNAGRNYVVDVV 446

>ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C
           (GIP2) - SH] (537421..538485) [1065 bp, 354 aa]
          Length = 354

 Score =  149 bits (377), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 102/319 (31%), Positives = 140/319 (43%), Gaps = 94/319 (29%)

Query: 218 RSKSVHFD--QAAPVKYFAEDESPINVNKTEQHDNCLSFKHKPVNLMVDPEEETKMLSSG 275
           RSKSVHFD      VKYF  DES + V   +  ++ L  +                    
Sbjct: 126 RSKSVHFDNRDVVSVKYFNSDESTLLVAHAQSFEDQLRLRQ------------------- 166

Query: 276 LETTSIDDDLTTVAPKGFAHPAKISNPXXXXXXXXXXLRKSKRFQNLLKNRTDMPPSKSN 335
                   D   +AP G    A               LRKSK F+     +  + P    
Sbjct: 167 --------DARELAPNGLTLVAPAGGMAGGAKSPRKPLRKSKCFR-----QYQLRP---- 209

Query: 336 KKFVNGGGAHEISDRNSKNYHVVGLYSKNFPILSNKNPKSLKLNIFINLSQNKKVFLQEL 395
                                +  L + NFPIL+NK+P  L LNIF+N++ N+KVFLQ+L
Sbjct: 210 --------------------QLRTLRNVNFPILANKDPAVLTLNIFLNIAYNRKVFLQDL 249

Query: 396 SLYIHRDXXXXXXXXXXXXIPNSHNGNDCNGVAKGYNAGCTRLIAGRILVKNIFYDKRVV 455
           SL                                        ++ GR+LVKNI YDK V+
Sbjct: 250 SL------------------------------------DSMLVMTGRVLVKNIHYDKSVI 273

Query: 456 VRYTWDSWRTTHEVECVYISDGDGILPGTNMDIFHFIIDDVSKVDPRGKLEFCIHYSTRN 515
           VRYTWD+W  T +   V+IS G+ +LPG +MD+F F ID  + V    +LEFCI Y  R+
Sbjct: 274 VRYTWDNWAHTSDTASVWISSGNAVLPGKDMDLFEFAIDVPAPVSGTPRLEFCIRYQVRD 333

Query: 516 DYEREEYWDNNNGNNYKVD 534
           + + + +WDNN+GNNY V+
Sbjct: 334 NSDFQTHWDNNHGNNYVVE 352

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 3/67 (4%)

Query: 41  SDLYNKERDGSTEETLNSLKFLHKPQRVTQMRANRFPEEEVQRNTDLNKRIFSA--GNDE 98
           S++Y K R  S E   +SL  L KPQR++        E  ++RNTD N++        DE
Sbjct: 10  SNIYIKPR-SSQEGKYSSLALLRKPQRISSRTEREEQENILKRNTDYNRKRGGGTWAADE 68

Query: 99  NVDNESG 105
           N+D   G
Sbjct: 69  NIDPLDG 75

>KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 GLC7P-interacting
           protein, hypothetical start
          Length = 498

 Score = 92.4 bits (228), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 67/101 (66%), Gaps = 4/101 (3%)

Query: 438 LIAGRILVKNIFYDKRVVVRYTWDSWRTTHEVECVYISDGDGILPGT---NMDIFHFIID 494
           ++ G ++V+NI Y+KRV+VRYT DSW++  +VE V+I++   +  GT   ++D+F F I 
Sbjct: 396 MLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGAIDIDVFQFAI- 454

Query: 495 DVSKVDPRGKLEFCIHYSTRNDYEREEYWDNNNGNNYKVDV 535
           D+ K++    +E CI Y TR      ++WDNN+G NYKV V
Sbjct: 455 DLGKINTIEHIEMCILYQTREGSSWIDHWDNNSGQNYKVSV 495

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 56 LNSLKFLHKPQRVTQMRANRFPEEEVQRNTDLNK 89
           +SL FL KPQR++         + ++RNTDLNK
Sbjct: 15 FSSLNFLRKPQRISCQVETTAMNDALKRNTDLNK 48

>YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulatory
           subunit for protein serine/threonine phosphatase Glc7p
           [2382 bp, 793 aa]
          Length = 793

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 52/111 (46%), Gaps = 25/111 (22%)

Query: 439 IAGRILVKNIFYDKRVVVRYTWDSWRTTHEVECVYISDGDGILPGTNMDIFHFIID---- 494
           I G + VKN+ ++K + +++T++SWR  H     Y++        +N+D F F ID    
Sbjct: 258 ITGLVYVKNLSFEKYLEIKFTFNSWRDIH-----YVTANFNRTINSNVDEFKFTIDLNSL 312

Query: 495 ----DVSKVDPRGK--------LEFCIHYSTRNDYEREEYWDNNNGNNYKV 533
                + ++    K        +E C  Y    D   E Y+DNNNG NY +
Sbjct: 313 KYILLIKRIITMEKNTSSCPLNIELCCRY----DVNNETYYDNNNGKNYHL 359

>YLR273C (PIG1) [3666] chr12 complement(689085..691031) Protein that
           interacts with Gsy2p, possible regulatory subunit for
           the PP1 family protein phosphatase Glc7p [1947 bp, 648
           aa]
          Length = 648

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 53/119 (44%), Gaps = 24/119 (20%)

Query: 439 IAGRILVKNIFYDKRVVVRYTWDSWRTTHEVECVYISDGDGILPGTNMDIFHFIIDDVS- 497
           I G I V N+ ++K++ +++T ++W   H +   Y      + P  ++D F FIID  + 
Sbjct: 224 IWGLIFVNNLNFEKKIEIKFTLNNWADIHYINAHY---NKSVTP--HVDEFKFIIDISAL 278

Query: 498 -----------------KVDPRGKLEFCIHYSTRNDYEREEYWDNNNGNNYKVDVVMDG 539
                            K      L+FC  Y   N +E   ++DNN+  NY++ + +  
Sbjct: 279 KLNLISKNLIYTNFFERKTTCLLNLQFCCRYDV-NGFEYRSFYDNNDYKNYEITISLSA 336

>CAGL0H04037g complement(379169..381916) weakly similar to sp|P28006
           Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, hypothetical start
          Length = 915

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (68%)

Query: 439 IAGRILVKNIFYDKRVVVRYTWDSWRTTHEVECVY 473
           I G+ILVKN+ Y+K + V+YT+++W   H +   +
Sbjct: 298 IVGKILVKNLNYEKFIEVKYTFNNWNDIHYITAYF 332

>AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C
           (PIG1) - SH] (1254768..1256807) [2040 bp, 679 aa]
          Length = 679

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query: 439 IAGRILVKNIFYDKRVVVRYTWDSWRTTHEVECVYISDGDGILPGTNMDIFHFIID 494
           I G + V N+ ++K + V++++D W+  H V   Y+         + +D F FIID
Sbjct: 286 IKGSLYVTNLHFEKFIEVKFSFDEWKNIHYVTAQYLKT-----VTSKVDEFQFIID 336

>Kwal_56.23262
          Length = 429

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 19/77 (24%)

Query: 429 KGYNAGCTRLIA--------GRILVKNIFYDKRVVVRYTWDSWRTTHEVECVY---ISDG 477
           +G+N    R+ A        G I V N+ ++K + +++T+++WR  H V   +   I+D 
Sbjct: 18  QGHNIKLNRISACLDSKKLQGLIYVANLNFEKSLEIKFTFNNWRDVHYVAAHHHRSITDA 77

Query: 478 DGILPGTNMDIFHFIID 494
                   +D F F ID
Sbjct: 78  --------IDEFKFTID 86

>CAGL0F04917g complement(499132..501180) weakly similar to sp|P28006
           Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, hypothetical start
          Length = 682

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 13/82 (15%)

Query: 436 TRLIAGRILVKNIFYDKRVVVRYTWDSWRTTHEVECVY---ISDGDGILPGTNMDIFHFI 492
           T  + G I V N+ ++K + V++++++W+  H     Y   I+D        ++D F F 
Sbjct: 189 TNKLKGLIYVNNLNFEKFIEVKFSFNNWKDIHYATATYNKSITD--------HIDEFRFT 240

Query: 493 IDDVS-KVDPRGK-LEFCIHYS 512
           ID ++ K   + K L +C  YS
Sbjct: 241 IDVMTFKYILKSKGLIYCDSYS 262

>Scas_526.4
          Length = 915

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 31/56 (55%), Gaps = 5/56 (8%)

Query: 439 IAGRILVKNIFYDKRVVVRYTWDSWRTTHEVECVYISDGDGILPGTNMDIFHFIID 494
           + G I V N+ ++K + ++++++ W+  H     Y++        +N+D F F+ID
Sbjct: 308 LIGLIYVNNLNFEKFIEIKFSFNHWKDIH-----YVTAFLNKSVTSNIDEFKFVID 358

>Scas_521.1
          Length = 579

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 5/69 (7%)

Query: 429 KGYNAGCTRLIAGRILVKNIFYDKRVVVRYTWDSWRTTHEVECVYISDGDGILPGTNMDI 488
           K  N G    + G ILV NI ++K + V++T+++W       C  ++  +  L     D 
Sbjct: 195 KSENDGQAFKLVGLILVNNIQFEKNIEVKFTFNNWENI----CYQVAYFNRSL-NAKFDE 249

Query: 489 FHFIIDDVS 497
           F F ID  S
Sbjct: 250 FKFTIDLTS 258

>Scas_659.21
          Length = 594

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%)

Query: 429 KGYNAGCTRLIAGRILVKNIFYDKRVVVRYTWDSWR 464
           K  N G    + G ILV NI ++K + V++T+++W 
Sbjct: 213 KSENDGQAFKLVGLILVNNIQFEKNIEVKFTFNNWE 248

>KLLA0C02519g complement(225470..226489) similar to sp|P53844
           Saccharomyces cerevisiae YNL264c PDR17 involved in
           regulating phosphatidylserine metabolism, start by
           similarity
          Length = 339

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 22/47 (46%), Gaps = 5/47 (10%)

Query: 106 WSKIAAAKNHTSVESLNGSTRPPFKIELPPLSPKSTVPKSFQAEYPE 152
           W+ I   KNH      NG TR  +  E PPLS    V   FQ  YPE
Sbjct: 196 WTLIIDLKNH---HIDNGGTRSLY--EYPPLSLAKQVINIFQDHYPE 237

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.133    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,853,600
Number of extensions: 868088
Number of successful extensions: 2339
Number of sequences better than 10.0: 42
Number of HSP's gapped: 2353
Number of HSP's successfully gapped: 56
Length of query: 539
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 433
Effective length of database: 12,926,601
Effective search space: 5597218233
Effective search space used: 5597218233
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)