Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER053C-A37371914e-22
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER053C-A
         (37 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER053C-A (YER053C-A) [1482] chr5 complement(260932..261045) Pro...    78   4e-22

>YER053C-A (YER053C-A) [1482] chr5 complement(260932..261045)
          Protein possibly involved in tolerance of high salt,
          osmotic stress, and low temperature conditions [114 bp,
          37 aa]
          Length = 37

 Score = 78.2 bits (191), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%)

Query: 1  MQDLEIFLSIFAFIFVFYFGAHRTVMNRNKSDVPYLQ 37
          MQDLEIFLSIFAFIFVFYFGAHRTVMNRNKSDVPYLQ
Sbjct: 1  MQDLEIFLSIFAFIFVFYFGAHRTVMNRNKSDVPYLQ 37

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.338    0.148    0.448 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 1,100,995
Number of extensions: 21242
Number of successful extensions: 82
Number of sequences better than 10.0: 1
Number of HSP's gapped: 82
Number of HSP's successfully gapped: 1
Length of query: 37
Length of database: 16,596,109
Length adjustment: 11
Effective length of query: 26
Effective length of database: 16,215,311
Effective search space: 421598086
Effective search space used: 421598086
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.8 bits)
S2: 54 (25.4 bits)