Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER053C30029615810.0
Scas_715.4530530411951e-166
Sklu_2260.530230011421e-159
Kwal_23.575730729210361e-142
CAGL0F00231g3073015672e-71
Scas_673.173143015602e-70
YJR077C (MIR1)3112945491e-68
Sklu_1119.13072915482e-68
Kwal_33.155973052945438e-68
KLLA0B14454g3052915151e-63
AER450C3082915072e-62
Sklu_2359.69022852093e-18
Kwal_47.173218812831872e-15
CAGL0K02365g9192811872e-15
YMR166C3683021842e-15
YPR021C (AGC1)9022841828e-15
Scas_379.23012871735e-14
KLLA0E13453g9062851731e-13
Sklu_2432.52882781682e-13
ADL049W9122791704e-13
CAGL0L05742g3052931665e-13
YJL133W (MRS3)3142801648e-13
KLLA0E18810g3772681632e-12
Sklu_2127.52782451602e-12
KLLA0E02772g2842661584e-12
CAGL0G01166g2952571585e-12
Scas_716.293161901576e-12
YKR052C (MRS4)3042921577e-12
CAGL0F07711g3682451552e-11
Scas_702.103022821542e-11
Kwal_26.86692962581532e-11
YLR348C (DIC1)2982791514e-11
ADL009W3792811524e-11
Scas_669.63733081515e-11
Sklu_2334.23192791505e-11
Sklu_1149.22962771497e-11
ACR109W2992571489e-11
YGR257C (MTM1)3662501491e-10
Scas_645.93912501491e-10
Scas_602.88852891501e-10
Kwal_23.47313143051471e-10
Sklu_2037.23103101462e-10
CAGL0K08250g2972951462e-10
Scas_582.73292901462e-10
KLLA0D07073g2972561452e-10
CAGL0G08910g2892961443e-10
CAGL0F08305g3742611453e-10
CAGL0L02079g2972971434e-10
Scas_691.43342961426e-10
YOR222W (ODC2)3072901426e-10
Scas_589.103161881401e-09
YJR095W (SFC1)3222831401e-09
KLLA0D09889g3642941392e-09
Kwal_23.39653071851382e-09
YNL003C (PET8)2842661382e-09
AGL311C3622811382e-09
KLLA0F03212g3052741363e-09
Kwal_26.79672972661364e-09
YBR291C (CTP1)2992691354e-09
YGR096W (TPC1)3141871355e-09
KLLA0A09383g3662581365e-09
AFL196W3612941347e-09
Kwal_33.140503142811347e-09
AFR131C3442981348e-09
Scas_640.253062631339e-09
Kwal_23.29133202811331e-08
Kwal_23.43543432591331e-08
YPL134C (ODC1)3102661311e-08
Kwal_23.35293952951312e-08
Scas_709.93651821302e-08
CAGL0H03839g2822561283e-08
YIL006W3731861284e-08
CAGL0B04543g3171761267e-08
Scas_632.92922501258e-08
CAGL0M09020g3482531268e-08
Kwal_47.182163333051251e-07
KLLA0E15532g3262991241e-07
CAGL0K02915g3423341232e-07
Scas_697.473282631222e-07
Kwal_0.2322742741212e-07
Scas_562.123001911213e-07
Kwal_33.154463051851213e-07
KLLA0F04697g3073051204e-07
CAGL0J09790g3001911196e-07
KLLA0F17864g3071961196e-07
KLLA0E23705g3681961196e-07
Kwal_14.22103153061188e-07
Kwal_55.208683803171188e-07
ACR260W3112791179e-07
Scas_578.3*5242981181e-06
ABL023W3091741161e-06
Sklu_2363.23233171161e-06
Sklu_2430.103241991161e-06
KLLA0E09680g3072471161e-06
Scas_558.22892741151e-06
CAGL0M05225g3811881162e-06
Kwal_47.192282812571142e-06
KLLA0F13464g3001921142e-06
CAGL0K11616g3202861152e-06
Scas_718.53242911152e-06
CAGL0J01661g3273191152e-06
KLLA0B12826g3191861142e-06
Kwal_26.79723582931142e-06
Scas_721.1293231991133e-06
YDL198C (YHM1)3001911133e-06
YIL134W (FLX1)3113081133e-06
YOR130C (ORT1)2921881123e-06
Kwal_27.120813691931124e-06
YPR011C3263161115e-06
CAGL0J04114g3032821115e-06
Kwal_27.116262991921107e-06
Sklu_2442.82752661107e-06
Scas_667.223062481107e-06
YHR002W (LEU5)3571441107e-06
Scas_662.123081891098e-06
Kwal_55.213353172611091e-05
KLLA0D15015g3172741091e-05
YEL006W3351811091e-05
CAGL0C02013g3291601091e-05
CAGL0K10362g3011791081e-05
Sklu_2374.75132501091e-05
Scas_717.203563491072e-05
AGL047C3163181072e-05
YBR192W (RIM2)3771851072e-05
Sklu_2431.53702901072e-05
AEL253W3651961062e-05
YPR058W (YMC1)3072461062e-05
CAGL0J02002g3611811063e-05
KLLA0C13431g3282681063e-05
Kwal_26.76533251711053e-05
AFR146W2811821053e-05
CAGL0J05522g5192911063e-05
KLLA0D04950g2742751043e-05
KLLA0B11319g3552361044e-05
Scas_705.93232791045e-05
Kwal_23.30425422461045e-05
AFR253W3441181036e-05
CAGL0G03135g3072491026e-05
AGR383W2932741027e-05
CAGL0H10538g2971921027e-05
KLLA0E18788g3813241029e-05
CAGL0K12210g3112551011e-04
YOR100C (CRC1)3271951011e-04
Sklu_2194.33121301011e-04
Sklu_2117.22982821001e-04
Sklu_2435.23443011001e-04
AER419W4932751011e-04
YKL120W (OAC1)324312992e-04
AGL065C335132992e-04
Kwal_55.21106328283982e-04
Sklu_2433.8420119992e-04
Sklu_2075.3345185982e-04
ADL264C329191973e-04
YFR045W285165973e-04
YNL083W545250983e-04
CAGL0D01606g305264964e-04
CAGL0D04774g322283964e-04
Scas_687.15*328135965e-04
KLLA0C11363g517249965e-04
AAL014C271252946e-04
Scas_714.18305183948e-04
AGR191W298191948e-04
Scas_671.1*12370890.001
YBR104W (YMC2)329285920.001
AFR542W310150920.001
Sklu_1275.1311198920.001
KLLA0E08877g294195910.002
Kwal_33.1298830366910.002
Sklu_2115.4299287910.002
Sklu_1926.2305169900.002
Kwal_34.15907312151900.002
YDL119C30772890.003
Kwal_56.23011303174870.005
KLLA0F08547g308130870.005
YMR241W (YHM2)314129870.006
CAGL0B03883g306263870.006
Kwal_27.1141929859860.006
KLLA0D14036g431195870.006
Scas_696.9312129860.007
KLLA0E12353g30576860.007
Kwal_27.1248130477860.008
CAGL0K07436g307120860.008
Kwal_27.12599304164850.008
YMR056C (AAC1)309196850.009
Scas_721.27374165850.009
AER184W30577850.009
AGL064W296269840.013
AAR036W317181840.015
Sklu_2398.4309177830.017
Scas_489.4297174800.038
KLLA0A00979g343134800.046
KLLA0D04290g18891760.079
YBR085W (AAC3)307200770.10
AER366W293287750.14
CAGL0F04213g306197750.19
YBL030C (PET9)318197700.63
Scas_718.2433788681.3
KLLA0B08503g30348619.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER053C
         (296 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...   613   0.0  
Scas_715.45                                                           464   e-166
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement        444   e-159
Kwal_23.5757                                                          403   e-142
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...   223   2e-71
Scas_673.17                                                           220   2e-70
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...   216   1e-68
Sklu_1119.1 YJR077C, Contig c1119 366-1289                            215   2e-68
Kwal_33.15597                                                         213   8e-68
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...   202   1e-63
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...   199   2e-62
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          85   3e-18
Kwal_47.17321                                                          77   2e-15
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    77   2e-15
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    75   2e-15
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    75   8e-15
Scas_379.2                                                             71   5e-14
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    71   1e-13
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       69   2e-13
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    70   4e-13
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    69   5e-13
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    68   8e-13
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    67   2e-12
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         66   2e-12
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    65   4e-12
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    65   5e-12
Scas_716.29                                                            65   6e-12
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    65   7e-12
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    64   2e-11
Scas_702.10                                                            64   2e-11
Kwal_26.8669                                                           64   2e-11
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    63   4e-11
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    63   4e-11
Scas_669.6                                                             63   5e-11
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         62   5e-11
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         62   7e-11
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    62   9e-11
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    62   1e-10
Scas_645.9                                                             62   1e-10
Scas_602.8                                                             62   1e-10
Kwal_23.4731                                                           61   1e-10
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         61   2e-10
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    61   2e-10
Scas_582.7                                                             61   2e-10
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    60   2e-10
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    60   3e-10
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    60   3e-10
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    60   4e-10
Scas_691.4                                                             59   6e-10
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    59   6e-10
Scas_589.10                                                            59   1e-09
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    59   1e-09
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    58   2e-09
Kwal_23.3965                                                           58   2e-09
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    58   2e-09
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    58   2e-09
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    57   3e-09
Kwal_26.7967                                                           57   4e-09
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    57   4e-09
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    57   5e-09
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    57   5e-09
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    56   7e-09
Kwal_33.14050                                                          56   7e-09
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    56   8e-09
Scas_640.25                                                            56   9e-09
Kwal_23.2913                                                           56   1e-08
Kwal_23.4354                                                           56   1e-08
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    55   1e-08
Kwal_23.3529                                                           55   2e-08
Scas_709.9                                                             55   2e-08
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    54   3e-08
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    54   4e-08
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    53   7e-08
Scas_632.9                                                             53   8e-08
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    53   8e-08
Kwal_47.18216                                                          53   1e-07
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    52   1e-07
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    52   2e-07
Scas_697.47                                                            52   2e-07
Kwal_0.232                                                             51   2e-07
Scas_562.12                                                            51   3e-07
Kwal_33.15446                                                          51   3e-07
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    51   4e-07
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    50   6e-07
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    50   6e-07
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    50   6e-07
Kwal_14.2210                                                           50   8e-07
Kwal_55.20868                                                          50   8e-07
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    50   9e-07
Scas_578.3*                                                            50   1e-06
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    49   1e-06
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          49   1e-06
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         49   1e-06
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    49   1e-06
Scas_558.2                                                             49   1e-06
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    49   2e-06
Kwal_47.19228                                                          49   2e-06
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    49   2e-06
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    49   2e-06
Scas_718.5                                                             49   2e-06
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    49   2e-06
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    49   2e-06
Kwal_26.7972                                                           49   2e-06
Scas_721.129                                                           48   3e-06
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    48   3e-06
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    48   3e-06
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    48   3e-06
Kwal_27.12081                                                          48   4e-06
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    47   5e-06
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    47   5e-06
Kwal_27.11626                                                          47   7e-06
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          47   7e-06
Scas_667.22                                                            47   7e-06
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    47   7e-06
Scas_662.12                                                            47   8e-06
Kwal_55.21335                                                          47   1e-05
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    47   1e-05
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    47   1e-05
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    47   1e-05
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    46   1e-05
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       47   1e-05
Scas_717.20                                                            46   2e-05
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    46   2e-05
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    46   2e-05
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            46   2e-05
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    45   2e-05
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    45   2e-05
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    45   3e-05
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    45   3e-05
Kwal_26.7653                                                           45   3e-05
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    45   3e-05
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    45   3e-05
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    45   3e-05
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    45   4e-05
Scas_705.9                                                             45   5e-05
Kwal_23.3042                                                           45   5e-05
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    44   6e-05
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    44   6e-05
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    44   7e-05
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    44   7e-05
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    44   9e-05
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    44   1e-04
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    44   1e-04
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            44   1e-04
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            43   1e-04
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         43   1e-04
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    44   1e-04
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    43   2e-04
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    43   2e-04
Kwal_55.21106                                                          42   2e-04
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       43   2e-04
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                42   2e-04
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    42   3e-04
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    42   3e-04
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    42   3e-04
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    42   4e-04
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    42   4e-04
Scas_687.15*                                                           42   5e-04
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    42   5e-04
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    41   6e-04
Scas_714.18                                                            41   8e-04
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    41   8e-04
Scas_671.1*                                                            39   0.001
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    40   0.001
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    40   0.001
Sklu_1275.1 , Contig c1275 314-1249                                    40   0.001
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    40   0.002
Kwal_33.12988                                                          40   0.002
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            40   0.002
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          39   0.002
Kwal_34.15907                                                          39   0.002
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    39   0.003
Kwal_56.23011                                                          38   0.005
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    38   0.005
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    38   0.006
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    38   0.006
Kwal_27.11419                                                          38   0.006
KLLA0D14036g complement(1203522..1204817) some similarities with...    38   0.006
Scas_696.9                                                             38   0.007
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    38   0.007
Kwal_27.12481                                                          38   0.008
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    38   0.008
Kwal_27.12599                                                          37   0.008
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    37   0.009
Scas_721.27                                                            37   0.009
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    37   0.009
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    37   0.013
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    37   0.015
Sklu_2398.4 , Contig c2398 9476-10405                                  37   0.017
Scas_489.4                                                             35   0.038
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    35   0.046
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    34   0.079
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    34   0.10 
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    33   0.14 
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    33   0.19 
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    32   0.63 
Scas_718.24                                                            31   1.3  
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    28   9.6  

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/296 (100%), Positives = 296/296 (100%)

Query: 1   MESNKQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGF 60
           MESNKQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGF
Sbjct: 1   MESNKQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGF 60

Query: 61  RKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAE 120
           RKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAE
Sbjct: 61  RKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAE 120

Query: 121 FLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYT 180
           FLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYT
Sbjct: 121 FLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYT 180

Query: 181 MCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKIN 240
           MCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKIN
Sbjct: 181 MCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKIN 240

Query: 241 SERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVGL 296
           SERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVGL
Sbjct: 241 SERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVGL 296

>Scas_715.45
          Length = 305

 Score =  464 bits (1195), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 224/304 (73%), Positives = 254/304 (83%), Gaps = 11/304 (3%)

Query: 1   MESNKQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGF 60
           M   K P  I+LYTKE+YA CTLGGI+ACGPTHSS+TPLDL+KCRLQV+P LY SN  G 
Sbjct: 1   MSKTKSP--IELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGI 58

Query: 61  RKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPG--------VTVY 112
            +I+  EG  K++TG GAT +GYSLQGAGKYGGYE FK LYS+ L            ++Y
Sbjct: 59  IQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIY 118

Query: 113 LMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPL 172
           L++SATAEF ADIMLCPFEAIKVKQQTTMPP+CNNV++GWKKMYA+ G +  FYKGI PL
Sbjct: 119 LLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEG-LNGFYKGITPL 177

Query: 173 WCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPA 232
           WCRQIPYTMCKFTSFE+IV+ IY+ LP KK EM+ALQQISVSFVGGY+AGILCA VSHPA
Sbjct: 178 WCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPA 237

Query: 233 DVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKA 292
           DVMVSKIN+ERK NESM+VA KRIY +IGF GLWNGL VRI+MIGTLTSFQWLIYDSFKA
Sbjct: 238 DVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKA 297

Query: 293 YVGL 296
           YVGL
Sbjct: 298 YVGL 301

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score =  444 bits (1142), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 214/300 (71%), Positives = 247/300 (82%), Gaps = 9/300 (3%)

Query: 3   SNKQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRK 62
           S KQP  I L++ E+YA CTLGG++ACGPTHSS+TPLDLVKCRLQVNP+LY SNL G++ 
Sbjct: 2   STKQP--IPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKT 59

Query: 63  IIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT------VYLMAS 116
           I+ +EG  KV+TG GATF+GYSLQGA KYGGYEYFK  YS+ LSP         VYL AS
Sbjct: 60  IVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCAS 119

Query: 117 ATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQ 176
           A+AEFLADI+LCP+EAIKVKQQTT+PPFC N ++GW K+ A  G +   YKGI PLWCRQ
Sbjct: 120 ASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEG-LSGLYKGITPLWCRQ 178

Query: 177 IPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMV 236
           IPYTMCKFTSFE+IV+ IY+ LP+ K+EM+  QQI VSFVGGYLAGILCA VSHPADVMV
Sbjct: 179 IPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMV 238

Query: 237 SKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVGL 296
           SK+N++RK  ESM  ASKRIY +IGF GLWNGL VRI MIGTLTSFQWLIYDSFKAY+GL
Sbjct: 239 SKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGL 298

>Kwal_23.5757
          Length = 307

 Score =  403 bits (1036), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 196/292 (67%), Positives = 229/292 (78%), Gaps = 8/292 (2%)

Query: 12  LYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKK 71
           LY+ E+YA CTLGG++ACGPTHS++TPLDLVKCR QV+  LY SNL G+R+I+ +EG  K
Sbjct: 13  LYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATK 72

Query: 72  VYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT------VYLMASATAEFLADI 125
           V+TG GAT +GYSLQGA KYGGYE+FKH YS  +SP         ++L ASA+AEF+ADI
Sbjct: 73  VFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADI 132

Query: 126 MLCPFEAIKVKQQTTMPP-FCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKF 184
            LCP+EAIKV+QQT +PP F  NV D + KM    G   + YKGI PLW RQIPYTMCKF
Sbjct: 133 FLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEG-FASLYKGITPLWFRQIPYTMCKF 191

Query: 185 TSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERK 244
           TSFE+IV+ IY+ LP  K EM+ L QISVSF GGYLAGILCA VSHPADVMVSK+N+ERK
Sbjct: 192 TSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERK 251

Query: 245 ANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVGL 296
           + ES   A+ RIY KIGF GLWNGL VRI+MIGTLTSFQWLIYDSFKA  GL
Sbjct: 252 SGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAAAGL 303

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score =  223 bits (567), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 121/301 (40%), Positives = 179/301 (59%), Gaps = 15/301 (4%)

Query: 3   SNKQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQG-FR 61
           SN+ P+    Y+   YA   L G I CG THSS+ P+D+VK R+Q+ P +Y   + G FR
Sbjct: 2   SNQLPQ----YSYSDYAKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFR 57

Query: 62  KIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGV------TVYLMA 115
           KIIA EG   + TGFG T +GYS+QGA K+GGYE FK  +   L          +VY+ +
Sbjct: 58  KIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGS 117

Query: 116 SATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCR 175
           +A AEFLADI LCP EA +++   + P F N +V G+ ++  E  G+ +FY G  P+  +
Sbjct: 118 AAAAEFLADIALCPLEATRIR-LVSQPTFANGLVGGFSRILKEE-GVGSFYSGFTPILFK 175

Query: 176 QIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVM 235
           QIPY + KF  FE+  +  +S+ P  K+ ++     +++ + G  AG+  A VS PAD +
Sbjct: 176 QIPYNIAKFLVFERASELYFSLAP-PKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTL 234

Query: 236 VSKINSERKANESMSVASK-RIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
           +SK+N   KA    +V    ++ +++GF G + GL  R+VM+GTLTS Q+ IY   K  +
Sbjct: 235 LSKVNKTSKAPGQSTVGLLFQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYGQLKKSL 294

Query: 295 G 295
           G
Sbjct: 295 G 295

>Scas_673.17
          Length = 314

 Score =  220 bits (560), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 117/301 (38%), Positives = 177/301 (58%), Gaps = 11/301 (3%)

Query: 3   SNKQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQG-FR 61
           +     KI  Y    Y    L G I CG THSS+ P+D+VK R+Q+ P +Y   + G F+
Sbjct: 5   TTTDAHKIPDYAASDYFKFALAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNKGMVGSFK 64

Query: 62  KIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHL------YSSWLSPGVTVYLMA 115
           KIIA+EG   + TGFG T +GYS+QGA K+GGYE FK L      Y + +    +VY+ +
Sbjct: 65  KIIADEGAGALLTGFGPTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGS 124

Query: 116 SATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCR 175
           +A AEFLADI LCP EA +++   + P F N +V G+ ++  E  G+ +FY G  P+  +
Sbjct: 125 AAVAEFLADIALCPLEATRIR-LVSQPTFANGLVGGFSRILKEE-GVGSFYSGFTPILFK 182

Query: 176 QIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVM 235
           QIPY + KF  FE+  +  Y ++   KE ++ +    ++ + G  AG   A VS PAD +
Sbjct: 183 QIPYNIAKFLVFERASEVYYGIV-GAKETLSDMTNTGINLLSGLTAGFAAAFVSQPADTL 241

Query: 236 VSKINSERKANESMSVA-SKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
           +SK+N  +KA    ++    ++ +++G  G + GL  R++M+GTLTS Q+ IY S K  +
Sbjct: 242 LSKVNKTKKAPGQSTIGLLAQLAKQLGVIGSFAGLPTRLIMVGTLTSLQFAIYGSLKNTL 301

Query: 295 G 295
           G
Sbjct: 302 G 302

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score =  216 bits (549), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 117/294 (39%), Positives = 175/294 (59%), Gaps = 11/294 (3%)

Query: 10  IQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQG-FRKIIANEG 68
           I  Y+   Y    L G I CG THSS+ P+D+VK R+Q+ P +Y   + G F++IIA EG
Sbjct: 9   IPQYSVSDYMKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEG 68

Query: 69  WKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGV------TVYLMASATAEFL 122
              + TGFG T +GYS+QGA K+GGYE FK  +   L          +VY+ ++A AEFL
Sbjct: 69  AGALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFL 128

Query: 123 ADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMC 182
           ADI LCP EA +++   + P F N +V G+ ++  E  G+ +FY G  P+  +QIPY + 
Sbjct: 129 ADIALCPLEATRIR-LVSQPQFANGLVGGFSRILKEE-GIGSFYSGFTPILFKQIPYNIA 186

Query: 183 KFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSE 242
           KF  FE+   + Y      KE++++     ++ + G  AG+  A VS PAD ++SK+N  
Sbjct: 187 KFLVFER-ASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVNKT 245

Query: 243 RKANESMSVA-SKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVG 295
           +KA    +V    ++ +++GF G + GL  R+VM+GTLTS Q+ IY S K+ +G
Sbjct: 246 KKAPGQSTVGLLAQLAKQLGFFGSFAGLPTRLVMVGTLTSLQFGIYGSLKSTLG 299

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score =  215 bits (548), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 174/291 (59%), Gaps = 11/291 (3%)

Query: 13  YTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNL-QGFRKIIANEGWKK 71
           Y+   YA   L G I CG THS++ P+D+VK R+Q+ P +Y   +   F++II++EG   
Sbjct: 8   YSLSDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGA 67

Query: 72  VYTGFGATFVGYSLQGAGKYGGYEYFKHL------YSSWLSPGVTVYLMASATAEFLADI 125
           + TGFG T +GYSLQG+ K+GGYE FK L      Y   ++   ++Y+ ++A AEF ADI
Sbjct: 68  LLTGFGPTLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADI 127

Query: 126 MLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFT 185
            LCP EA +++   + P F N +V G+ ++  E  G  +FY G  P+  +QIPY + KF 
Sbjct: 128 ALCPLEATRIR-LVSQPTFANGLVGGFSRILKEE-GAGSFYNGFTPILFKQIPYNIAKFL 185

Query: 186 SFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKA 245
            FE+  + +Y  +   KE ++      ++ + G  AG+  A VS PAD ++SK+N  +KA
Sbjct: 186 VFERAAE-VYFGMAGPKESLSTASTTGINLLSGLTAGLAAAIVSQPADTLLSKVNKTKKA 244

Query: 246 NESMSVA-SKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVG 295
               ++    ++ +++GF G + GL  R+VM+GTLTS Q+ IY S K  +G
Sbjct: 245 PGQSTIGLLAQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYGSLKKTLG 295

>Kwal_33.15597
          Length = 305

 Score =  213 bits (543), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 114/294 (38%), Positives = 176/294 (59%), Gaps = 11/294 (3%)

Query: 10  IQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNL-QGFRKIIANEG 68
           I  YT   YA   L G I CG THS++ P+D+VK R+Q+ P +Y   +   F++II++EG
Sbjct: 5   IPQYTISDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEG 64

Query: 69  WKKVYTGFGATFVGYSLQGAGKYGGYEYFKHL------YSSWLSPGVTVYLMASATAEFL 122
              + TGFG T +GYSLQG+ K+GGYE FK L      Y   ++   ++Y+ ++A AEF 
Sbjct: 65  AGALLTGFGPTLLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFF 124

Query: 123 ADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMC 182
           ADI LCP EA +++   + P F N +V G+ ++  E  G+ +FY G  P+  +QIPY + 
Sbjct: 125 ADIALCPLEATRIR-LVSQPTFANGLVGGFSRILKEE-GLSSFYNGFTPILFKQIPYNIA 182

Query: 183 KFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSE 242
           KF  FE+  + +Y  +   KE ++      ++ + G  AG+  A VS PAD ++SK+N  
Sbjct: 183 KFLVFERAAE-VYFGMAGPKETLSTSTTTGLNLLSGLTAGLAAAIVSQPADTLLSKVNKA 241

Query: 243 RKANESMSVA-SKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVG 295
           +KA    ++    ++ +++GF G + GL  R+VM+GTLTS Q+ IY S K  +G
Sbjct: 242 KKAPGQSTIGLLGQLAKELGFVGSFAGLPTRLVMVGTLTSLQFGIYGSLKKTLG 295

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score =  202 bits (515), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 172/291 (59%), Gaps = 11/291 (3%)

Query: 13  YTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNL-QGFRKIIANEGWKK 71
           YT   YA   L G I CG THSS+ P+D+VK R+Q+ P +Y   +   F++II++EG   
Sbjct: 8   YTVSDYAKFALAGAIGCGITHSSMVPIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGA 67

Query: 72  VYTGFGATFVGYSLQGAGKYGGYEYFKHL------YSSWLSPGVTVYLMASATAEFLADI 125
           + TGFG T +GYSLQG+ K+GGYE FK L      Y + ++   T+Y+ ++A AEF ADI
Sbjct: 68  LLTGFGPTLLGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADI 127

Query: 126 MLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFT 185
            LCP EA +++   + P F N +  G+ ++  E  G+ +FY G  P+  +QIPY + KF 
Sbjct: 128 ALCPLEATRIR-LVSQPTFANGLFGGFSRILKEE-GVGSFYNGFTPILFKQIPYNIAKFF 185

Query: 186 SFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKA 245
            FE      +  L   KE M+     +++   G  AG+  A VS PAD ++SK+N  +KA
Sbjct: 186 VFEHAANAYFG-LAGPKETMSETTHTAINLAAGLTAGLAAAVVSQPADTLLSKVNKTKKA 244

Query: 246 NESMSVA-SKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVG 295
               ++    ++ +++GF G + GL  R+VM+GTLTS Q+ IY + K  +G
Sbjct: 245 PGQSTIGLLAQLAKQLGFVGSFTGLPTRLVMVGTLTSLQFGIYGTLKKSLG 295

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score =  199 bits (507), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 168/291 (57%), Gaps = 11/291 (3%)

Query: 13  YTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQG-FRKIIANEGWKK 71
           Y+   YA   L G I CG THS++ P+D+VK R+Q+ P  Y+S + G FRKI+  EG   
Sbjct: 10  YSLSDYAKFALAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGAAA 69

Query: 72  VYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT------VYLMASATAEFLADI 125
           + TGFG T +GYS+QGA K+GGYE FK  +   L           +Y+ ++A AEF ADI
Sbjct: 70  LLTGFGPTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADI 129

Query: 126 MLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFT 185
            LCP EA +++   + P F N +V G+ ++  E  G+ +FY G  P+  +QIPY + KF 
Sbjct: 130 ALCPLEATRIR-LVSQPTFANGLVGGFARILKEE-GIGSFYNGFTPILFKQIPYNIAKFV 187

Query: 186 SFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKA 245
            FE      +  L   KE ++      ++ + G  AG+  A +S PAD ++SK+N  +KA
Sbjct: 188 VFEHAANAYFG-LAGSKENLSTTAATGINLLAGLTAGLAAAVISQPADTLLSKVNKTKKA 246

Query: 246 -NESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVG 295
             +S      ++ +++GF G + GL  R+VM+GTLTS Q+ IY   K  +G
Sbjct: 247 PGQSTFGLLMQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYGKLKQSLG 297

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 85.1 bits (209), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 69/285 (24%), Positives = 128/285 (44%), Gaps = 24/285 (8%)

Query: 22  TLGGIIAC-GPTHSSITPLDLVKCRLQVNPKL--YTSNLQGFRKIIANEGWKKVYTGFGA 78
           TLG I  C G T   + P+DLVK R+Q       Y +++  F KI + EG + +Y+G G 
Sbjct: 523 TLGSIAGCIGAT--VVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGIYSGLGP 580

Query: 79  TFVGYSLQGAGKYGGYEYF------KHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEA 132
             +G + + A K    +Y       KH    W        +++ A A     +   P E 
Sbjct: 581 QLIGVAPEKAIKLTVNDYMRGRLMDKHANLKWY-----FEILSGACAGACQVVFTNPLEV 635

Query: 133 IKVKQQTTMPPFCNNVVDGWKKMYA--ESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKI 190
           +K++ Q     +  +V+          +  G+K  YKGI     R +P++   F ++  +
Sbjct: 636 VKIRLQVR-SEYAGDVLKSQVTALGVIKQLGIKGLYKGIAACLMRDVPFSAIYFPTYAHL 694

Query: 191 VQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANES-- 248
            + ++   PK K++ N L+   +   GG LAG+  A ++ P DV+ +++  + +  E+  
Sbjct: 695 KKDVFKYDPKDKKQRNKLKTWELLVAGG-LAGMPAAYLTTPFDVIKTRLQIDPRKGETRY 753

Query: 249 --MSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFK 291
             +  A++ I ++  F   + G   R++       F    Y+ F+
Sbjct: 754 EGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYEIFQ 798

 Score = 30.4 bits (67), Expect = 1.9,   Method: Composition-based stats.
 Identities = 15/81 (18%), Positives = 43/81 (53%), Gaps = 2/81 (2%)

Query: 214 SFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVAS--KRIYQKIGFTGLWNGLMV 271
           +F  G +AG + A V +P D++ +++ ++R  ++  +      +I+ + G  G+++GL  
Sbjct: 521 NFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGIYSGLGP 580

Query: 272 RIVMIGTLTSFQWLIYDSFKA 292
           +++ +    + +  + D  + 
Sbjct: 581 QLIGVAPEKAIKLTVNDYMRG 601

>Kwal_47.17321
          Length = 881

 Score = 76.6 bits (187), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 129/283 (45%), Gaps = 22/283 (7%)

Query: 23  LGGIIAC-GPTHSSITPLDLVKCRLQV--NPKLYTSNLQGFRKIIANEGWKKVYTGFGAT 79
           LG +  C G T  ++ P+DLVK R+Q   N   Y +++  F KI + EG + +Y+G G  
Sbjct: 506 LGSVAGCIGAT--AVYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREGIRGIYSGLGPQ 563

Query: 80  FVGYSLQGAGKYGGYEYFKHLYSSWLSP-GVTVYLMASATAEFLADIMLCPFEAIKVKQQ 138
            VG + + A K    +Y + L     +   + + +++ A A     I   P E +K++ Q
Sbjct: 564 LVGVAPEKAIKLTVNDYVRKLLMDENNRLTLPLEIISGAAAGACQVIFTNPLEIVKIRLQ 623

Query: 139 TTMPPFCNNVVDGWKKM------YAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQ 192
                  +   D   K         +S G++  YKG+V    R +P++   F ++  + +
Sbjct: 624 VR-----SEYADSLPKSQLTALGVVKSLGLRGLYKGLVACLMRDVPFSAIYFPTYAHLKR 678

Query: 193 KIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSV- 251
            I++  P+ K +   L    +   GG LAG+  A ++ P DV+ +++  + +  E+    
Sbjct: 679 DIFNYDPQDKNKRARLHTWELLTAGG-LAGMPAAYLTTPFDVIKTRLQIDPRKGETRYTG 737

Query: 252 ---ASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFK 291
              A++ I ++  F   + G   R++       F    Y+ F+
Sbjct: 738 ILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEIFQ 780

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 76.6 bits (187), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 66/281 (23%), Positives = 127/281 (45%), Gaps = 17/281 (6%)

Query: 22  TLGGIIAC-GPTHSSITPLDLVKCRLQVNPKL--YTSNLQGFRKIIANEGWKKVYTGFGA 78
           +LG +  C G T   + P+D VK R+Q    L  Y +++  F KI++ EG + VY+G G 
Sbjct: 548 SLGSVAGCIGAT--IVYPIDFVKTRMQAQRSLSQYKNSIDCFLKILSREGIRGVYSGLGP 605

Query: 79  TFVGYSLQGAGKYGGYEYFKH-LYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQ 137
             +G + + A K    +Y ++ L       G+   +++ A+A     I   P E +K++ 
Sbjct: 606 QLIGVAPEKAIKLTVNDYMRNKLKDKNGKLGLLSEIISGASAGACQVIFTNPLEIVKIRL 665

Query: 138 QTTMPPFCNNVVDGWKKMYA----ESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQK 193
           Q        N  +   K+ A    +  G+   YKG      R +P++   F ++  + + 
Sbjct: 666 QVKGEYVAENAENA--KLTALQIIKRLGLPGLYKGAAACLLRDVPFSAIYFPTYAHLKRD 723

Query: 194 IYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSV-- 251
           +++  P  K + + L    +    G LAG+  A ++ P DV+ +++  + K  E++    
Sbjct: 724 LFNFDPNDKNKRSRLNTWEL-LSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETIYKGI 782

Query: 252 --ASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSF 290
             A++ I ++  F   + G   R++       F    Y+ F
Sbjct: 783 IHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYELF 823

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/302 (22%), Positives = 129/302 (42%), Gaps = 38/302 (12%)

Query: 21  CTLGGIIACGPTHSSITPLDLVKCRLQVNP--KLYTSNLQGFRKIIANEGWKK-VYTGFG 77
           C + G I      S++  LD VK R Q  P  K Y + +  +R I   EG ++ +Y G+ 
Sbjct: 56  CVVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGYM 115

Query: 78  ATFVGYSLQGAGKYGGYEYFKH-LYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVK 136
           A  +G     A  +G YEY K  +   W       +L A    +F++  +  P E +K +
Sbjct: 116 AAMLGSFPSAAIFFGTYEYTKRTMIEDWQINDTITHLSAGFLGDFISSFVYVPSEVLKTR 175

Query: 137 QQTT---MPPFC------NNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSF 187
            Q       PF       +N+ +  K +  E G  ++ + G      R +P++  +F  +
Sbjct: 176 LQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEG-FRSLFFGYKATLARDLPFSALQFAFY 234

Query: 188 EKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANE 247
           EK  Q  + +  ++K+  +    I    + G  AG L   ++ P DV+ +++ +++  ++
Sbjct: 235 EKFRQLAFKI--EQKDGRDGELSIPNEILTGACAGGLAGIITTPMDVVKTRVQTQQPPSQ 292

Query: 248 S----------------------MSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWL 285
           S                      +S++ + +YQ  G  G ++G+  R V     +S   L
Sbjct: 293 SNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGVGPRFVWTSVQSSIMLL 352

Query: 286 IY 287
           +Y
Sbjct: 353 LY 354

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 74.7 bits (182), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 60/284 (21%), Positives = 130/284 (45%), Gaps = 15/284 (5%)

Query: 22  TLGGIIAC-GPTHSSITPLDLVKCRLQVNPKL--YTSNLQGFRKIIANEGWKKVYTGFGA 78
           +LG I  C G T   + P+D +K R+Q    L  Y +++    KII+ EG K +Y+G G 
Sbjct: 535 SLGSIAGCIGAT--VVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGLGP 592

Query: 79  TFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVY--LMASATAEFLADIMLCPFEAIKVK 136
             +G + + A K    ++ ++  +   +  ++++  +++ A+A     I   P E +K++
Sbjct: 593 QLIGVAPEKAIKLTVNDFMRNRLTD-KNGKLSLFPEIISGASAGACQVIFTNPLEIVKIR 651

Query: 137 QQTTMPPFCNNV--VDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKI 194
            Q        N+   +       +  G++  Y G+     R +P++   F ++  + + +
Sbjct: 652 LQVQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTYAHLKKDL 711

Query: 195 YSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANES----MS 250
           +   P  K + N L+   +    G +AG+  A ++ P DV+ +++  + +  E+    + 
Sbjct: 712 FDFDPNDKTKRNRLKTWEL-LTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKYNGIF 770

Query: 251 VASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
            A + I ++  F   + G   R++       F    Y+ FK ++
Sbjct: 771 HAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYELFKGFI 814

>Scas_379.2
          Length = 301

 Score = 71.2 bits (173), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 116/287 (40%), Gaps = 30/287 (10%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSN-LQGFRKIIANEGWKKVYTGFGATFV 81
           L G  A    HS + P+D +K R+Q      TSN L    KI   EG   ++ G  +  +
Sbjct: 28  LAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKISTAEGSLALWKGVQSVIL 87

Query: 82  GYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYL---MASATAEFLADIMLCPFEAIKVKQQ 138
           G     A  +  YEY K              L   ++   A   AD ++ PF+ +K + Q
Sbjct: 88  GAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTALSGTVATIAADALMNPFDTLKQRMQ 147

Query: 139 TTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVL 198
                   NV    K++Y ++ G  AFY          IP+    F  +E   +      
Sbjct: 148 LNTNTTVWNVT---KQIY-KNEGFSAFYYSYPTTLAMNIPFAAFNFMIYESATKFF---- 199

Query: 199 PKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSV------- 251
                + N L    V  + G L+G  CAA++ P D + + +  + + +ES+S+       
Sbjct: 200 -NPTNDYNPL----VHCLSGGLSGATCAAITTPLDCIKTVL--QVRGSESVSLQVMKEAN 252

Query: 252 ----ASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
               A+K IYQ  G  G W GL  R+      T+  W  Y+  K ++
Sbjct: 253 TFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYECAKHFL 299

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 83/177 (46%), Gaps = 9/177 (5%)

Query: 113 LMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPL 172
           L+A A A  +   ++ P +A+K + Q+T     +N++    K+    G + A +KG+  +
Sbjct: 27  LLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKISTAEGSL-ALWKGVQSV 85

Query: 173 WCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPA 232
                P     F ++E    K Y +    +++M   Q +  + + G +A I   A+ +P 
Sbjct: 86  ILGAGPAHAVYFATYE--YTKKYLI---DEKDMQTHQPLKTA-LSGTVATIAADALMNPF 139

Query: 233 DVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDS 289
           D +  ++  +   N ++   +K+IY+  GF+  +      + M     +F ++IY+S
Sbjct: 140 DTLKQRM--QLNTNTTVWNVTKQIYKNEGFSAFYYSYPTTLAMNIPFAAFNFMIYES 194

 Score = 31.6 bits (70), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 1/85 (1%)

Query: 211 ISVSFVGGYLAGILCAAVSHPADVMVSKINS-ERKANESMSVASKRIYQKIGFTGLWNGL 269
           +S   + G  AGI+  +V  P D + ++I S   K+  +M     +I    G   LW G+
Sbjct: 23  LSHQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKISTAEGSLALWKGV 82

Query: 270 MVRIVMIGTLTSFQWLIYDSFKAYV 294
              I+  G   +  +  Y+  K Y+
Sbjct: 83  QSVILGAGPAHAVYFATYEYTKKYL 107

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 71.2 bits (173), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 62/285 (21%), Positives = 127/285 (44%), Gaps = 22/285 (7%)

Query: 22  TLGGIIAC-GPTHSSITPLDLVKCRLQV--NPKLYTSNLQGFRKIIANEGWKKVYTGFGA 78
           TLG I  C G T   + P+DLVK R+Q   N   Y +++    KI   +G + +Y+G G 
Sbjct: 509 TLGSIAGCIGAT--VVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLYSGLGP 566

Query: 79  TFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVY--LMASATAEFLADIMLCPFEAIKVK 136
             +G + + A K    ++ +  + +  S  +  Y  +++ ATA     +   P E +K++
Sbjct: 567 QLIGVAPEKAIKLTVNDFMRQYFMN-KSRTIKWYQEILSGATAGACQVVFTNPLEIVKIR 625

Query: 137 QQTTMPPFCNNVVDGWKKMYAESG-----GMKAFYKGIVPLWCRQIPYTMCKFTSFEKIV 191
            Q       + V +  +      G     G++  YKG      R +P++   F ++  + 
Sbjct: 626 LQMR----SDYVGENARPQLGAVGIIRQLGLRGLYKGAAACLLRDVPFSAIYFPTYAHLK 681

Query: 192 QKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSV 251
           + +++  P  K + N L+   +   GG +AG+  A ++ P DV+ +++  + +  E+   
Sbjct: 682 KDVFNFDPNDKNKRNKLKTWELLLAGG-IAGMPAAYLTTPFDVIKTRLQIDPRKGETTYT 740

Query: 252 ----ASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKA 292
               A++ I ++      + G   R++       F    ++ F+ 
Sbjct: 741 GVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFEMFQG 785

 Score = 34.7 bits (78), Expect = 0.099,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 44/83 (53%), Gaps = 4/83 (4%)

Query: 214 SFVGGYLAGILCAAVSHPADVMVSKINSERKA---NESMSVASKRIYQKIGFTGLWNGLM 270
           +F  G +AG + A V +P D++ +++ ++R +     S+    K I+Q  G  GL++GL 
Sbjct: 507 NFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVK-IFQTKGIRGLYSGLG 565

Query: 271 VRIVMIGTLTSFQWLIYDSFKAY 293
            +++ +    + +  + D  + Y
Sbjct: 566 PQLIGVAPEKAIKLTVNDFMRQY 588

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 124/278 (44%), Gaps = 19/278 (6%)

Query: 24  GGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGY 83
           GGI+AC  TH    PLDL K RLQ  P    + ++   +I+ NEG   +Y+G  A  +  
Sbjct: 18  GGIVACVATH----PLDLAKVRLQTAPAPKPTLVRMASQILRNEGVPGLYSGLTAAILRQ 73

Query: 84  SLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMA-SATAEFLADIMLCPFEAIKVKQQ--TT 140
                 ++G Y++ K  Y         +YL+  S  +  +  ++  P + + ++ Q  ++
Sbjct: 74  CTYTTARFGVYDFVKERYIPKEYLNSMLYLLPCSMFSGAVGGLIGNPADVVNIRMQNDSS 133

Query: 141 MPPFCN----NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYS 196
           +P        N  DG  K+ +  G  K F  G  P   R I  T  +  +++  + K Y 
Sbjct: 134 LPAELRRNYKNAADGLYKICSGEGVAKLF-TGWQPNLVRGILMTSSQVVTYD--IAKNYL 190

Query: 197 VLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKI-NSERKANESMSVASKR 255
           V     ++ N     S  F    LAG++   V  PADV+ +++ N+ + +++S       
Sbjct: 191 VQNVGLDKDNK----STHFASSLLAGLVATTVCSPADVIKTRVMNAHKHSHDSAVRILLD 246

Query: 256 IYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAY 293
             ++ G + ++ G +   V +G  T   +L  +  + +
Sbjct: 247 AVKQEGPSFMFRGWLPSFVRLGPNTILIFLTVEQLRKH 284

 Score = 34.7 bits (78), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 36/74 (48%)

Query: 218 GYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIG 277
           G   GI+    +HP D+   ++ +      ++   + +I +  G  GL++GL   I+   
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKPTLVRMASQILRNEGVPGLYSGLTAAILRQC 74

Query: 278 TLTSFQWLIYDSFK 291
           T T+ ++ +YD  K
Sbjct: 75  TYTTARFGVYDFVK 88

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 70.1 bits (170), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 62/279 (22%), Positives = 124/279 (44%), Gaps = 14/279 (5%)

Query: 22  TLGGIIACGPTHSSITPLDLVKCRLQVNPKL--YTSNLQGFRKIIANEGWKKVYTGFGAT 79
           TLG +  C      + P+D+VK R+Q       Y +++    KI++ EG + +Y+G G  
Sbjct: 529 TLGSVAGCIGA-MVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLYSGLGPQ 587

Query: 80  FVGYSLQGAGKYGGYEYFKHLYSSWLSP-GVTVYLMASATAEFLADIMLCPFEAIKVKQQ 138
            +G + + A K    ++ +   +       +   +++ ATA     +   P E +K++ Q
Sbjct: 588 LIGVAPEKAIKLTVNDHMRATLAGRDGKLSLPCEIISGATAGACQVVFTNPLEIVKIRLQ 647

Query: 139 TT---MPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIY 195
                +     N V+    +  ++ G+   Y+G      R IP++   F ++  I   ++
Sbjct: 648 VKSDYVADAARNSVNAISVI--KNLGLIGLYRGAGACLLRDIPFSAIYFPTYAHIKSNVF 705

Query: 196 SVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSV---- 251
           +  PK  ++ N L    +  V G LAG+  A ++ P DV+ +++  + K  ES+      
Sbjct: 706 NFDPKDSDKRNKLNTWQL-LVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVYNGIWD 764

Query: 252 ASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSF 290
           A++ I ++ G    + G   R++       F    Y+ F
Sbjct: 765 AARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEIF 803

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 39/85 (45%), Gaps = 4/85 (4%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPK----LYTSNLQGFRKIIANEGWKKVYTGFGA 78
           + G +A  P     TP D++K RLQ++PK    +Y       R I+  EG K  + G  A
Sbjct: 725 VSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVYNGIWDAARTILKEEGIKSFFKGGPA 784

Query: 79  TFVGYSLQGAGKYGGYEYFKHLYSS 103
             +  S Q       YE F +L+ +
Sbjct: 785 RVLRSSPQFGFTLAAYEIFHNLFPA 809

 Score = 31.6 bits (70), Expect = 0.86,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 43/82 (52%), Gaps = 4/82 (4%)

Query: 214 SFVGGYLAGILCAAVSHPADVMVSKINSER---KANESMSVASKRIYQKIGFTGLWNGLM 270
           +F  G +AG + A V +P D++ +++ ++R   K   S+    K I  K G  GL++GL 
Sbjct: 527 NFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLK-ILSKEGVRGLYSGLG 585

Query: 271 VRIVMIGTLTSFQWLIYDSFKA 292
            +++ +    + +  + D  +A
Sbjct: 586 PQLIGVAPEKAIKLTVNDHMRA 607

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 71/293 (24%), Positives = 113/293 (38%), Gaps = 34/293 (11%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSN--------LQGFRKIIANEGWKKVYT 74
           + G  A    HS I PLD +K RLQ    + T+         L+    I A EG   ++ 
Sbjct: 23  MAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGSMVLWK 82

Query: 75  GFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLM----ASATAEFLADIMLCPF 130
           G  +  +G     A  +  YE  K       +     +      + ATA   AD ++ PF
Sbjct: 83  GVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIAADALMNPF 142

Query: 131 EAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKI 190
           + IK + Q        +V D  K++Y++ G  +AFY          IP+    F      
Sbjct: 143 DVIKQRIQLNT---NISVWDTAKRIYSKEG-FQAFYSSYPTTLAINIPFAAFNF------ 192

Query: 191 VQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMS 250
              IY    +                GG ++G  CA ++ P D + + +        SM 
Sbjct: 193 --GIYDTATRYFNPSGVYNPFIHCLCGG-ISGAACAGLTTPLDCIKTALQVRGSEKVSME 249

Query: 251 V---------ASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
           V         A++ IYQ  G+ G W+G+  RI+     T+  W  Y+  K ++
Sbjct: 250 VFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISWTAYEFAKHFL 302

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 77/182 (42%), Gaps = 14/182 (7%)

Query: 16  EFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTG 75
            F+ T    G  A     + + P D++K R+Q+N  +  S     ++I + EG++  Y+ 
Sbjct: 120 HFFKTA-FSGATATIAADALMNPFDVIKQRIQLNTNI--SVWDTAKRIYSKEGFQAFYSS 176

Query: 76  FGATFVGYSLQGAGKYGGYEYFKHLY--SSWLSPGVTVYL--MASATAEFLADIMLCPFE 131
           +  T        A  +G Y+     +  S   +P +      ++ A    L   + C   
Sbjct: 177 YPTTLAINIPFAAFNFGIYDTATRYFNPSGVYNPFIHCLCGGISGAACAGLTTPLDCIKT 236

Query: 132 AIKVK--QQTTMPPFCNNVVDGWKKMYA---ESGGMKAFYKGIVPLWCRQIPYTMCKFTS 186
           A++V+  ++ +M  F     D +KK      +  G + F+ G+ P     +P T   +T+
Sbjct: 237 ALQVRGSEKVSMEVF--KQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISWTA 294

Query: 187 FE 188
           +E
Sbjct: 295 YE 296

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 67.8 bits (164), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 71/280 (25%), Positives = 118/280 (42%), Gaps = 34/280 (12%)

Query: 33  HSSITPLDLVKCRLQ-VNPKLYTSN--LQGFRKIIANEGWKKVYTGFGATFVGYSLQGAG 89
           HS + P+D +K R+Q  N K  ++   L     I  +EG   ++ G  +  +G     A 
Sbjct: 48  HSVMFPIDALKTRIQSANAKSLSAKNMLSQISHISTSEGTLALWKGVQSVILGAGPAHAV 107

Query: 90  KYGGYEYFK-HLYSSWLSPGVTVY--LMASATAEFLADIMLCPFEAIKVKQQTTMPPFCN 146
            +G YE+ K +L  S  +     +   ++ A A   +D ++ PF+ IK + Q       N
Sbjct: 108 YFGTYEFCKKNLIDSSDTQTHHPFKTAISGACATTASDALMNPFDTIKQRIQ------LN 161

Query: 147 NVVDGWK--KMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEE 204
                W+  K   +S G+ AFY          IP+    F  +E   + +         E
Sbjct: 162 TSASVWQTTKQIYQSEGLAAFYYSYPTTLVMNIPFAAFNFVIYESSTKFL-----NPSNE 216

Query: 205 MNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSE----------RKANESMSVASK 254
            N L    +  + G ++G  CAA++ P D + + +             RKA ++ S A+ 
Sbjct: 217 YNPL----IHCLCGSISGSTCAAITTPLDCIKTVLQIRGSQTVSLEIMRKA-DTFSKAAS 271

Query: 255 RIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
            IYQ  G+ G W G   RIV     T+  W  Y+  K ++
Sbjct: 272 AIYQVYGWKGFWRGWKPRIVANMPATAISWTAYECAKHFL 311

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 67.4 bits (163), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/268 (24%), Positives = 122/268 (45%), Gaps = 24/268 (8%)

Query: 23  LGGIIACGPTHSSIT-PLDLVKCRLQVNPKLYTSNLQGFRKII---ANEGWKKVYTGFGA 78
           L G IA G   +SIT P +  K RLQ+  K   ++      I     N G   +Y G  A
Sbjct: 95  LAGSIA-GAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGISSIYVGCPA 153

Query: 79  TFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVY--LMASATAEFLADIM-LCPFEAIKV 135
             VG + +   ++ G++  K+L     +  ++ +  ++A   A  L  ++ + PFEAIK 
Sbjct: 154 FIVGNTAKAGIRFLGFDTIKNLLRDKKTGELSGFRGVVAGLGAGLLESVVAVTPFEAIKT 213

Query: 136 ----KQQTTMPPFCNN---VVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFE 188
                +Q  +P + NN   +V  + K+ ++  G    Y+G++P+  RQ      +   + 
Sbjct: 214 ALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQ-GFSGLYRGVLPVSMRQAANQAVRLGCYN 272

Query: 189 KI--VQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKAN 246
           KI  + + Y+ +PK K   + L     +F+ G  +GI+    + P D + +++ S     
Sbjct: 273 KIKTLVQDYTNVPKDKPLSSGL-----TFIVGAFSGIVTVYTTMPIDTVKTRMQSLNAGQ 327

Query: 247 ESMSVAS-KRIYQKIGFTGLWNGLMVRI 273
            S ++     I+++ G    W G   R+
Sbjct: 328 YSSTINCFATIFKEEGLKTFWKGATPRL 355

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 76/173 (43%), Gaps = 19/173 (10%)

Query: 35  SITPLDLVKCRL----QVNPKLYTSNLQG----FRKIIANEGWKKVYTGFGATFVGYSLQ 86
           ++TP + +K  L    Q     Y +N +G    + K+++++G+  +Y G     +  +  
Sbjct: 204 AVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAAN 263

Query: 87  GAGKYGGYEYFKHLYSSW--------LSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQ 138
            A + G Y   K L   +        LS G+T   +  A +  +      P + +K + Q
Sbjct: 264 QAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLT--FIVGAFSGIVTVYTTMPIDTVKTRMQ 321

Query: 139 TTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIV 191
           +      ++ ++ +  ++ E G +K F+KG  P   R I      FT +EK++
Sbjct: 322 SLNAGQYSSTINCFATIFKEEG-LKTFWKGATPRLGRLILSGGIVFTIYEKVL 373

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 112/245 (45%), Gaps = 19/245 (7%)

Query: 38  PLDLVKCRLQVNP-KLYTSNLQGFRKIIANEG-WKKVYTGFGATFVGYSLQGAGKYGGYE 95
           P D VK RLQ  P  ++ +     +    NEG W+  Y G G+   G +L+ A  +  + 
Sbjct: 26  PFDTVKVRLQTQPAHMFPTTWSCIKFTYDNEGLWRGFYQGIGSPLAGAALENAVLFVSFN 85

Query: 96  YFKHLYS--SWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQ----TTMPPFCNNVV 149
             K L    S LSP ++  + A A A   A  +L P E IK K Q    +T       ++
Sbjct: 86  QAKRLLDVESLLSP-LSKTVWAGAFAGACASFVLTPVELIKCKLQVSNLSTTKTSHTKIL 144

Query: 150 DGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQ 209
              K + +E G +   ++G    + R+       FT++E +   + S   +++ E N   
Sbjct: 145 PTIKSVLSERGFL-GLWQGQSGTFIRESGGGAAWFTTYEVVKNYLAS---RRQAEQNTTW 200

Query: 210 QISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGL 269
           ++  S   G  AG+   A   PAD + S + ++   +  +S A+++IY + G  G + GL
Sbjct: 201 ELLAS---GASAGLAFNASIFPADTIKSTMQTD---HIDLSSATRKIYARQGIAGFYRGL 254

Query: 270 MVRIV 274
            + ++
Sbjct: 255 GITLI 259

 Score = 52.4 bits (124), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 76/163 (46%), Gaps = 13/163 (7%)

Query: 36  ITPLDLVKCRLQVN-----PKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGK 90
           +TP++L+KC+LQV+        +T  L   + +++  G+  ++ G   TF+  S  GA  
Sbjct: 118 LTPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAW 177

Query: 91  YGGYEYFKHLYSS--WLSPGVTVYLMASATAEFLA-DIMLCPFEAIKVKQQTTMPPFCNN 147
           +  YE  K+  +S        T  L+AS  +  LA +  + P + IK   QT      + 
Sbjct: 178 FTTYEVVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQTDHIDLSSA 237

Query: 148 VVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKI 190
                +K+YA   G+  FY+G+     R +P     F ++E +
Sbjct: 238 T----RKIYARQ-GIAGFYRGLGITLIRAVPANAAIFYTYETL 275

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 65.5 bits (158), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 68/266 (25%), Positives = 116/266 (43%), Gaps = 23/266 (8%)

Query: 38  PLDLVKCRLQVNP-KLYTSNLQGFRKIIANEG-WKKVYTGFGATFVGYSLQGAGKYGGYE 95
           P D VK RLQ  P  LY +     R    +EG WK  Y G  +   G +L+ A  +  + 
Sbjct: 27  PFDTVKVRLQTQPAHLYPTTWSCIRSTYTDEGIWKGFYQGIASPLFGAALENAVLFVSFN 86

Query: 96  YFKHLYSSW--LSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWK 153
              +    +  L P +T  + + A A   A  +L P E +K K Q +     N++    +
Sbjct: 87  QCTNFLDEFTQLKP-LTKTIYSGAFAGACASFILTPVELVKCKLQVS--NISNSLSQTTR 143

Query: 154 --------KMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEM 205
                   K   +  G+   ++G +  + R+       FT++E +  K  S+ P +KE  
Sbjct: 144 HTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTYEIMKMKFASLHPAEKE-- 201

Query: 206 NALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGL 265
           N   ++ VS   G  AG+L  A   PAD + S   +E   + S+  A K++ +  G TG 
Sbjct: 202 NHTWELLVS---GASAGVLFNASVFPADTVKSVCQTE---HVSIVNALKKVLRTHGITGF 255

Query: 266 WNGLMVRIVMIGTLTSFQWLIYDSFK 291
           + GL + ++      +  +  Y++ K
Sbjct: 256 YRGLGITLIRAAPANATVFYTYETLK 281

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 78/168 (46%), Gaps = 19/168 (11%)

Query: 36  ITPLDLVKCRLQVN--------PKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQG 87
           +TP++LVKC+LQV+           +TS     + +I  +G   ++ G  +TFV   L G
Sbjct: 119 LTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGG 178

Query: 88  AGKYGGYEYFKHLYSSWLSPG-----VTVYLMASATAEFLADIMLCPFEAIKVKQQTTMP 142
           A  +  YE  K  ++S L P          L++ A+A  L +  + P + +K   QT   
Sbjct: 179 AVWFTTYEIMKMKFAS-LHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQTEHV 237

Query: 143 PFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKI 190
               ++V+  KK+   + G+  FY+G+     R  P     F ++E +
Sbjct: 238 ----SIVNALKKVL-RTHGITGFYRGLGITLIRAAPANATVFYTYETL 280

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 65.5 bits (158), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 108/257 (42%), Gaps = 34/257 (13%)

Query: 24  GGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGY 83
            GI A   TH    PLDL K RLQ  P    + +Q  R I+ NEG   +Y G  A+ +  
Sbjct: 16  AGIFAVMNTH----PLDLTKVRLQAAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLLRQ 71

Query: 84  SLQGAGKYGGYEYFKH-------LYSSWLSPGVTVYLMA-SATAEFLADIMLCPFEAIKV 135
                 ++G Y+  K        L + W   G ++   A    A   AD++      I++
Sbjct: 72  CTYTTARFGMYDALKEHVIPRDKLTNMWYLLGASMVSGALGGLAGNFADLI-----NIRM 126

Query: 136 KQQTTMP----PFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCK---FTSFE 188
           +  + +P        N +DG  K+Y   G    F  G  P   R +  T  +   +  F+
Sbjct: 127 QNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVTYDMFK 186

Query: 189 KIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKI-NSERKANE 247
             +   Y++ PKK         ++ S + G++A  +C+    PADV+ + + N+ +K   
Sbjct: 187 NFLVTKYNMDPKKNS-----THLTSSLLAGFVATTVCS----PADVIKTIVMNAHKKPGH 237

Query: 248 SMSVASKRIYQKIGFTG 264
           +   + K + + I   G
Sbjct: 238 NHDSSFKILMEAINKEG 254

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 37/77 (48%)

Query: 218 GYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIG 277
           G  AGI     +HP D+   ++ +      ++    + I +  G  GL+ GL   ++   
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQAAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLLRQC 72

Query: 278 TLTSFQWLIYDSFKAYV 294
           T T+ ++ +YD+ K +V
Sbjct: 73  TYTTARFGMYDALKEHV 89

>Scas_716.29
          Length = 316

 Score = 65.1 bits (157), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 89/190 (46%), Gaps = 14/190 (7%)

Query: 109 VTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGW----KKMYAESGGMKA 164
           V+  L+A + +  LA  ++ P + +K++ Q   P +      G     K M    GG+++
Sbjct: 22  VSQSLVAGSVSGLLARTVIAPLDTLKIRLQLR-PSYTGQAPSGLLKMMKGMILNEGGLRS 80

Query: 165 FYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGIL 224
           F+KG VP     + Y   +F+S+       Y+ L  +  +MN   Q   S V G LAG+ 
Sbjct: 81  FWKGNVPGTMMYVLYGGAQFSSYS-----FYNNLFGETSDMNGQLQ---SLVVGALAGMT 132

Query: 225 CAAVSHPADVMVSK-INSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQ 283
            + VS+P DV+ ++ I ++  A  S+S   K I+   G  G + G    +  I    S  
Sbjct: 133 SSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASIL 192

Query: 284 WLIYDSFKAY 293
           +  Y+S K Y
Sbjct: 193 FGTYESIKIY 202

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 95/233 (40%), Gaps = 18/233 (7%)

Query: 36  ITPLDLVKCRLQVNPKLYTSN-----LQGFRKIIANE-GWKKVYTGFGATFVGYSLQGAG 89
           I PLD +K RLQ+ P  YT       L+  + +I NE G +  + G     + Y L G  
Sbjct: 40  IAPLDTLKIRLQLRPS-YTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGA 98

Query: 90  KYGGYEYFKHLYSSWLS-PGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNV 148
           ++  Y ++ +L+       G    L+  A A   +  +  P + ++ +         +++
Sbjct: 99  QFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSL 158

Query: 149 VDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNAL 208
             G K+++    G+  F++G               F ++E I  KIY     K+ +    
Sbjct: 159 SHGCKEIWNME-GIPGFFRGCTASMFTITLSASILFGTYESI--KIYCDEYSKESDYTNY 215

Query: 209 QQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASK---RIYQ 258
            + S S +    +G+    V++P D +  +I          +V +K    IYQ
Sbjct: 216 LRYSASSI----SGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQ 264

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 65.1 bits (157), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 75/292 (25%), Positives = 122/292 (41%), Gaps = 38/292 (13%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQ---VNPKLYTSNLQGFRKIIANEGWKKVYTGFGAT 79
           L G  A    HS + P+D +K R+Q   +N    T  +    KI   EG   ++ G  + 
Sbjct: 28  LAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQISKISTMEGSMALWKGVQSV 87

Query: 80  FVGYSLQGAGKYGGYEYFKHLYSSWLSPG--VTVYLMASA----TAEFLADIMLCPFEAI 133
            +G     A  +G YE+ K   +  +SP    T   M +A     A   AD ++ PF+ +
Sbjct: 88  ILGAGPAHAVYFGTYEFCK---ARLISPEDMQTHQPMKTALSGTIATIAADALMNPFDTV 144

Query: 134 KVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQK 193
           K + Q        NV    K++Y ++ G  AFY          IP+    F         
Sbjct: 145 KQRLQLDTNLRVWNVT---KQIY-QNEGFAAFYYSYPTTLAMNIPFAAFNFM-------- 192

Query: 194 IYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSV-- 251
           IY    K     N+   +     GG ++G  CAA++ P D + + +  + + +E++S+  
Sbjct: 193 IYESASKFFNPQNSYNPLIHCLCGG-ISGATCAALTTPLDCIKTVL--QVRGSETVSIEI 249

Query: 252 ---------ASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
                    AS+ I +  G+ G W GL  RIV     T+  W  Y+  K ++
Sbjct: 250 MKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYECAKHFL 301

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 109/245 (44%), Gaps = 20/245 (8%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKL--YTSNLQGFRKIIANEGWKK-VYTGFGAT 79
           +GGII     HS    LD VK R Q  P +  Y   LQ +R +   EG+++ +Y G+ A 
Sbjct: 62  VGGIIGDSAMHS----LDTVKTRQQGAPNVHKYKHMLQAYRTMFIEEGFRRGLYGGYCAA 117

Query: 80  FVGYSLQGAGKYGGYEYFKH-LYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQ 138
            +G     A  +  YE+ K  + + +       +L A    +F +  +  P E +K + Q
Sbjct: 118 MLGSFPSAAIFFSTYEFTKRTMINDYHLNDTFSHLTAGFLGDFFSSFVYVPSEVLKTRLQ 177

Query: 139 T----TMPPFCN-----NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEK 189
                  P F +     ++ +    +Y  + G+ A + G      R +P++  +F  +EK
Sbjct: 178 LQGCYNNPHFNSGYNYKSLRNAIATIY-RTEGVAALFFGYKATLARDLPFSALQFAFYEK 236

Query: 190 IVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESM 249
             Q  ++ L + K+       IS   V G  AG L   ++ P DV+ +++ ++  +   +
Sbjct: 237 FRQ--WAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTPLDVVKTRVQTQLPSQIDI 294

Query: 250 SVASK 254
           S  +K
Sbjct: 295 STDTK 299

>Scas_702.10
          Length = 302

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 115/282 (40%), Gaps = 26/282 (9%)

Query: 24  GGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGY 83
            GI AC  TH    PLDL K RLQ  P    +  +    I+ NE    +Y+G  A  +  
Sbjct: 19  AGIFACVMTH----PLDLAKVRLQAAPLPKPTLGRMLTTILRNENVMGLYSGLSAAVLRQ 74

Query: 84  SLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEA---IKVKQQTT 140
                 ++G Y+  K            VYL+  +        ++  F     I+++  + 
Sbjct: 75  CTYTTVRFGAYDLMKENLIPQGHINDMVYLLPCSMFSGAIGGLVGNFADVVNIRMQNDSA 134

Query: 141 MPPFCN----NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEK----IVQ 192
           + P       N +DG  K+Y   GG+K    G  P   R +  T  +  +++     +V 
Sbjct: 135 LKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVVTYDVFKNYLVT 194

Query: 193 KIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKI-NSERKANESMSV 251
           K+ S  PKK         +S S + G +A  +C+    PADV+ ++I N+ +  +ES   
Sbjct: 195 KL-SFDPKKNS-----THLSASLLAGLVATTICS----PADVIKTRIMNAHKTESESAIK 244

Query: 252 ASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAY 293
                 +K G + ++ G +     +G  T   +   +  K +
Sbjct: 245 ILTSAIKKEGPSFMFRGWLPIFTRLGPFTMLIFFAIEQLKKH 286

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 37/83 (44%)

Query: 209 QQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNG 268
           +QI   +  G  AGI    ++HP D+   ++ +      ++      I +     GL++G
Sbjct: 7   KQIKYPWWYGGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRMLTTILRNENVMGLYSG 66

Query: 269 LMVRIVMIGTLTSFQWLIYDSFK 291
           L   ++   T T+ ++  YD  K
Sbjct: 67  LSAAVLRQCTYTTVRFGAYDLMK 89

>Kwal_26.8669
          Length = 296

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 123/258 (47%), Gaps = 31/258 (12%)

Query: 38  PLDLVKCRLQVN------PKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKY 91
           PLD+VK R+Q+       P+ Y   +   ++I+A EG  ++Y G  +  +  + + A K+
Sbjct: 29  PLDVVKTRMQLQVSGGLGPQ-YKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKF 87

Query: 92  GGYEYFKHLYSSWLSPGV-----TVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCN 146
              + F+ +Y      GV     ++ +++ A+A      ++ PFE +K++ Q     +  
Sbjct: 88  ACNDEFQKIYKREF--GVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSY-K 144

Query: 147 NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMN 206
             +D  +K+ A+ G + A Y G+     R   +    F     I+ ++ ++LP+ K +  
Sbjct: 145 GPIDVVRKIIAQEGVL-AMYNGLESTLWRHGVWNAGYFG----IIFQVRALLPEAKSKS- 198

Query: 207 ALQQISVSFVGGYLAGILCAAVSHPADVMVSKINS-------ERKANESMSVASKRIYQK 259
             QQ     + G + G + + +S P DV+ S+I +        RK N S   +   IY++
Sbjct: 199 --QQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWP-SIFTIYKE 255

Query: 260 IGFTGLWNGLMVRIVMIG 277
            GF  L+ G + +++ +G
Sbjct: 256 EGFRALYKGFVPKVLRLG 273

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 63/155 (40%), Gaps = 18/155 (11%)

Query: 36  ITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYE 95
           + P +LVK RLQ     Y   +   RKIIA EG   +Y G  +T   + +  AG +G   
Sbjct: 126 VVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIF 185

Query: 96  YFKHLYSSWLSPGVTVY--LMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWK 153
             + L     S        L+A +    +  +M  PF+ +K + Q T       VV G  
Sbjct: 186 QVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTA------VVAGGA 239

Query: 154 KMYA----------ESGGMKAFYKGIVPLWCRQIP 178
           + Y           +  G +A YKG VP   R  P
Sbjct: 240 RKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 64/279 (22%), Positives = 111/279 (39%), Gaps = 21/279 (7%)

Query: 24  GGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGY 83
            GI A   TH    PLDL K RLQ  P    +  +    I+ANEG   +Y+G  A  +  
Sbjct: 23  AGIFATMVTH----PLDLAKVRLQAAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQ 78

Query: 84  SLQGAGKYGGYEYFKH--------LYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKV 135
                 ++G Y+  K            ++L P           A   AD++    +    
Sbjct: 79  CTYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGGLAGNFADVVNIRMQNDSA 138

Query: 136 KQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIY 195
            +      +  N +DG  K+Y   GG+K  + G  P   R I  T  +  +++  V K Y
Sbjct: 139 LEAAKRRNY-KNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYD--VFKNY 195

Query: 196 SVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKI-NSERKANESMSVASK 254
            V     +       ++ S + G +A  +C+    PADVM ++I N       ++ + + 
Sbjct: 196 LVTKLDFDASKNYTHLTASLLAGLVATTVCS----PADVMKTRIMNGSGDHQPALKILAD 251

Query: 255 RIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAY 293
            + +K G + ++ G +     +G  T   +   +  K +
Sbjct: 252 AV-RKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLKKH 289

 Score = 32.7 bits (73), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 35/77 (45%)

Query: 218 GYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIG 277
           G  AGI    V+HP D+   ++ +      ++    + I    G  GL++GL   ++   
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQC 79

Query: 278 TLTSFQWLIYDSFKAYV 294
           T T+ ++  YD  K  V
Sbjct: 80  TYTTVRFGAYDLLKENV 96

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 64/281 (22%), Positives = 121/281 (43%), Gaps = 30/281 (10%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVN-----PKLYTSNLQGFRKIIANEGWKKVYTGFG 77
           + GI+ C        PLD+ K RLQ        + Y   +     I+ +EG   +Y G  
Sbjct: 97  VSGIMVC--------PLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLA 148

Query: 78  ATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQ 137
              +GY       +  YE  K  Y S+L  G   +  ++ TA  ++  +  P   +K + 
Sbjct: 149 PIVLGYFPTWMLYFSVYEKCKQRYPSYLPGGFVSHAASALTAGAISTALTNPIWVVKTRL 208

Query: 138 --QTTMPPFCNN---VVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQ 192
             Q+ +     N    +D ++KMY  S G+K FY G+VP     + +    F  +EK+  
Sbjct: 209 MIQSDVSRDSTNYRSTLDAFRKMY-RSEGLKVFYSGLVPSLF-GLFHVAIHFPVYEKLKI 266

Query: 193 KIYSVLPK---KKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKA-NES 248
            ++   P    ++ + N L Q+    V   L+ ++ + +++P +++ +++         S
Sbjct: 267 WLHRNTPAADGQRLDHNKL-QLDRLIVASCLSKVVASVITYPHEILRTRMQVRHSGVPPS 325

Query: 249 MSVASKRIYQKIGFTGLWNGLMVRIVM-----IGTLTSFQW 284
           +     RI    G+ G ++G    +V      + TL SF++
Sbjct: 326 LLNLLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSFEY 366

>Scas_669.6
          Length = 373

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 74/308 (24%), Positives = 126/308 (40%), Gaps = 47/308 (15%)

Query: 21  CTLGGIIACGPTHSSITPLDLVKCRLQ---VNPKLYTSNLQGFRKIIANEGWKK-VYTGF 76
           C L G I      SS+  LD VK R Q   + PK Y +    +R I   EG  + +Y G+
Sbjct: 54  CVLAGGIGGIIGDSSMHSLDTVKTRQQGAPMTPK-YKNMTTAYRTIFLEEGIARGLYGGY 112

Query: 77  GATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTV-YLMASATAEFLADIMLCPFEAIKV 135
            A  +G     A  +G YE+ K      L    TV +L A    +F++  +  P E +K 
Sbjct: 113 FAAMLGSFPSAAIFFGTYEWCKRKMIGDLGFNDTVSHLSAGLLGDFVSSFVYVPSEVLKT 172

Query: 136 K---QQTTMPPFCNNVVDGWK--------KMYAESGGMKAFYKGIVPLWCRQIPYTMCKF 184
           +   Q     PF  +   G+         ++   + G+KA + G      R +P++  +F
Sbjct: 173 RLQLQGRVNNPFFQS---GYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQF 229

Query: 185 TSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSER- 243
             +EK  Q  + +  +KK+       I      G +AG L   ++ P DV+ +++ +++ 
Sbjct: 230 GFYEKFRQTAFKL--EKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQA 287

Query: 244 --KANESMSVAS----------------------KRIYQKIGFTGLWNGLMVRIVMIGTL 279
               N + +V +                      K +YQ  G  G ++G+  R V     
Sbjct: 288 DINPNSATTVGAISAKTNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFVWTSVQ 347

Query: 280 TSFQWLIY 287
           +S   L+Y
Sbjct: 348 SSIMLLLY 355

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 62.4 bits (150), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 57/279 (20%), Positives = 122/279 (43%), Gaps = 30/279 (10%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQ--GF----RKIIANEGWKKVYTGFGATFVGYSLQGAGKY 91
           PLD +K R+Q+  +     ++  GF    R I   EG   +Y G GA  +G   + A ++
Sbjct: 30  PLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLALYKGLGAVVIGIIPKMAIRF 89

Query: 92  GGYEYFKHLYSSWLSPGVT---VYLMASATAEFLADIMLCPFEAIKVKQQ-------TTM 141
             YE+++   +   +  V+    +L         A +++ P E +K++ Q       T  
Sbjct: 90  SSYEFYRSALADKQTGSVSTGNTFLAGVGAGTTEAVLVVNPMEVVKIRLQAQHLHPETAA 149

Query: 142 PPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKK 201
            P   N +     +  E  G+ A Y+G+     RQ       FT + K+ + +     ++
Sbjct: 150 SPRYRNALQACYLIVKEE-GIGALYRGVSLTAARQATNQGANFTVYSKLKEFL-----QE 203

Query: 202 KEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMS------VASKR 255
             + +AL     S + G ++G +    + P D + +++  + K+  +MS         K+
Sbjct: 204 HHKTDALPSWETSCI-GLISGAIGPFSNAPLDTIKTRLQKD-KSTANMSGWSRIVTIGKQ 261

Query: 256 IYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
           + ++ GF  L+ G+  R++ +    +  + +Y+  + ++
Sbjct: 262 LIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVREHL 300

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 62.0 bits (149), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 119/277 (42%), Gaps = 29/277 (10%)

Query: 14  TKEFYATCTLGGIIACGPTHSSIT-PLDLVKCRLQVNPKLYTSNLQGFRKI---IANEGW 69
           +K F A C  G +       +S+T P +  K RLQ+  K   ++      I      +G 
Sbjct: 10  SKSFIAGCLAGAV------EASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKTQGI 63

Query: 70  KKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT--VYLMASATAEFLADIM- 126
             VY G  A  VG + +   ++ G++  K+L     +  ++    ++A   A  L  ++ 
Sbjct: 64  GSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLRDPKTGELSGPRGVIAGLGAGLLESVVA 123

Query: 127 LCPFEAIKV----KQQTTMPPFCNNVVDGWKKMYA---ESGGMKAFYKGIVPLWCRQIPY 179
           + PFEAIK      +Q+  P + NN   G  + Y       G+   Y+G++P+  RQ   
Sbjct: 124 VTPFEAIKTALIDDKQSATPKYHNNG-KGMLRNYTALVRKQGLSGLYRGVLPVSMRQAAN 182

Query: 180 TMCKFTSFEKI--VQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVS 237
              +   + KI  + + Y+  PK K   + L     +FV G  +GI+    + P D + +
Sbjct: 183 QAVRLGCYNKIKVMVQDYTNAPKDKPLSSGL-----TFVVGAFSGIVTVYTTMPIDTVKT 237

Query: 238 KINS-ERKANESMSVASKRIYQKIGFTGLWNGLMVRI 273
           ++ S + K   S       I+++ G    W G   R+
Sbjct: 238 RMQSLDSKRYSSTINCFTTIFKEEGLKAFWKGATPRL 274

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 61.6 bits (148), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 118/257 (45%), Gaps = 29/257 (11%)

Query: 38  PLDLVKCRLQVNPK-----LYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYG 92
           PLD+VK R+Q+  +      YT  +   +KI+A EG  ++Y G  +  +  + + A K+ 
Sbjct: 31  PLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFA 90

Query: 93  GYEYFKHLYSSWLSPGVT-----VYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNN 147
             + F+ LY      GV      + ++A A+A  +   ++ PFE +K++ Q     +   
Sbjct: 91  CNDEFQKLYKQAF--GVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSY-KG 147

Query: 148 VVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNA 207
            VD  +K+ A  G + A Y G+     R   +    F     I+ +  ++LP      N 
Sbjct: 148 PVDVVRKIVAREGVL-AMYNGLESTLWRHALWNGGYFG----IIFQARALLPAAH---NK 199

Query: 208 LQQISVSFVGGYLAGILCAAVSHPADVMVSKINSE-------RKANESMSVASKRIYQKI 260
            Q I+   +   +   +   +S P DV+ S+I +        RK N S+  +   IY++ 
Sbjct: 200 TQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLP-SLLTIYREE 258

Query: 261 GFTGLWNGLMVRIVMIG 277
           GF  L+ G + +++ +G
Sbjct: 259 GFRALYKGFVPKVLRLG 275

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 67/150 (44%), Gaps = 8/150 (5%)

Query: 36  ITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYE 95
           + P +LVK RLQ     Y   +   RKI+A EG   +Y G  +T   ++L   G +G   
Sbjct: 128 VVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIF 187

Query: 96  YFKHLYSSWLSPG--VTVYLMASATAEFLADIMLCPFEAIKVKQQTT--MPPFC---NNV 148
             + L  +  +    +T  L++ +    +  ++  PF+ +K + Q T  +P      N  
Sbjct: 188 QARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWS 247

Query: 149 VDGWKKMYAESGGMKAFYKGIVPLWCRQIP 178
           +     +Y E  G +A YKG VP   R  P
Sbjct: 248 LPSLLTIYREE-GFRALYKGFVPKVLRLGP 276

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 112/250 (44%), Gaps = 35/250 (14%)

Query: 53  YTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVY 112
           +   L+ F KI + EG   ++ G   T +         + GYEY + +     SP  + Y
Sbjct: 102 FNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIRDV-----SPIASTY 156

Query: 113 -----LMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGW---KKMYAES----- 159
                L   A A   A   + P E +K K Q+   P  +     W   K +  E+     
Sbjct: 157 PTLNPLFCGAIARVFAATSIAPLELVKTKLQSI--PRSSKSTKTWMMVKDLLNETRQEMK 214

Query: 160 --GGMKAFYKGI-VPLWCRQIPYTMCKFTSFEKIVQKIYSVLPK-KKEEMNALQQISVSF 215
             G  +A +KG+ + LW R +P++   ++S+E   ++++    +   ++ N +  I+ SF
Sbjct: 215 MVGPSRALFKGLEITLW-RDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFIN-SF 272

Query: 216 VGGYLAGILCAAVSHPADV-----MVSKINSE--RKANESMSVAS--KRIYQKIGFTGLW 266
             G ++G++ A  +HP DV      +S +N+   +  N S ++    + I++  G   L+
Sbjct: 273 ASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAALY 332

Query: 267 NGLMVRIVMI 276
            GL  R++ I
Sbjct: 333 TGLAARVIKI 342

>Scas_645.9
          Length = 391

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 102/250 (40%), Gaps = 31/250 (12%)

Query: 53  YTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVY 112
           +   L+ F KI   EG   ++ G     +         + GYEY +       S      
Sbjct: 129 FNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLRDNSPLATSSPTFNP 188

Query: 113 LMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGW---KKMYAE-------SGGM 162
           LM  A A  LA   + P E +K K Q+   P  +     W   K++  E       SG  
Sbjct: 189 LMCGAIARILAASTVAPLELLKTKLQSI--PRVSKSTTSWMMVKELLKETRQEMRISGAS 246

Query: 163 KAFYKGI-VPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLA 221
            A +KG+ + LW R +P++   + S+E    K +  +   K   N    I+ SF+GG ++
Sbjct: 247 NALFKGLEITLW-RDVPFSAIYWGSYE--FCKTHLWMDTSKSHSNLTFFIN-SFIGGSIS 302

Query: 222 GILCAAVSHPADVMVSKINSERKANESMSVAS--------------KRIYQKIGFTGLWN 267
           G + A V+HP DV  ++       N   SV                + I++  G+  L+ 
Sbjct: 303 GTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGALYT 362

Query: 268 GLMVRIVMIG 277
           GL+ R+V I 
Sbjct: 363 GLVPRMVKIA 372

 Score = 32.3 bits (72), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 48/117 (41%), Gaps = 19/117 (16%)

Query: 1   MESNKQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVN----------- 49
           M+++K    +  +   F    ++ G IA   TH    P D+ K R Q++           
Sbjct: 280 MDTSKSHSNLTFFINSFIGG-SISGTIAALVTH----PFDVGKTRWQISFMGNNDKSVVK 334

Query: 50  -PKL-YTSNLQGF-RKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSS 103
            P +  T N+  F R I   EGW  +YTG     V  +   A     YE  K L+++
Sbjct: 335 SPDIEQTKNMFKFLRNIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLFNA 391

>Scas_602.8
          Length = 885

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/289 (21%), Positives = 120/289 (41%), Gaps = 31/289 (10%)

Query: 22  TLGGIIAC-GPTHSSITPLDLVKCRLQVNPKL--YTSNLQGFRKIIANEGWKKVYTGFGA 78
           +LG +  C G T   + P+D +K R+Q    L  Y +++    KI   EG + +Y+G G 
Sbjct: 503 SLGSVAGCIGAT--LVYPIDFIKTRMQAQRSLTKYKNSIDCLVKIFGKEGIRGLYSGLGP 560

Query: 79  TFVGYSLQGAGKYGGYEYF-KHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQ 137
             +G + + A K    ++  K L     +  +   +++ ATA     +   P E +K++ 
Sbjct: 561 QLIGVAPEKAIKLTVNDFMRKSLVDKKGNLQLGAEVLSGATAGACQVVFTNPLEIVKIRL 620

Query: 138 QTTMPPFCNNVVDGWKKMYAESGGMKAF-----------YKGIVPLWCRQIPYTMCKFTS 186
           Q         V   +         + AF           YKG+     R +P++   F +
Sbjct: 621 Q---------VKSEYTNAMIPKSQLTAFQIIKELKLIGLYKGVGACLLRDVPFSAIYFPT 671

Query: 187 FEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKAN 246
           +  + + ++   P  K++ + L+   +    G LAG+  A ++ P DV+ +++  E    
Sbjct: 672 YAHLKKNVFQFDPNDKDKRDRLKTWEL-LTAGALAGVPAAFLTTPFDVIKTRLQIEPGVG 730

Query: 247 ESMSV----ASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFK 291
           E+       A + I ++  F   + G   R++       F    Y+ FK
Sbjct: 731 ETRYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYELFK 779

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 49/106 (46%), Gaps = 8/106 (7%)

Query: 1   MESNKQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKL----YTSN 56
            + N + ++ +L T E      L G+ A   T    TP D++K RLQ+ P +    YT  
Sbjct: 682 FDPNDKDKRDRLKTWELLTAGALAGVPAAFLT----TPFDVIKTRLQIEPGVGETRYTGI 737

Query: 57  LQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYS 102
           L   R I+  E ++  + G  A  +  S Q       YE FK++++
Sbjct: 738 LHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYELFKNMFN 783

>Kwal_23.4731
          Length = 314

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/305 (21%), Positives = 133/305 (43%), Gaps = 41/305 (13%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIA---------NEGWKKVY 73
           + G+ A   T  +  PLDLVK RLQ+   + T++  G++++I          +  +++ Y
Sbjct: 18  IAGLAAGTLTTIATHPLDLVKLRLQL--LVNTTHSHGYKEVIKTIIRDSKADSNVFREAY 75

Query: 74  TGFGATFVGYSLQGAGKYGGYEYFKHL----------------YSSWLSPGVTVYLMASA 117
            G G   +G S+     +G Y + K +                +    + G ++YL ++A
Sbjct: 76  RGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASAA 135

Query: 118 TAEFLADIMLCPFEAIKVKQQTTMPPFCNN---VVDGWKKMYAESGGMKAFYKGIVPLWC 174
            +     I+  P   IK +  +T            DG +K+YA  G    F++G+VP   
Sbjct: 136 LSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEG-FSGFWRGLVPSLF 194

Query: 175 RQIPYTMCKFTSFEKIVQKIYSVLP-KKKEEMNALQQISVSFVGGYLAGILCAAVSHPAD 233
             +      FT ++ +  + ++     + E+M  L+ I+++ V    + +L     +P  
Sbjct: 195 -GVAQGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSV----SKMLSVTAVYPFQ 249

Query: 234 VMVSKINS----ERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDS 289
           ++ S + S    E++ +       K I+QK G  GL+ GL   ++     T   + IY++
Sbjct: 250 LLKSNLQSFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTCITFCIYEN 309

Query: 290 FKAYV 294
            + ++
Sbjct: 310 LRHWL 314

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 135/310 (43%), Gaps = 50/310 (16%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNL--QGF----RKIIANEG----WKKV 72
           + G+ A   T  S  PLDLVK RLQ    L  +N   QG+    ++I+ +      +++ 
Sbjct: 13  ISGLTAGTITTVSTHPLDLVKVRLQ----LLATNKKPQGYYDVVKRIVKDSKQHSFFRET 68

Query: 73  YTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT---------------VYLMASA 117
           Y G G   +G S+     +G Y   K     W +  V                +YL+A+A
Sbjct: 69  YRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYLLAAA 128

Query: 118 TAEFLADIMLCPFEAIKVKQQTTMPPFCNN-----VVDGWKKMYAESGGMKAFYKGIVPL 172
            +     ++  P   IK +  +T   F ++      VDG KK+Y    G+  F++G+VP 
Sbjct: 129 MSGVATSVLTNPIWVIKTRIMST--SFVDSRSYRSTVDGIKKLY-RIEGLAGFWRGLVPS 185

Query: 173 WCRQIPYTMCKFTSFEKIVQKIYSVLP-KKKEEMNALQQISVSFVGGYLAGILCAAVSHP 231
               +      FT ++ +    ++     KK++++ L+ I+++     L+ ++     +P
Sbjct: 186 -LFGVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITIT----SLSKMVSVTAVYP 240

Query: 232 ADVMVSKINSERKANESMSVASKR-------IYQKIGFTGLWNGLMVRIVMIGTLTSFQW 284
             ++ S + S   +       S R       IY + G TGL+ GL+  ++     T   +
Sbjct: 241 LQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCITF 300

Query: 285 LIYDSFKAYV 294
            +Y++F+ ++
Sbjct: 301 CVYENFRHWL 310

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 117/295 (39%), Gaps = 45/295 (15%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSN--LQGFRKIIANEGWKKVYTGFGATF 80
           L G  A    HS + P+D +K R+Q +     +   ++   KI   EG   ++ G  +  
Sbjct: 21  LAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKGVQSVI 80

Query: 81  VGYSLQGAGKYGGYEYFKHLYSSWLSP---------GVTVYLMASATAEFLADIMLCPFE 131
           +G     A  +  YE+ K   S  + P            +  MA+ T   +AD ++ PF+
Sbjct: 81  LGAGPAHAVYFATYEFSK---SKLIDPQDMHTHQPIKTAISGMAATT---VADALMNPFD 134

Query: 132 AIKVKQQTTMPPFCNNVVDGW---KKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFE 188
            IK + Q       N     W   K +Y + G   AFY          IP+    F  +E
Sbjct: 135 VIKQRMQ------LNTRESVWHVTKNIYHKEG-FAAFYYSYPTTLVMNIPFAAFNFAIYE 187

Query: 189 KIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKIN---SERKA 245
              + +         E N      +  + G L+G  CAA++ P D + + +    SE  +
Sbjct: 188 SATKFM-----NPSNEYNPF----IHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVS 238

Query: 246 NESM------SVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
           NE M        A+  IY+  G+ G   GL  R++     T+  W  Y+  K ++
Sbjct: 239 NEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYECAKHFL 293

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 78/178 (43%), Gaps = 10/178 (5%)

Query: 113 LMASATAEFLADIMLCPFEAIKVK-QQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVP 171
           L+A A A  +   +L P +AIK + Q ++       ++    K+    G + A +KG+  
Sbjct: 20  LLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSL-ALWKGVQS 78

Query: 172 LWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHP 231
           +     P     F ++E    K+        ++M+  Q I  + + G  A  +  A+ +P
Sbjct: 79  VILGAGPAHAVYFATYEFSKSKLID-----PQDMHTHQPIKTA-ISGMAATTVADALMNP 132

Query: 232 ADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDS 289
            DV+  ++  +    ES+   +K IY K GF   +      +VM     +F + IY+S
Sbjct: 133 FDVIKQRM--QLNTRESVWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYES 188

>Scas_582.7
          Length = 329

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 120/290 (41%), Gaps = 30/290 (10%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVN-----PKLYTSNLQGFRKIIANEGWKKVYTGFG 77
           L G  A    HS++ P+D +K R+Q        +  TS ++   KI   EG   ++ G  
Sbjct: 41  LAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWKGVQ 100

Query: 78  ATFVGYSLQGAGKYGGYEYFK-HLY--SSWLSPGVTVYLMASATAEFLADIMLCPFEAIK 134
           +  +G     A  +  YE+ K HL   S   +       ++ ATA   +D  + PF+ IK
Sbjct: 101 SVILGAGPAHAVYFATYEFTKAHLIPDSQRETHQPIKVAVSGATATVASDFFMNPFDTIK 160

Query: 135 VKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKI 194
            + Q +       V +  KK+Y    G+ AFY          IP+    F  +E    K 
Sbjct: 161 QRMQISDLK-KEKVYNVAKKIY-NLEGLSAFYYSYPTTIAMNIPFAAFNFMIYES-ASKF 217

Query: 195 YSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVM----------VSKINSERK 244
           ++ L       N L    +  + G ++G + AAV+ P D +          V  +   +K
Sbjct: 218 FNPL----HHYNPL----IHCLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVVSLEVMKK 269

Query: 245 ANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
           AN +   A+  I    G+ G W GL  RI+     T+  W  Y+  K ++
Sbjct: 270 AN-TFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYECAKHFL 318

 Score = 35.0 bits (79), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 76/181 (41%), Gaps = 11/181 (6%)

Query: 113 LMASATAEFLADIMLCPFEAIKVKQQTT----MPPFCNNVVDGWKKMYAESGGMKAFYKG 168
           L+A A A  +    + P +A+K + Q+T          +++    K+    G + A +KG
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSL-ALWKG 98

Query: 169 IVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAV 228
           +  +     P     F ++E    K + ++P  + E +  Q I V+ V G  A +     
Sbjct: 99  VQSVILGAGPAHAVYFATYE--FTKAH-LIPDSQRETH--QPIKVA-VSGATATVASDFF 152

Query: 229 SHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYD 288
            +P D +  ++       E +   +K+IY   G +  +      I M     +F ++IY+
Sbjct: 153 MNPFDTIKQRMQISDLKKEKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFMIYE 212

Query: 289 S 289
           S
Sbjct: 213 S 213

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 42/97 (43%), Gaps = 5/97 (5%)

Query: 203 EEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINS-ERKANESMSVASKRIYQKI- 260
           E + A   +S   + G  AGI+  +   P D + ++I S   K  E  S +  +   KI 
Sbjct: 28  EALPAHAPLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKIS 87

Query: 261 ---GFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
              G   LW G+   I+  G   +  +  Y+  KA++
Sbjct: 88  TMEGSLALWKGVQSVILGAGPAHAVYFATYEFTKAHL 124

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/256 (23%), Positives = 113/256 (44%), Gaps = 27/256 (10%)

Query: 38  PLDLVKCRLQVN------PKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKY 91
           PLD+VK  +Q+       P+ Y       ++I A EG  ++Y G  +  +  + + A K+
Sbjct: 29  PLDMVKTVMQLQVSGGSGPQ-YKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKF 87

Query: 92  GGYEYFKHLYSSWLSP---GVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNV 148
              + F+ +Y            + +++ A+A      ++ PFE +K++ Q     F + +
Sbjct: 88  ACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPI 147

Query: 149 VDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNAL 208
                K   E  G+ A Y G+     R   +    F     I+ ++ ++LPK   +    
Sbjct: 148 --AVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG----IIFQVRALLPKASTKS--- 198

Query: 209 QQISVSFVGGYLAGILCAAVSHPADVMVSKINS-------ERKANESMSVASKRIYQKIG 261
           +Q     + G + G L + +S P DV+ S++ +        RK N S   A   IY++ G
Sbjct: 199 EQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWP-ALATIYKEEG 257

Query: 262 FTGLWNGLMVRIVMIG 277
           F  L+ G + +++ +G
Sbjct: 258 FKALYKGFVPKVLRLG 273

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 65/150 (43%), Gaps = 8/150 (5%)

Query: 36  ITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYE 95
           + P +LVK RLQ     +TS +   + I+  EG   +Y G  +T   + +  AG +G   
Sbjct: 126 VVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIF 185

Query: 96  YFKHLY--SSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTT-----MPPFCNNV 148
             + L   +S  S      L+A      L+ ++  PF+ +K + Q T     +P   N  
Sbjct: 186 QVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWS 245

Query: 149 VDGWKKMYAESGGMKAFYKGIVPLWCRQIP 178
                 +Y E  G KA YKG VP   R  P
Sbjct: 246 WPALATIYKEE-GFKALYKGFVPKVLRLGP 274

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/296 (23%), Positives = 131/296 (44%), Gaps = 43/296 (14%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQ-GFR----KIIANEG--WKKVYTG 75
           + G+ A   T   + PLDL K RLQ+   L TS  + G+R    +I+ ++    +++Y G
Sbjct: 13  ISGLTAGSVTTLIVHPLDLFKVRLQL---LITSTTKKGYRNLWSEIVGSDLSLTRELYRG 69

Query: 76  FGATFVGYSLQGAGKYGGYEYFKHLY-------------SSWLSPGVTVYLMASATAEFL 122
                VG ++     +  Y   K                SSW+      YL ASA++  L
Sbjct: 70  LTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWM------YLSASASSGML 123

Query: 123 ADIMLCPFEAIKVKQQTTMPPFCNNVVDGWK--KMYAESGGMKAFYKGIVPLWCRQIPYT 180
             ++  P   IK    T M    N+ +   K  +   ++ G++  +KG+VP     +   
Sbjct: 124 TTVLTNPLWVIK----TRMMSKANSDLTSMKVLRDLIKNDGVQGLWKGLVPALV-GVSQG 178

Query: 181 MCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKIN 240
              FT ++ +  K+  +  +  +E+  L+ I+V+ V    + +L  +  +P  ++ S + 
Sbjct: 179 ALHFTCYDTLKHKLV-LKNRDSDEITNLETIAVTSV----SKMLSTSAVYPFQLLKSNLQ 233

Query: 241 SERKANESMSVA--SKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
           S + +     +   SK IY + G  G + GL   ++     T   + IY++FK+++
Sbjct: 234 SFQASENDFKLLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYENFKSFL 289

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 109/261 (41%), Gaps = 32/261 (12%)

Query: 42  VKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLY 101
           + CR Q     +   L+ F KI   EG   ++ G   T +         + GYEY +   
Sbjct: 103 LNCRNQK----FNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDRS 158

Query: 102 S-SWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTT-MPPFCNNVVDGWKKMYAE- 158
             + L P +   L+  A A  LA   + P E IK K Q+       N  V  ++ ++ E 
Sbjct: 159 PLNGLYPTINP-LICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEI 217

Query: 159 ------SGGMKAFYKGI-VPLWCRQIPYTMCKFTSFEKIVQKIYSVLPK--KKEEMNALQ 209
                  G  +  +KG+ + LW R +P++   + S+E    K+  + P    K   N   
Sbjct: 218 KSEIAMRGVAQTMFKGLEITLW-RDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFH 276

Query: 210 QISVSFVGGYLAGILCAAVSHPADV-----MVSKINSERKANESMSVASKR--------I 256
             + SF+GG+++G L A  +HP DV      +S +  ++ AN ++   S          I
Sbjct: 277 -FTNSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYI 335

Query: 257 YQKIGFTGLWNGLMVRIVMIG 277
            +  G   L+ GL  R+  I 
Sbjct: 336 RKTEGIGALYTGLAPRVAKIA 356

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 71/187 (37%), Gaps = 33/187 (17%)

Query: 34  SSITPLDLVKCRLQVNPK---------LYTSNLQGFRKIIANEG-WKKVYTGFGATFVGY 83
           +S+ PL+L+K +LQ  P          +Y       +  IA  G  + ++ G   T    
Sbjct: 182 TSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGVAQTMFKGLEITLWRD 241

Query: 84  SLQGAGKYGGYEYFKHLYSSWLSPGV-----------TVYLMASATAEFLADIMLCPFEA 132
               A  +  YE++K    ++LSP             T   +    +  LA I   PF+ 
Sbjct: 242 VPFSAIYWASYEFYKTKV-AYLSPSTFDKNSSNWFHFTNSFLGGFISGSLAAICTHPFDV 300

Query: 133 IKVKQQTTMPPF-----------CNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTM 181
            K +QQ ++               +N + G+     ++ G+ A Y G+ P   +  P   
Sbjct: 301 GKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEGIGALYTGLAPRVAKIAPSCA 360

Query: 182 CKFTSFE 188
              +S+E
Sbjct: 361 IMISSYE 367

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/297 (22%), Positives = 127/297 (42%), Gaps = 27/297 (9%)

Query: 14  TKEFYATCTLGGIIACGPTHSSIT-PLDLVKCRLQV---NPKLYTSNLQGFRKIIANEGW 69
           TK F A    G +       +SIT P +  K RLQ+   + K   + L         +G 
Sbjct: 11  TKSFVAGALAGAV------EASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAKTQGV 64

Query: 70  KKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT--VYLMASATAEFLADIM- 126
             +Y G  A  VG + + A ++ GY+  ++L     +  ++    ++A   A  L  ++ 
Sbjct: 65  GAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGELSGPRGVLAGLGAGLLESVVA 124

Query: 127 LCPFEAIKV----KQQTTMPPFCNNVVDGWKKMYA--ESGGMKAFYKGIVPLWCRQIPYT 180
           + PFEAIK      +Q+  P + NN     +   +  +  G +  Y G++P+  RQ    
Sbjct: 125 VTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQAANQ 184

Query: 181 MCKFTSFEKI--VQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSK 238
             +   + KI  + + Y+  PK K   + L     +F+ G  +G++    + P D + ++
Sbjct: 185 AVRLGCYNKIKVLVQDYTGAPKDKPLTSGL-----TFIVGAFSGVVTVYATMPIDTVKTR 239

Query: 239 INSERKANESMSVAS-KRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
           + S   +  S ++     IY++ G    W G   R+  +       + IY++   Y+
Sbjct: 240 MQSLTASKYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVLLYL 296

>Scas_691.4
          Length = 334

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 60/296 (20%), Positives = 122/296 (41%), Gaps = 52/296 (17%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQGF----RKIIANEGWKKVYTGFGATFVGYSLQGAGKYGG 93
           PLD +K R+Q+  +       GF    R I ++EG+  +Y G GA  +G   + A ++  
Sbjct: 33  PLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHEGFLALYKGLGAVVIGIIPKMAIRFSS 92

Query: 94  YEYFKHLYSSWLSPGVT---VYLMASATAEFLADIMLCPFEAIKVKQQT----------- 139
           YE++++  +   +  +T    +L         A +++ P E +K++ Q            
Sbjct: 93  YEFYRNALTDKETRTITTGNTFLAGVGAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPA 152

Query: 140 -----------TMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFE 188
                      T P + N +   +  +  E  G  A Y+G+     RQ       FT   
Sbjct: 153 GVSAAGTAATVTKPKYANAIHAAYTIVKEEGAG--ALYRGVSLTAARQATNQGANFT--- 207

Query: 189 KIVQKIYSVLP---KKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKA 245
                +YS L    +K     +L     S + G ++G +    + P D + +++  ++  
Sbjct: 208 -----VYSYLKDYLQKYHNRESLPSWETSCI-GLISGAIGPFSNAPLDTIKTRLQKDKSI 261

Query: 246 NESMSVASKRIY-------QKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
             S + A K+IY       ++ GF  L+ G+  R++ +    +  + +Y+  + ++
Sbjct: 262 --SSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRKHL 315

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 60/290 (20%), Positives = 124/290 (42%), Gaps = 38/290 (13%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNP------------KLYTSNLQGFRKIIANEGWK 70
           + G +A     + + PLD+VK R Q+              + Y   +   +KI+  EG+ 
Sbjct: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76

Query: 71  KVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT---VYLMASATAEFLADIML 127
           ++Y G  +  +  + + A K+   + ++ ++ +  +   T   + + A A+A      ++
Sbjct: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIAAGASAGMTEAAVI 136

Query: 128 CPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSF 187
            PFE IK++ Q     +    +D  KK     G M   YKGI     R   +    F   
Sbjct: 137 VPFELIKIRMQDVKSSYLGP-MDCLKKTIKNEGIM-GLYKGIESTMWRNALWNGGYFG-- 192

Query: 188 EKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANE 247
             ++ ++ + +P  K +    Q+     + G + G +   ++ P DV+ S+I S     +
Sbjct: 193 --VIYQVRNSMPVAKTKG---QKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSV----D 243

Query: 248 SMSVASKR----------IYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIY 287
           ++S A K+          IY++ GF  L+ G + ++  +    S   +++
Sbjct: 244 AVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 80/191 (41%), Gaps = 22/191 (11%)

Query: 4   NKQPRKI--QLY-TKEFYATCTLGGIIACGPTHSS-ITPLDLVKCRLQVNPKLYTSNLQG 59
           N Q +KI   L+ T E     ++    + G T ++ I P +L+K R+Q     Y   +  
Sbjct: 100 NDQYQKIFKNLFNTNETTQKISIAAGASAGMTEAAVIVPFELIKIRMQDVKSSYLGPMDC 159

Query: 60  FRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVY--LMASA 117
            +K I NEG   +Y G  +T    +L   G +G     ++      + G      L+A A
Sbjct: 160 LKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGA 219

Query: 118 TAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKK----------MYAESGGMKAFYK 167
               +  ++  PF+ +K + Q+      + V    KK          +Y E  G +A YK
Sbjct: 220 IGGTVGTMLNTPFDVVKSRIQS-----VDAVSSAVKKYNWCLPSLLVIYREE-GFRALYK 273

Query: 168 GIVPLWCRQIP 178
           G VP  CR  P
Sbjct: 274 GFVPKVCRLAP 284

>Scas_589.10
          Length = 316

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 86/188 (45%), Gaps = 13/188 (6%)

Query: 3   SNKQPRKIQLYT---KEFYATCTLGGIIACGPTHSSIT-PLDLVKCRLQVNPKLYTSNLQ 58
           SN+Q ++I +     KE  +T TL      G T S I  P +LVK RLQ     Y S ++
Sbjct: 103 SNEQFQQIMMKKFKLKEVTSTVTLLAGTFAGITESLIVVPFELVKIRLQDAQSDYRSPIR 162

Query: 59  GFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGY----EYFKHLYSSWLSPGVTVYLM 114
             R II N+G   +Y GF +T    ++  A  +G      ++     S+    G+    +
Sbjct: 163 CTRTIIENQGLFGIYAGFESTIWRNTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRNDFL 222

Query: 115 ASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWK----KMYAESGGMKAFYKGIV 170
             A A  ++  +  PF+ +K + Q +     + +  GW      +   + G+K  YKGI+
Sbjct: 223 VGAIAGCMSCFLSVPFDVVKTRMQGSKKT-SSGMCYGWAWQSVFLIYRTEGIKGIYKGIL 281

Query: 171 PLWCRQIP 178
           P+ CR  P
Sbjct: 282 PIICRYGP 289

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/256 (22%), Positives = 107/256 (41%), Gaps = 30/256 (11%)

Query: 38  PLDLVKCR--LQVNPKL-------------YTSNLQGFRKIIANEGWKKVYTGFGATFVG 82
           PLD+VK R  LQ+N K              ++S L    KI+  EG+K +Y G     + 
Sbjct: 33  PLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKEEGFKNLYKGMSPPLLM 92

Query: 83  YSLQGAGKYGGYEYFKHLYSSWL---SPGVTVYLMASATAEFLADIMLCPFEAIKVKQQT 139
              + A K+   E F+ +            TV L+A   A     +++ PFE +K++ Q 
Sbjct: 93  EVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLLAGTFAGITESLIVVPFELVKIRLQD 152

Query: 140 TMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLP 199
               + + +     +   E+ G+   Y G      R   +      S+  ++ ++   +P
Sbjct: 153 AQSDYRSPI--RCTRTIIENQGLFGIYAGFESTIWRNTIWN----ASYFGLIFQVKKFIP 206

Query: 200 KKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSV-----ASK 254
           + K      Q I   F+ G +AG +   +S P DV+ +++   +K +  M       +  
Sbjct: 207 RAKST-TKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQGSKKTSSGMCYGWAWQSVF 265

Query: 255 RIYQKIGFTGLWNGLM 270
            IY+  G  G++ G++
Sbjct: 266 LIYRTEGIKGIYKGIL 281

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/174 (20%), Positives = 74/174 (42%), Gaps = 27/174 (15%)

Query: 113 LMASATAEFLADIMLCPFEAIKVKQQTTM--------------PPFCNNVVDGWKKMYAE 158
            ++ A A     IM+ P + +K + Q  +               P  ++++    K+  E
Sbjct: 17  FISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKE 76

Query: 159 SGGMKAFYKGIVPLWCRQIPYTMCKFTS---FEKIVQKIYSVLPKKKEEMNALQQISVSF 215
            G  K  YKG+ P    ++P    KF S   F++I+ K +     K +E+ +    +V+ 
Sbjct: 77  EG-FKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKF-----KLKEVTS----TVTL 126

Query: 216 VGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGL 269
           + G  AGI  + +  P +++  ++   +    S    ++ I +  G  G++ G 
Sbjct: 127 LAGTFAGITESLIVVPFELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIYAGF 180

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/283 (20%), Positives = 120/283 (42%), Gaps = 34/283 (12%)

Query: 38  PLDLVKCRLQVNPK---LYTSNLQGF----RKIIANEGWKKVYTGFGATFVGYSLQGAGK 90
           PLD +K R+Q+  +   +      GF    R I   EG+  +Y G GA  +G   + A +
Sbjct: 30  PLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLGAVVIGIIPKMAIR 89

Query: 91  YGGYEYFKHLY----SSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQT------- 139
           +  YE+++ L     S  +S G T ++         A +++ P E +K++ Q        
Sbjct: 90  FSSYEFYRTLLVNKESGIVSTGNT-FVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPSE 148

Query: 140 -TMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVL 198
               P  NN +     +  E  G+ A Y+G+     RQ       FT + K+ + +    
Sbjct: 149 PNAGPKYNNAIHAAYTIVKEE-GVSALYRGVSLTAARQATNQGANFTVYSKLKEFL---- 203

Query: 199 PKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRI-- 256
            +   +M+ L     S + G ++G +    + P D + +++  ++  +       K+I  
Sbjct: 204 -QNYHQMDVLPSWETSCI-GLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGMKKIIT 261

Query: 257 -----YQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
                 ++ GF  L+ G+  R++ +    +  + +Y+  + ++
Sbjct: 262 IGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVREHL 304

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 84/204 (41%), Gaps = 32/204 (15%)

Query: 111 VYLMASATAEFLADIMLCPFEAIKVKQQT---------TMPPFCNNVVDGWKKMYAESGG 161
           + LMA  TA     +   P + IKV+ Q            PP     +   + +Y + G 
Sbjct: 12  INLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPP---GFIKTGRTIYQKEGF 68

Query: 162 MKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLA 221
           + A YKG+  +    IP    +F+S+E      Y  L   KE  + +     +FV G  A
Sbjct: 69  L-ALYKGLGAVVIGIIPKMAIRFSSYE-----FYRTLLVNKE--SGIVSTGNTFVAGVGA 120

Query: 222 GILCAA-VSHPADVM----------VSKINSERKANESMSVASKRIYQKIGFTGLWNGLM 270
           GI  A  V +P +V+           S+ N+  K N ++  A+  I ++ G + L+ G+ 
Sbjct: 121 GITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIH-AAYTIVKEEGVSALYRGVS 179

Query: 271 VRIVMIGTLTSFQWLIYDSFKAYV 294
           +      T     + +Y   K ++
Sbjct: 180 LTAARQATNQGANFTVYSKLKEFL 203

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 49/226 (21%), Positives = 81/226 (35%), Gaps = 44/226 (19%)

Query: 10  IQLYTKEFYATCTLG---GIIACGPTHSS------------ITPLDLVKCRLQVN----- 49
           I+  + EFY T  +    GI++ G T  +            + P+++VK RLQ       
Sbjct: 88  IRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPS 147

Query: 50  -----PKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSW 104
                PK Y + +     I+  EG   +Y G   T    +      +  Y   K    ++
Sbjct: 148 EPNAGPK-YNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVYSKLKEFLQNY 206

Query: 105 LSPGVT-------VYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYA 157
               V        + L++ A   F       P + IK + Q            G KK+  
Sbjct: 207 HQMDVLPSWETSCIGLISGAIGPFSN----APLDTIKTRLQKDKS-ISLEKQSGMKKIIT 261

Query: 158 ------ESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSV 197
                 +  G +A YKGI P   R  P     FT +E + + + ++
Sbjct: 262 IGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVREHLENL 307

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 120/294 (40%), Gaps = 31/294 (10%)

Query: 21  CTLGGIIACGPTHSSITPLDLVKCRLQVNPKL--YTSNLQGFRKIIANEGWKK-VYTGFG 77
           C L G I      S++  LD VK R Q  P    Y + +  +R II  EG +K +Y G+ 
Sbjct: 58  CMLAGGIGGAIGDSAMHSLDTVKTRQQGAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYS 117

Query: 78  ATFVGYSLQGAGKYGGYEYFKH-LYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVK 136
              +G     A  +  YEY K  +   W       +L A    +F++  +  P E +K +
Sbjct: 118 GAMLGSFPSAAIFFATYEYTKRKMIGEWGINETFSHLTAGFLGDFISSFVYVPSEVLKTR 177

Query: 137 QQTT---MPPFCN------NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSF 187
            Q       PF        N+ D    +    G    F+ G      R +P++  +F  +
Sbjct: 178 LQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPTLFF-GYKATLSRDLPFSGLQFAFY 236

Query: 188 EKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSE----- 242
           EK  Q  ++V  K  +E  +L   S   + G  AG L   ++ P DV+ ++I ++     
Sbjct: 237 EKFRQLAFAVENKTFDEDLSL---SNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIP 293

Query: 243 ---------RKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIY 287
                    +    S++     +Y+  G  GL++G+  R +     +S   L+Y
Sbjct: 294 ENSSQNLKQQTLTNSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLY 347

>Kwal_23.3965
          Length = 307

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 90/185 (48%), Gaps = 15/185 (8%)

Query: 113 LMASATAEFLADIMLCPFEAIKVKQQTTMPPFCN--NVVDGWKKMYAESGGMKAFYKGIV 170
           L+A   +   A I+  P + +K++ Q  +        ++  +K++  + G ++A +KG V
Sbjct: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEG-VRALWKGNV 76

Query: 171 PLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSH 230
           P     I Y   +FTS+  I+ K+ S     K ++ A  QI    VG  L+G   A  S+
Sbjct: 77  PAMAMYILYGSTQFTSY-AILNKLLS-----KSQLPA--QIHTGMVGA-LSGTCSAIASY 127

Query: 231 PADVMVSKI--NSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYD 288
           P DV+ ++   N  R+ +  +S A + I++  GF G + G+   IV I   TS     Y+
Sbjct: 128 PCDVLRTRFIANHSRELSTMLSTA-QEIWRHEGFRGFFKGVSSSIVSIAVATSSILATYE 186

Query: 289 SFKAY 293
           S K +
Sbjct: 187 SVKIF 191

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/266 (22%), Positives = 106/266 (39%), Gaps = 32/266 (12%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVG 82
           L G  A   T     P+D +K RLQ     +           AN G+K +Y G G+  V 
Sbjct: 9   LSGAAAGTSTDLVFFPIDTIKTRLQAKGGFF-----------ANGGYKGIYRGLGSAVVA 57

Query: 83  YSLQGAGKYGGYEYFKHLYSSWLSP----------GVTVYLMASATAEFLADIMLCPFEA 132
            +   +  +  Y+Y K     ++S             T ++++S+  E  A ++  P E 
Sbjct: 58  SAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVPAEV 117

Query: 133 IKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQ 192
           +K + Q          +    +   + G  K  Y+G      R+IP+T  +F        
Sbjct: 118 VKQRTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQF-------- 169

Query: 193 KIYSVLPKKKEEMNALQQISV--SFVGGYLAGILCAAVSHPADVMVSKINSERKANESMS 250
            +Y  L K   + N   Q+      + G +AG + AA + P D + +++    K   S+ 
Sbjct: 170 PLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLN-KTTASLG 228

Query: 251 VASKRIYQKIGFTGLWNGLMVRIVMI 276
               RIY++ G    ++G+  R + I
Sbjct: 229 SVIIRIYREEGPAVFFSGVGPRTMWI 254

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 54/281 (19%), Positives = 122/281 (43%), Gaps = 36/281 (12%)

Query: 38  PLDLVKCRLQVNPKLYT-SNLQGFRKIIAN----EGWKKVYTGFGATFVGYSLQGAGKYG 92
           PLD +K R+Q+  +    +   GF +  AN    EG    Y G GA  +G   + A ++ 
Sbjct: 77  PLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFS 136

Query: 93  GYEYFKHLYSSW----LSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQ-------TTM 141
            YE+++ L +      +S G T +L         A +++ P E +K++ Q          
Sbjct: 137 SYEFYRTLLADRQTGVVSTGNT-FLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQ 195

Query: 142 PPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKK 201
             + N +   +  +  +  G+ A Y+G+     RQ       FT + K+++++       
Sbjct: 196 QKYRNAIQAAY--LIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERL------- 246

Query: 202 KEEMNALQQI---SVSFVGGYLAGILCAAVSHPADVMVSKINSERKANE-----SMSVAS 253
            +E +  Q +     S + G ++G +    + P D + +++  ++          ++   
Sbjct: 247 -QEYHGSQNLPSWETSLI-GLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIG 304

Query: 254 KRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
           +++ Q+ GF  L+ G+  R++ +    +  + +Y+  + ++
Sbjct: 305 RQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 36/85 (42%), Gaps = 5/85 (5%)

Query: 212 SVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMS-----VASKRIYQKIGFTGLW 266
           +V+ V G  AG+  A   HP D +  ++   R+ANE             IY   G    +
Sbjct: 58  AVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFY 117

Query: 267 NGLMVRIVMIGTLTSFQWLIYDSFK 291
            GL   ++ I    + ++  Y+ ++
Sbjct: 118 KGLGAVVIGIIPKMAIRFSSYEFYR 142

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/274 (22%), Positives = 122/274 (44%), Gaps = 34/274 (12%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQ--GFRK----IIANEGWKKVYTGFGATFVGYSLQGAGKY 91
           PLD +K R+Q+      S ++  GF K    I  NEG+   Y G GA  +G + + A ++
Sbjct: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89

Query: 92  GGYEYFKHLYSS----WLSPGVT-VYLMASATAEFLADIMLCPFEAIKVKQQTTMP---- 142
             YE+++ L +      +S G T +  + +   E +  +       I+++ Q   P    
Sbjct: 90  SSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAVVVVNPMEVVKIRLQAQHLNPVEGA 149

Query: 143 PFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKK 202
           P   N V     +  E  G  A Y+G+     RQ       FT + K+ + +        
Sbjct: 150 PKYKNAVQACYTIVKEE-GFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGY---HN 205

Query: 203 EEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMS------VASKRI 256
           +EM  L     S + G ++G +    + P D + +++  + K+ ++MS      +  K++
Sbjct: 206 QEM--LPSWETSLI-GLISGAIGPFSNAPLDTIKTRLQKD-KSTKNMSGLKRITIIGKQL 261

Query: 257 YQKIGFTGLWNGLMVRIVMIG-----TLTSFQWL 285
            Q+ GF  L+ G+  R++ +      T T+++++
Sbjct: 262 IQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFI 295

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 69/181 (38%), Gaps = 45/181 (24%)

Query: 43  KCRLQ---VNP----KLYTSNLQGFRKIIANEGWKKVYTGF-----------GATFVGYS 84
           K RLQ   +NP      Y + +Q    I+  EG+  +Y G            GA F  YS
Sbjct: 135 KIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYS 194

Query: 85  -----LQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQT 139
                LQG        + + +  SW +    + L++ A   F       P + IK + Q 
Sbjct: 195 KLKEFLQGY-------HNQEMLPSWETS--LIGLISGAIGPFSN----APLDTIKTRLQK 241

Query: 140 TMPPFCNNVVDGWK------KMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQK 193
                    + G K      K   +  G +A YKGI P   R  P     FT++E I ++
Sbjct: 242 DK---STKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKE 298

Query: 194 I 194
           +
Sbjct: 299 L 299

>Kwal_26.7967
          Length = 297

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 115/266 (43%), Gaps = 20/266 (7%)

Query: 23  LGGIIACGPTHSSIT-PLDLVKCRLQVNPKLYTSNLQGFRKIIAN---EGWKKVYTGFGA 78
           L G +A G   +SIT P +  K RLQ+  K  T++      I      +G   VY G  A
Sbjct: 14  LAGSLA-GAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKVQGLGAVYVGCPA 72

Query: 79  TFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT--VYLMASATAEFLADIM-LCPFEAIKV 135
             VG + +   ++ G++  K++     +  ++    ++A   A  L  ++ + PFEAIK 
Sbjct: 73  FIVGNTAKAGVRFLGFDAIKNILRDPTTGELSGPRGIVAGLGAGLLESVVAVTPFEAIKT 132

Query: 136 ----KQQTTMPPFCNNVVDGWKKMYAE---SGGMKAFYKGIVPLWCRQIPYTMCKFTSFE 188
                +Q+  P + NN   G  + Y+      G    Y+G++P+  RQ      +   + 
Sbjct: 133 ALIDDKQSASPKYHNNG-RGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAANQAVRLGCYN 191

Query: 189 KIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANES 248
           KI   I       K++        ++FV G  +GI+    + P D + +++ S   +  S
Sbjct: 192 KIKTMIQDYTNSAKDKP---LSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSSKYS 248

Query: 249 MSVAS-KRIYQKIGFTGLWNGLMVRI 273
            ++     ++++ G    W G   R+
Sbjct: 249 STINCFATVFREEGLKTFWKGATPRL 274

 Score = 36.6 bits (83), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 35/173 (20%), Positives = 75/173 (43%), Gaps = 19/173 (10%)

Query: 35  SITPLDLVKCRL-----QVNPKLYTSN---LQGFRKIIANEGWKKVYTGFGATFVGYSLQ 86
           ++TP + +K  L       +PK + +    L+ +  ++ ++G+  +Y G     +  +  
Sbjct: 123 AVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAAN 182

Query: 87  GAGKYGGYEYFKHLYSSW--------LSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQ 138
            A + G Y   K +   +        LS G+T   +  A +  +      P + +K + Q
Sbjct: 183 QAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMT--FVVGAFSGIVTVYTTMPIDTVKTRMQ 240

Query: 139 TTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIV 191
           +      ++ ++ +  ++ E G +K F+KG  P   R I      FT +EK++
Sbjct: 241 SLDSSKYSSTINCFATVFREEG-LKTFWKGATPRLGRLILSGGIVFTIYEKVL 292

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 65/269 (24%), Positives = 118/269 (43%), Gaps = 26/269 (9%)

Query: 23  LGGIIACGPTHSSIT-PLDLVKCRLQVNPKLYTSN---LQGFRKIIANEGWKKVYTGFGA 78
           L G +A G   + IT P +  K RLQ+  K   ++   L    K    +G   +Y G  A
Sbjct: 17  LAGSLA-GAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKTAKTQGIGSIYVGCPA 75

Query: 79  TFVGYSLQGAGKYGGYEYFKHLYSSWLSPGV--TVYLMASATAEFLADIM-LCPFEAIKV 135
             +G + +   ++ G++  K +     +  +  T  ++A   A  L  +  + PFEAIK 
Sbjct: 76  FIIGNTAKAGIRFLGFDTIKDMLRDSETGELSGTRGVIAGLGAGLLESVAAVTPFEAIKT 135

Query: 136 ----KQQTTMPPFCNN---VVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFE 188
                +Q+  P + NN   VV  +  +  + G     Y+G++P+  RQ      +   + 
Sbjct: 136 ALIDDKQSATPKYHNNGRGVVRNYSSLVRDKG-FSGLYRGVLPVSMRQAANQAVRLGCYN 194

Query: 189 KIVQKI--YSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINS--ERK 244
           KI   I  Y+  PK K   + L     +F+ G  +GI+    + P D + +++ S    K
Sbjct: 195 KIKTLIQDYTDSPKDKPLSSGL-----TFLVGAFSGIVTVYSTMPLDTVKTRMQSLDSTK 249

Query: 245 ANESMSVASKRIYQKIGFTGLWNGLMVRI 273
            + +M+  +  I+++ G    W G   R+
Sbjct: 250 YSSTMNCFAT-IFKEEGLKTFWKGATPRL 277

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 34/174 (19%), Positives = 75/174 (43%), Gaps = 19/174 (10%)

Query: 34  SSITPLDLVKCRL-----QVNPKLYTSN---LQGFRKIIANEGWKKVYTGFGATFVGYSL 85
           +++TP + +K  L        PK + +    ++ +  ++ ++G+  +Y G     +  + 
Sbjct: 125 AAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAA 184

Query: 86  QGAGKYGGYEYFKHLYSSW--------LSPGVTVYLMASATAEFLADIMLCPFEAIKVKQ 137
             A + G Y   K L   +        LS G+T   +  A +  +      P + +K + 
Sbjct: 185 NQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLT--FLVGAFSGIVTVYSTMPLDTVKTRM 242

Query: 138 QTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIV 191
           Q+      ++ ++ +  ++ E G +K F+KG  P   R +      FT +EK++
Sbjct: 243 QSLDSTKYSSTMNCFATIFKEEG-LKTFWKGATPRLGRLVLSGGIVFTIYEKVL 295

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 91/187 (48%), Gaps = 17/187 (9%)

Query: 113 LMASATAEFLADIMLCPFEAIKVKQQTT----MPPFCNNVVDGWKKMYAESGGMKAFYKG 168
           L+A A +  LA  +  P + IK++ Q T    + PF + V++  + M  ++ G+++F+KG
Sbjct: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSM-IKNEGIRSFWKG 78

Query: 169 IVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAV 228
            +P     + Y   +F+S        YS+  +       L+    S V G  AGI  + V
Sbjct: 79  NIPGSLLYVTYGSAQFSS--------YSLFNRYLTPF-GLEARLHSLVVGAFAGITSSIV 129

Query: 229 SHPADVMVSKINSERKANESMSVAS--KRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLI 286
           S+P DV+ +++ +  + + SMS+    + I++  G  G + G +  +  I    S  +  
Sbjct: 130 SYPFDVLRTRLVANNQMH-SMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGT 188

Query: 287 YDSFKAY 293
           Y++ + Y
Sbjct: 189 YETIRIY 195

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 86/218 (39%), Gaps = 23/218 (10%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNP----KLYTSN-LQGFRKIIANEGWKKVYTGFG 77
           L G ++     S   P+D +K RLQ+ P    K + S  ++  R +I NEG +  + G  
Sbjct: 21  LAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNI 80

Query: 78  ATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVK- 136
              + Y   G+ ++  Y  F    + +        L+  A A   + I+  PF+ ++ + 
Sbjct: 81  PGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRL 140

Query: 137 ---QQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQK 193
               Q         V D WK       G+  F+KG +             F ++E I  +
Sbjct: 141 VANNQMHSMSITREVRDIWKLE-----GLPGFFKGSIASMTTITLTASIMFGTYETI--R 193

Query: 194 IY------SVLPKKKEEMNALQQISVSFVGGYLAGILC 225
           IY      +    KK E+  L   S   +GG +A I+ 
Sbjct: 194 IYCDENEKTTAAHKKWELATLNH-SAGTIGGVIAKIIT 230

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 105/258 (40%), Gaps = 40/258 (15%)

Query: 53  YTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVY 112
           + S  + F KI   EG   ++ G   T +         + GYE F+       SP    Y
Sbjct: 97  FNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFRDH-----SPMRDSY 151

Query: 113 -----LMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVV------DGWKKMYAE--S 159
                L   ATA  +A   + P E IK + Q+ +P    +        D  K+   E  S
Sbjct: 152 PSLNPLFCGATARMVAATTVAPLELIKTRLQS-IPRSRKDTTTQMMFKDLLKETRNEIRS 210

Query: 160 GGMKAFYKGI-VPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISV---SF 215
           GG K  +KG+ + LW R +P++   + S+E   +  +    ++    N          SF
Sbjct: 211 GGYKVLFKGLEITLW-RDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSF 269

Query: 216 VGGYLAGILCAAVSHPADV----MVSKINSERKANESMSVASKR------------IYQK 259
           +GG ++G   A ++HP DV    M   ++ E K   ++    KR            I Q 
Sbjct: 270 IGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQT 329

Query: 260 IGFTGLWNGLMVRIVMIG 277
            G+  L+ GL+ R++ I 
Sbjct: 330 EGYGALYTGLIPRVMKIA 347

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 89/209 (42%), Gaps = 41/209 (19%)

Query: 29  CGPTH-----SSITPLDLVKCRLQVNPK---------LYTSNLQGFRKIIANEGWKKVYT 74
           CG T      +++ PL+L+K RLQ  P+         ++   L+  R  I + G+K ++ 
Sbjct: 159 CGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFK 218

Query: 75  GFGATFVGYSLQGAGKYGGYEYFKHLY--------SSW-LSPGVTVYL---MASATAEFL 122
           G   T        A  +G YE++K  +          W LSP    ++   +  + +   
Sbjct: 219 GLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGGSVSGSS 278

Query: 123 ADIMLCPFEAIKVKQQTTMP---PFCNNVVDGWKKMYA-----------ESGGMKAFYKG 168
           A ++  PF+  K + Q TM       N +V   K++ A           ++ G  A Y G
Sbjct: 279 AALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGYGALYTG 338

Query: 169 IVPLWCRQIPYTMCKFTSFEKIVQKIYSV 197
           ++P   +  P      +++E + +++++V
Sbjct: 339 LIPRVMKIAPSCAIMISTYE-LSKRLFAV 366

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 121/294 (41%), Gaps = 28/294 (9%)

Query: 21  CTLGGIIACGPTHSSITPLDLVKCRLQVNPKL--YTSNLQGFRKIIANEGWKK-VYTGFG 77
           C L G I      S +  LD VK R Q  P    Y   +  +R +   EG ++ +Y G+G
Sbjct: 56  CVLAGGIGGAIGDSVMHSLDTVKTRQQGAPGEVKYRHMISAYRTLALEEGVRRGLYGGYG 115

Query: 78  ATFVGYSLQGAGKYGGYEYFK-HLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVK 136
           A  +G     A  +G YE+ K  + + W       +L A    +  + ++  P E +K +
Sbjct: 116 AAMLGSFPSAAVFFGTYEWVKRQMINEWQIHETYSHLAAGFLGDLFSSVVYVPSEVLKTR 175

Query: 137 QQTTMPPFCNNVVDGWK--------KMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFE 188
            Q        +   G+         +    + G+ A + G      R +P++  +F  +E
Sbjct: 176 LQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYE 235

Query: 189 KIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANES 248
           +   + ++ L ++K  ++     +   V G  AG L   ++ P DV+ ++I ++ + +  
Sbjct: 236 RF--RKWAFLLERK-PVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAG 292

Query: 249 MSVASK------RIYQKI-------GFTGLWNGLMVRIVMIGTLTSFQWLIYDS 289
              AS        I++ +       G  G ++G+  R +     +S   L+Y +
Sbjct: 293 TPDASAPARLNGSIFRSLLVVLRYEGLGGAFSGVGPRFIWTSIQSSIMLLLYQT 346

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 35/87 (40%), Gaps = 18/87 (20%)

Query: 13  YTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNP-------------KLYTSNLQG 59
           +T E     + GG+          TPLD+VK R+Q  P             +L  S  + 
Sbjct: 255 FTAEVVTGASAGGLAGI-----ITTPLDVVKTRIQTQPRGSAGTPDASAPARLNGSIFRS 309

Query: 60  FRKIIANEGWKKVYTGFGATFVGYSLQ 86
              ++  EG    ++G G  F+  S+Q
Sbjct: 310 LLVVLRYEGLGGAFSGVGPRFIWTSIQ 336

>Kwal_33.14050
          Length = 314

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 63/281 (22%), Positives = 108/281 (38%), Gaps = 33/281 (11%)

Query: 33  HSSITPLDLVKCRLQV----------NPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVG 82
           HS + P+D +K R+Q             KL ++ +Q   +I   EG   ++ G  +  +G
Sbjct: 31  HSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMALWKGVQSVILG 90

Query: 83  YSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASAT---AEFLADIMLCPFEAIKVKQQT 139
                A  +  YE  K              L  +A+   A   AD+++ PF+ IK + Q 
Sbjct: 91  AGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTAASGIAATVAADLLMNPFDTIKQRMQ- 149

Query: 140 TMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLP 199
            +  F  + +         + G+ AF+          IP+    F         IY    
Sbjct: 150 -LRTFSKDRMWSVASRIYRNEGLAAFFYSYPTTIAMNIPFAAFNFA--------IYESAT 200

Query: 200 KKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVM---------VSKINSERKANESMS 250
           K     N    +     GG ++G  CAA++ P D +          S ++   +  ++ S
Sbjct: 201 KFFNPENTYNPLIHCLCGG-ISGATCAAITTPLDCIKTVLQVRGSESVVDPLFRQADTFS 259

Query: 251 VASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFK 291
            A+  I +  G++G W GL  RI+     T+  W  Y+  K
Sbjct: 260 RAASAISKVYGWSGFWRGLKPRIISNMPATAISWTAYECAK 300

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 68/298 (22%), Positives = 125/298 (41%), Gaps = 37/298 (12%)

Query: 9   KIQLYTKEFYATCTLGGIIA--CGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIAN 66
           +++L+ +E   +CT  G ++   G           V CR +   +L    L+G RKI   
Sbjct: 36  RVRLHQQEMLPSCTCTGQLSKPAGKVFWQDECFANVGCR-EPAARLQ-GTLEGLRKIAQL 93

Query: 67  EGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVY--LMASATAEFLAD 124
           EG   ++ G G T V         + GYE  +   +S L+  + V   L+  A A  LA 
Sbjct: 94  EGLPTLWRGLGITLVMAVPANVVYFSGYEALRD--NSPLASRLPVANPLVCGAFARILAA 151

Query: 125 IMLCPFEAIKVKQQTTMPPFCNN-------VVDGWKKMYAESG--GMKAFYKGI-VPLWC 174
             + P E ++ + Q+   P   +       + D  ++M  E    G +A +KG+ + LW 
Sbjct: 152 TTIAPLELLRTRLQSV--PRARDTERTIYLIGDLLREMRHEVSVMGYRALFKGLEITLW- 208

Query: 175 RQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADV 234
           R +P++   + ++E    + ++         N    I  SF  G + G + A ++HP DV
Sbjct: 209 RDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIG-SFACGSMGGAVAALLTHPFDV 267

Query: 235 MVSKINSERKANESMSVASK---------------RIYQKIGFTGLWNGLMVRIVMIG 277
             +++     + + ++V  K                I +  G   L+ GL+ R++ I 
Sbjct: 268 GKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGIRALYTGLLPRVMKIA 325

>Scas_640.25
          Length = 306

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 57/263 (21%), Positives = 113/263 (42%), Gaps = 36/263 (13%)

Query: 38  PLDLVKCRLQV---------NPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGA 88
           PLD+VK R+Q+         +   Y   +    +I+  EG   +Y G  +  +  + + A
Sbjct: 33  PLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRA 92

Query: 89  GKYGGYEYFKHLYSS-----WLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPP 143
            K+   + F  L+ S      L+  ++V  ++ A+A     +++ PFE +K++ Q     
Sbjct: 93  VKFASNDEFIKLWKSVFGTKQLTQQISV--LSGASAGITEALVIVPFELVKIRLQDVNSK 150

Query: 144 FCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKE 203
           F    V+  K +  +  G+K  Y G+     R   +    F     ++ ++  +LP  K 
Sbjct: 151 F-KGPVEVLKHIIKQD-GLKGLYSGVESTVWRNAVWNAGYFG----VIFQVRELLPVAKS 204

Query: 204 EMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASK--------- 254
           +    +        G++ G      + P DV+ S+I S+   NE ++   K         
Sbjct: 205 KQEKTRN---DLCAGFVGGTFGVMFNTPFDVVKSRIQSD--GNEIINGVRKYNWTWPSVM 259

Query: 255 RIYQKIGFTGLWNGLMVRIVMIG 277
           +IY + GF  L+ G + +++ +G
Sbjct: 260 KIYHEEGFRALYKGFVPKVLRLG 282

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 64/152 (42%), Gaps = 11/152 (7%)

Query: 36  ITPLDLVKCRLQ-VNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGY 94
           I P +LVK RLQ VN K +   ++  + II  +G K +Y+G  +T    ++  AG +G  
Sbjct: 134 IVPFELVKIRLQDVNSK-FKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVI 192

Query: 95  EYFKHLYSSWLSPGVTVY--LMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVD-G 151
              + L     S        L A         +   PF+ +K + Q+      N V    
Sbjct: 193 FQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYN 252

Query: 152 WK-----KMYAESGGMKAFYKGIVPLWCRQIP 178
           W      K+Y E  G +A YKG VP   R  P
Sbjct: 253 WTWPSVMKIYHEE-GFRALYKGFVPKVLRLGP 283

>Kwal_23.2913
          Length = 320

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 116/281 (41%), Gaps = 47/281 (16%)

Query: 16  EFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKK---- 71
           E  A   +GG+ A    H    P DL+K R Q N    +  L    +++     K     
Sbjct: 30  ESLAAGGVGGVCAVLTGH----PFDLLKVRCQSNQA--SGTLDAISRVLHEAKSKSGPLP 83

Query: 72  ------VYTGFGATFVGYSLQGAGKYGGYEYFKHLY-------------SSWLSPGVTVY 112
                  Y G     +G +   A  + GY+  K L              SS L+P  T  
Sbjct: 84  LNQIKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQ 143

Query: 113 LMASATAEFLADI----MLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKG 168
           L   A A F + I    +  P E +KV  QT+     +    G  +     GG+++ ++G
Sbjct: 144 L---ALAGFFSAIPTTLITAPTERVKVVLQTSE----SGSFLGAARTLIREGGVRSLFQG 196

Query: 169 IVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAV 228
            +    R  P +   F S+E + ++  S    + ++ +AL  +S+   GG +AG+     
Sbjct: 197 TLATLARDGPGSALYFASYE-VSKRFLS----RNQDTDALSVVSICVAGG-VAGMSMWIG 250

Query: 229 SHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGL 269
             P D + +K+ S  + ++SM  A++ IY + G  G + GL
Sbjct: 251 VFPIDTIKTKLQSSSR-SQSMVQAAREIYTRAGLRGFFPGL 290

>Kwal_23.4354
          Length = 343

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 113/259 (43%), Gaps = 36/259 (13%)

Query: 45  RLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFK---HLY 101
           R + +P  Y S    F KI   EG + ++ G   T +  +      + GYE  +    L 
Sbjct: 76  RCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRDKSRLQ 135

Query: 102 SSW--LSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQT---TMPPFCNNVVDGWKKMY 156
             +  L+P     LM  A A  LA   + P E  + + Q+   + P     ++   K + 
Sbjct: 136 DKYPTLNP-----LMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMM--IKDLI 188

Query: 157 AESG------GMKAFYKGI-VPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNA-- 207
            ES       G KA ++G+ + LW R +P++   +  +E    K    +  +K  +N+  
Sbjct: 189 KESRYEISKVGYKALFRGLEITLW-RDVPFSSIYWGCYE--FYKSNVSIDSEKSIVNSSN 245

Query: 208 --LQQISVSFVGGYLAGILCAAVSHPADV-----MVSKINS--ERKANESMSVASKRIYQ 258
                   SFVGG   G + A ++HP DV      ++ +NS  E+K +++M     ++ +
Sbjct: 246 SNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRK 305

Query: 259 KIGFTGLWNGLMVRIVMIG 277
             G   L+ GL+ R++ I 
Sbjct: 306 SEGLAALYTGLVPRVIKIA 324

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/266 (22%), Positives = 116/266 (43%), Gaps = 38/266 (14%)

Query: 38  PLDLVKCRLQV------NPKL---------YTSNLQGFRKIIANEGWKKVYTGFGATFVG 82
           PLD+VK R+Q+      +P +         YT  +    KI+  EG+  +Y G  +  + 
Sbjct: 31  PLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKKEGFSHLYKGITSPILM 90

Query: 83  YSLQGAGKYGGYEYFKHLY-------SSWLSPGVTVYLMASATAEFLADIMLCPFEAIKV 135
            + + A K+ G + F+  Y       +  ++  + +Y  ASA A  +   ++ PFE +K+
Sbjct: 91  EAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIYSGASAGA--VEAFVVAPFELVKI 148

Query: 136 KQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIY 195
           + Q     F   +     K     GG+ + + G+     R + +    F     I+ +I 
Sbjct: 149 RLQDVNSQFKTPI--EVVKNSVVKGGVLSLFNGLEATIWRHVLWNAGYFG----IIFQIR 202

Query: 196 SVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSE----RKANESMSV 251
            +LP  K    + ++     + G + G +   ++ P DV+ S+I       RK N S+  
Sbjct: 203 KLLPAAK---TSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQRSSGPLRKYNWSLP- 258

Query: 252 ASKRIYQKIGFTGLWNGLMVRIVMIG 277
           +   +Y++ GF  L+ G   +++ + 
Sbjct: 259 SVLLVYREEGFKALYKGFAPKVMRLA 284

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 65/147 (44%), Gaps = 5/147 (3%)

Query: 36  ITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYG-GY 94
           + P +LVK RLQ     + + ++  +  +   G   ++ G  AT   + L  AG +G  +
Sbjct: 140 VAPFELVKIRLQDVNSQFKTPIEVVKNSVVKGGVLSLFNGLEATIWRHVLWNAGYFGIIF 199

Query: 95  EYFKHLYSSWLSPGVTVY-LMASATAEFLADIMLCPFEAIKVKQQTTMPPFC--NNVVDG 151
           +  K L ++  S   T   L+A A    +  ++  PF+ +K + Q +  P    N  +  
Sbjct: 200 QIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQRSSGPLRKYNWSLPS 259

Query: 152 WKKMYAESGGMKAFYKGIVPLWCRQIP 178
              +Y E  G KA YKG  P   R  P
Sbjct: 260 VLLVYREE-GFKALYKGFAPKVMRLAP 285

>Kwal_23.3529
          Length = 395

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 123/295 (41%), Gaps = 31/295 (10%)

Query: 19  ATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKL--YTSNLQGFRKIIANEGWKK-VYTG 75
           A C + G I      S +  LD VK R Q  P    Y + +  ++KI   EG ++ +Y G
Sbjct: 86  AHCIVAGGIGGAIGDSVMHSLDTVKTRQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGG 145

Query: 76  FGATFVGYSLQGAGKYGGYEYFKH-LYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIK 134
           + A  +G     A  +G YE  K  L   W       +L A  + + ++ ++  P E +K
Sbjct: 146 YTAAMLGSFPSAAIFFGTYELTKRKLIDDWGVNETLSHLTAGLSGDLVSSVVYVPSEVLK 205

Query: 135 VKQQT----TMPPFCN-----NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFT 185
            + Q       P F +     N+ D    +    G    F+ G     CR +P++  +F 
Sbjct: 206 TRLQLQGCYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFF-GYKATLCRDLPFSAFQFA 264

Query: 186 SFEKIVQKIYSVLPKK-KEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSER- 243
            +EK  Q  +++  K   ++++ L ++      G LAGI+      P DV+ ++I ++  
Sbjct: 265 FYEKFRQWAFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITT----PMDVIKTRIQTQMP 320

Query: 244 -----------KANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIY 287
                      +   S+      +Y+  G  G ++G+  R +     +S   L+Y
Sbjct: 321 STVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLY 375

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 34/183 (18%), Positives = 76/183 (41%), Gaps = 21/183 (11%)

Query: 124 DIMLCPFEAIKVKQQ-TTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMC 182
           D ++   + +K +QQ     P   N++  ++K++ E G  +  Y G         P    
Sbjct: 100 DSVMHSLDTVKTRQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAI 159

Query: 183 KFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSH-PADVMVSKINS 241
            F ++E         L K+K   +     ++S +   L+G L ++V + P++V+ +++  
Sbjct: 160 FFGTYE---------LTKRKLIDDWGVNETLSHLTAGLSGDLVSSVVYVPSEVLKTRLQL 210

Query: 242 ERKAN----------ESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFK 291
           +   N           ++  A   I +  G+  L+ G    +      ++FQ+  Y+ F+
Sbjct: 211 QGCYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFR 270

Query: 292 AYV 294
            + 
Sbjct: 271 QWA 273

>Scas_709.9
          Length = 365

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 80/182 (43%), Gaps = 22/182 (12%)

Query: 27  IACGPTHSSIT-PLDLVKCRLQVNPKL------YTSNLQGFRKIIANEGWKKVYTGFGAT 79
           I  G   + +T P+ +VK RL +   L      Y   +  F+KII  EG + +YTG   +
Sbjct: 170 ITAGAASTVLTNPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPS 229

Query: 80  FVGYSLQGAGKYGGYEYFKH-LYSSWLSPG---------VTVYLMASATAEFLADIMLCP 129
             G  L  A  +  YE  K+ L+   ++ G         +T  ++AS+ ++ LA I+  P
Sbjct: 230 MFGL-LHVAIHFPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYP 288

Query: 130 FEAIKVKQQTTMPPFC---NNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTS 186
            E ++ + Q          + ++D  K+ Y    G+  FY G      R +P +     S
Sbjct: 289 HEILRTRMQLKSDKLLISKHKLLDLIKRTYRYE-GLLGFYSGFATNLLRTVPASAITLVS 347

Query: 187 FE 188
           FE
Sbjct: 348 FE 349

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/286 (21%), Positives = 120/286 (41%), Gaps = 36/286 (12%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQV-------NPKLYTSNLQGFRKIIANEGWKKVYTG 75
           L GII C        PLD+ K RLQ        NP  Y   L     I+ +EG + +Y G
Sbjct: 77  LSGIIVC--------PLDVTKTRLQAQGIQSIENP-YYRGVLGTMSTIVVDEGVRGLYKG 127

Query: 76  FGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASA-TAEFLADIMLCPFEAIK 134
                +GY       +  YE+ K LY   L     +    SA TA   + ++  P   +K
Sbjct: 128 LIPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDFISHSCSAITAGAASTVLTNPIWVVK 187

Query: 135 VKQQTTMP-----PFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEK 189
            +     P           +D +KK+  +  G++  Y G+VP     + +    F  +EK
Sbjct: 188 TRLMLQTPLGESRTHYRGTIDAFKKIITQE-GVRTLYTGLVPSMFGLL-HVAIHFPVYEK 245

Query: 190 IVQKIY--SVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERK--- 244
           +  +++  ++      + ++L  ++   +    + +L + +++P +++ +++  +     
Sbjct: 246 LKNRLHCDTITGGHNSQEHSL-HLTRLIIASSASKMLASILTYPHEILRTRMQLKSDKLL 304

Query: 245 -ANESMSVASKRIYQKIGFTGLWNGL---MVRIVMIG--TLTSFQW 284
            +   +    KR Y+  G  G ++G    ++R V     TL SF++
Sbjct: 305 ISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFEY 350

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 95/219 (43%), Gaps = 34/219 (15%)

Query: 93  GYEYFKHLYSSWL-------SPGVTVYLMASATAEFLADIMLCPFEAIKVKQQ-----TT 140
            +E  KH+ S+ +        P +T   ++ A A FL+ I++CP +  K + Q     + 
Sbjct: 43  SHEPEKHIASTVIQSKLHLSDPKITA--LSGALAGFLSGIIVCPLDVTKTRLQAQGIQSI 100

Query: 141 MPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIY-SVLP 199
             P+   V+     +  + G ++  YKG++P+     P  M  F+ +E   + +Y  VLP
Sbjct: 101 ENPYYRGVLGTMSTIVVDEG-VRGLYKGLIPIILGYFPTWMIYFSVYE-FAKDLYPRVLP 158

Query: 200 KKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMS------VAS 253
                 ++   I+        AG     +++P  V+ +++  +    ES +       A 
Sbjct: 159 NSDFISHSCSAIT--------AGAASTVLTNPIWVVKTRLMLQTPLGESRTHYRGTIDAF 210

Query: 254 KRIYQKIGFTGLWNGLMVRIVMIGTL-TSFQWLIYDSFK 291
           K+I  + G   L+ GL+    M G L  +  + +Y+  K
Sbjct: 211 KKIITQEGVRTLYTGLVPS--MFGLLHVAIHFPVYEKLK 247

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 115/256 (44%), Gaps = 14/256 (5%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGAT--F 80
           L G  A   T     P+D +K RLQ     + +   G+R +    G   V +  GA+  F
Sbjct: 10  LSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFRNG--GYRGVYRGLGSAVVASAPGASLFF 67

Query: 81  VGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTT 140
           + Y    A   G   +F+ L  S     V  ++ +S+  E  A ++  P E +K + QT 
Sbjct: 68  ITYDTCKAETRG---FFRGLLPSSNVADVVTHMFSSSMGEIAACMVRVPAEVVKQRSQTH 124

Query: 141 MPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPK 200
                   +    K     G  +  Y+G      R+IP+T  +F  +E  ++K+++ L  
Sbjct: 125 ASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQFPLYE-YMKKVWAEL-- 181

Query: 201 KKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKI 260
             +E + ++    + V G +AG + AA + P D + +++   +K+    ++ S  IY++ 
Sbjct: 182 --DESDRVEPWKGA-VCGSIAGGIAAATTTPLDFLKTRLMLCKKSIPLGTLVST-IYKEE 237

Query: 261 GFTGLWNGLMVRIVMI 276
           GF   ++G+  R + I
Sbjct: 238 GFKVFFSGVGPRTMWI 253

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 36/83 (43%), Gaps = 1/83 (1%)

Query: 25  GIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYS 84
           G IA G   ++ TPLD +K RL +  K           I   EG+K  ++G G   +  S
Sbjct: 196 GSIAGGIAAATTTPLDFLKTRLMLCKKSIPLGTL-VSTIYKEEGFKVFFSGVGPRTMWIS 254

Query: 85  LQGAGKYGGYEYFKHLYSSWLSP 107
             GA   G YE    L S+   P
Sbjct: 255 AGGAIFLGIYETVHSLLSTNKKP 277

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 80/186 (43%), Gaps = 16/186 (8%)

Query: 27  IACGPTHSSIT-PLDLVKCRLQV------NPKLYTSNLQGFRKIIANEGWKKVYTGFGAT 79
           I  G   +++T P+ +VK RL +      +P  Y      FRK+   EG+K +Y G   +
Sbjct: 184 ITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPS 243

Query: 80  FVGYSLQGAGKYGGYEYFK---HLYS---SWLSPGVTVYLMASATAEFLADIMLCPFEAI 133
            +G     A  +  YE  K   H YS   +  S  +   +MAS+ ++ +A  +  P E +
Sbjct: 244 LLGL-FHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEIL 302

Query: 134 KVKQQ--TTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIV 191
           + + Q  + +P      +    K      G+K FY G      R IP +     SFE   
Sbjct: 303 RTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEYFR 362

Query: 192 QKIYSV 197
            ++ ++
Sbjct: 363 NRLENI 368

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 39/194 (20%), Positives = 79/194 (40%), Gaps = 30/194 (15%)

Query: 114 MASATAEFLADIMLCPFEAIKVKQQTT------MPPFCNNVVDGWKKMYAESGGMKAFYK 167
           ++ A A FL+ + +CP +  K + Q          P+   ++ G         G +  YK
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIM-GTLSTIVRDEGPRGLYK 140

Query: 168 GIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAA 227
           G+VP+     P  M  F+ +E   +  + + P+              FV    A I   A
Sbjct: 141 GLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQ------------FDFVAQSCAAITAGA 188

Query: 228 VS----HPADVMVSKINSERKANESMS------VASKRIYQKIGFTGLWNGLMVRIVMIG 277
            S    +P  V+ +++  +    E  +       A ++++ + GF  L+ GL+  ++ + 
Sbjct: 189 ASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLF 248

Query: 278 TLTSFQWLIYDSFK 291
            + +  + IY+  K
Sbjct: 249 HV-AIHFPIYEDLK 261

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 70/176 (39%), Gaps = 8/176 (4%)

Query: 19  ATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGA 78
           A     G I+  PT     P + +K  LQ N +   S ++  + I++  G K ++ G  A
Sbjct: 133 AQMATAGFISAIPTTLVTAPTERIKVVLQTNSEFKGSFIKAAKHIVSTGGVKSLFNGSLA 192

Query: 79  TFVGYSLQGAGKYGGYEYFKHLYSSWLSP------GVTVYLMASATAEFLADIMLCPFEA 132
           T        A  +  YE  K   +  ++        +    +A   A     +++ P + 
Sbjct: 193 TLARDGPGSALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDT 252

Query: 133 IKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFE 188
           IK + Q    P   ++V   K +Y + GG+K F+ G+ P   R  P     F   E
Sbjct: 253 IKTRLQVATTPI--SMVQATKDIYIQRGGIKGFFPGLGPALLRSFPANAATFLGVE 306

 Score = 32.3 bits (72), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 58/135 (42%), Gaps = 9/135 (6%)

Query: 162 MKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLA 221
           +K FYKG++P      P     F  ++     I   L   K+  +A    +     G+++
Sbjct: 88  VKGFYKGVIPPLIGVTPIFAVSFWGYD-----IGKRLVTWKQASDAPLTTAQMATAGFIS 142

Query: 222 GILCAAVSHPADVM--VSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTL 279
            I    V+ P + +  V + NSE K   S   A+K I    G   L+NG +  +   G  
Sbjct: 143 AIPTTLVTAPTERIKVVLQTNSEFKG--SFIKAAKHIVSTGGVKSLFNGSLATLARDGPG 200

Query: 280 TSFQWLIYDSFKAYV 294
           ++  +  Y+  KA++
Sbjct: 201 SALYFASYELSKAFL 215

>Scas_632.9
          Length = 292

 Score = 52.8 bits (125), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 109/250 (43%), Gaps = 26/250 (10%)

Query: 38  PLDLVKCRLQVN-PKLYTSNLQGFRKIIANEG-WKKVYTGFGATFVGYSLQGAGKYGGYE 95
           P D VK RLQ     ++ +     +    NEG W+  + G G+   G +L+ A  +  Y 
Sbjct: 37  PFDTVKVRLQTQGSHIFPTTWSCIKYTYHNEGVWRGFFQGIGSPLFGAALENATLFVSYN 96

Query: 96  YFKHLYSSW--LSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWK 153
              ++   +  +SP ++  L++ A A   A  +L P E IK K Q +        V+G  
Sbjct: 97  QCSNVLEKFTNVSP-LSNILLSGAFAGSCASFVLTPVELIKCKLQVSN---LQTAVEGQI 152

Query: 154 K--------MYA-ESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEE 204
           K        MY     G+   ++G    + R+    +  F ++E + Q +     ++K+ 
Sbjct: 153 KHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGGVAWFATYEVMKQGLKD---RRKDT 209

Query: 205 MNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTG 264
            N   ++ VS   G  AG+   A   PAD + S + +E     ++  A K++    G TG
Sbjct: 210 ENKTWELLVS---GASAGLAFNASIFPADTVKSMMQTEHI---TLINAVKKVLTTYGITG 263

Query: 265 LWNGLMVRIV 274
            + GL + ++
Sbjct: 264 FYRGLGITLI 273

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 69/166 (41%), Gaps = 16/166 (9%)

Query: 36  ITPLDLVKCRLQVNPKL--------YTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQG 87
           +TP++L+KC+LQV+           +T  +     ++  +G   ++ G  +TF+  SL G
Sbjct: 129 LTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGG 188

Query: 88  AGKYGGYEYFKHLYSSWL--SPGVTVYLMASATAEFLA-DIMLCPFEAIKVKQQTTMPPF 144
              +  YE  K         +   T  L+ S  +  LA +  + P + +K   QT     
Sbjct: 189 VAWFATYEVMKQGLKDRRKDTENKTWELLVSGASAGLAFNASIFPADTVKSMMQTEHITL 248

Query: 145 CNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKI 190
            N V     K    + G+  FY+G+     R +P     F  +E +
Sbjct: 249 INAV-----KKVLTTYGITGFYRGLGITLIRAVPANATVFYMYETL 289

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/253 (19%), Positives = 107/253 (42%), Gaps = 27/253 (10%)

Query: 61  RKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT---VYLMASA 117
           R I A EG+  +Y G GA  +G   + A ++  YE+++ L +   +  V+    ++    
Sbjct: 87  RNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADKQTGVVSTSNTFIAGVG 146

Query: 118 TAEFLADIMLCPFEAIKVKQQT---------TMPPFCNNVVDGWKKMYAESGGMKAFYKG 168
                A +++ P E +K++ Q            P + N V  G+  +  E  G+ A Y+G
Sbjct: 147 AGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEE--GISALYRG 204

Query: 169 IVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAV 228
           +     RQ       FT + K+ + +     ++      L     S + G ++G +    
Sbjct: 205 VSLTAARQATNQGANFTVYSKLREFL-----QEYHGTETLPSWETSCI-GLISGAIGPFS 258

Query: 229 SHPADVMVSKINSERKANESMSVASKRI-------YQKIGFTGLWNGLMVRIVMIGTLTS 281
           + P D + +++  ++  +       KRI        ++ GF  L+ G+  R++ +    +
Sbjct: 259 NAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQA 318

Query: 282 FQWLIYDSFKAYV 294
             + +Y+  + ++
Sbjct: 319 VTFTVYEFVRRHL 331

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 69/176 (39%), Gaps = 29/176 (16%)

Query: 36  ITPLDLVKCRLQ---VNPKL------YTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQ 86
           + P+++VK RLQ   +NP        YT+ +Q    II  EG   +Y G   T    +  
Sbjct: 156 VNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISALYRGVSLTAARQATN 215

Query: 87  GAGKYGGY----EYFKHLYSSWLSPG---VTVYLMASATAEFLADIMLCPFEAIKVK-QQ 138
               +  Y    E+ +  + +   P      + L++ A   F       P + IK + Q+
Sbjct: 216 QGANFTVYSKLREFLQEYHGTETLPSWETSCIGLISGAIGPFSN----APLDTIKTRLQK 271

Query: 139 TTMPPFCNNVVDGWKKM------YAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFE 188
                F      GWK++        +  G +A YKGI P   R  P     FT +E
Sbjct: 272 DKSTSFKGE--SGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 325

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 51/109 (46%), Gaps = 19/109 (17%)

Query: 9   KIQLYTKEFYATCTLG-------GII--ACGPTHSSITPLDLVKCRLQVNPKLYTSNLQG 59
           K++ + +E++ T TL        G+I  A GP  ++  PLD +K RLQ +         G
Sbjct: 225 KLREFLQEYHGTETLPSWETSCIGLISGAIGPFSNA--PLDTIKTRLQKDKSTSFKGESG 282

Query: 60  FRKI-------IANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYF-KHL 100
           +++I       +  EG++ +Y G     +  +   A  +  YE+  +HL
Sbjct: 283 WKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 331

>Kwal_47.18216
          Length = 333

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/305 (18%), Positives = 119/305 (39%), Gaps = 62/305 (20%)

Query: 38  PLDLVKCRLQV--NPKLYTSNLQGF----RKIIANEGWKKVYTGFGATFVGYSLQGAGKY 91
           PLD +K R+Q+    +      +GF    R I   EG+  +Y G GA  +G   + A ++
Sbjct: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89

Query: 92  GGYEYFKHLYSSWLSPGVTV--YLMASATAEFLADIMLC-PFEAIKVKQQ---------- 138
             YE+F+ L +   +  V+     +A   A     +M+  P E +K++ Q          
Sbjct: 90  TSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLK 149

Query: 139 ------------------------TTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWC 174
                                      P + N +   +  +  E  G +A Y+G+     
Sbjct: 150 AQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYVIVKEE--GPRALYRGVSLTAA 207

Query: 175 RQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQI---SVSFVGGYLAGILCAAVSHP 231
           RQ       FT        +YS L  + +E +    +     S + G ++G L    + P
Sbjct: 208 RQATNQGANFT--------VYSTLKSRLQEYHQTDMLPSWETSLI-GLISGALGPFSNAP 258

Query: 232 ADVMVSKINSERKANES-----MSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLI 286
            D + +++  ++  ++      +    +++ ++ GF  L+ G+  R++ +    +  + +
Sbjct: 259 LDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTV 318

Query: 287 YDSFK 291
           Y+  +
Sbjct: 319 YELIR 323

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 60/161 (37%), Gaps = 25/161 (15%)

Query: 49  NPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFK---------H 99
            PK Y + +Q    I+  EG + +Y G   T    +      +  Y   K          
Sbjct: 176 TPK-YRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTD 234

Query: 100 LYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYA-- 157
           +  SW +    + L++ A   F       P + IK + Q       ++   GW ++ A  
Sbjct: 235 MLPSWETS--LIGLISGALGPFSN----APLDTIKTRLQKDKSTSKDS---GWSRILAIG 285

Query: 158 ----ESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKI 194
                  G +A YKGI P   R  P     FT +E I +K+
Sbjct: 286 RQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326

 Score = 28.9 bits (63), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 39/86 (45%), Gaps = 6/86 (6%)

Query: 212 SVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVA------SKRIYQKIGFTGL 265
           +++ V G  AG+  A   HP D +  ++    +A E    A      ++ I  + GF  L
Sbjct: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLAL 70

Query: 266 WNGLMVRIVMIGTLTSFQWLIYDSFK 291
           + GL   ++ I    + ++  Y+ F+
Sbjct: 71  YKGLGAVVIGIIPKMAIRFTSYEFFR 96

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/299 (22%), Positives = 110/299 (36%), Gaps = 44/299 (14%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKL--------------------YTSNLQGFRK 62
           + G  A    HS + P+D +K R+Q   ++                      + LQ   +
Sbjct: 25  IAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQISR 84

Query: 63  IIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYL---MASATA 119
           I + EG   ++ G  +  +G     A  +  YE+ K              L   ++   A
Sbjct: 85  ISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLKTAVSGVAA 144

Query: 120 EFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPY 179
              AD ++ PF+ IK + Q       +++      +Y   G M  FY     L    IP+
Sbjct: 145 TVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFNIYKNEGPMAFFYSYPTTL-AMNIPF 203

Query: 180 TMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVS-- 237
               F         IY    K     NA         GG +AG  CAAV+ P D + +  
Sbjct: 204 AALNFV--------IYESSTKFFNPTNAYNPWIHCLCGG-IAGATCAAVTTPLDCIKTVL 254

Query: 238 --------KINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYD 288
                    + S + AN +   A++ I+Q  G+ G W GL  R++     T+  W  Y+
Sbjct: 255 QIRGSDTVHVESFKTAN-TFKKAAQAIWQSYGWKGFWRGLQPRVISNIPATAISWTSYE 312

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 39/90 (43%), Gaps = 12/90 (13%)

Query: 21  CTLGGIIACGPTHSSIT-PLDLVKCRLQVN-------PKLYTSNL--QGFRKIIANEGWK 70
           C  GGI   G T +++T PLD +K  LQ+            T+N   +  + I  + GWK
Sbjct: 230 CLCGGI--AGATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWK 287

Query: 71  KVYTGFGATFVGYSLQGAGKYGGYEYFKHL 100
             + G     +      A  +  YE+ KHL
Sbjct: 288 GFWRGLQPRVISNIPATAISWTSYEFAKHL 317

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/334 (20%), Positives = 134/334 (40%), Gaps = 60/334 (17%)

Query: 16  EFYATCTLGGIIACGPTHSSITPLDLVKCRLQV-NPKL--YTSNLQGF----RKIIANEG 68
           ++     L G ++     + I PLD +K   Q  NP    Y  +L G     + I  N+G
Sbjct: 16  DYVVRSGLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDG 75

Query: 69  WKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLY-------SSWLSPGVTVYLMASATAEF 121
            +  + G   T +      A K+  YE  + +        S W         +AS +   
Sbjct: 76  IRGFFQGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWRR-------LASGSLAG 128

Query: 122 LADIMLC-PFEAIKVKQQTTMPPFCNNVVDGWKKMYAE--SGGMKA-------------F 165
           L  + +  P +  +V+           + D  K +Y E  S G+ +             F
Sbjct: 129 LCSVFITYPLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNF 188

Query: 166 YKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVL--PKKKEEMNALQQIS----------- 212
           Y+G VP     IPY    F + + I   + S L  P   +++++ +++            
Sbjct: 189 YRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLR 248

Query: 213 --VSFVGGYLAGILCAAVSHPADVMVSKIN----SERKANE----SMSVASKRIYQKIGF 262
                V G L+GIL    ++P +++  ++     S RK  +    S+S  ++ IYQ+ G+
Sbjct: 249 TWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGW 308

Query: 263 TGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVGL 296
            G + GL +  + +  + +  + +Y+  K ++G+
Sbjct: 309 RGFFVGLSIGYIKVTPMVACSFFVYERMKWHLGI 342

>Scas_697.47
          Length = 328

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/263 (24%), Positives = 109/263 (41%), Gaps = 25/263 (9%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIAN-----------EGWKK 71
           +GG+ A    H    P DL+K R Q      +S +   + I+ +              K 
Sbjct: 45  VGGVCAVLTGH----PFDLIKVRCQSGQA--SSTIHAIKIILKDARAIPTSNMLVNSVKG 98

Query: 72  VYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLADI----ML 127
            Y G     +G +   A  + GY+  K + +   S    + +   A A F++ I    + 
Sbjct: 99  FYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSSSAQLTMGQMAAAGFISAIPTTLVT 158

Query: 128 CPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSF 187
            P E IKV  QT       + + G  K   + GG+K+ +KG +    R  P +   F S+
Sbjct: 159 APTERIKVVLQTAGANSKTSFI-GAAKNIVKDGGVKSLFKGSLATLARDGPGSALYFASY 217

Query: 188 EKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANE 247
           E I +K  +      E       I+   + G +AG+    V  P D + +K+ S    ++
Sbjct: 218 E-ISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQSS-SGSQ 275

Query: 248 SMSVASKRIY-QKIGFTGLWNGL 269
           SM  A++ IY ++ G  G + GL
Sbjct: 276 SMVAATREIYVKRGGIKGFFPGL 298

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 78/197 (39%), Gaps = 20/197 (10%)

Query: 8   RKIQLYTKEFYATCTLGGIIACG-----PTHSSITPLDLVKCRLQV---NPKLYTSNLQG 59
           +KI   +    A  T+G + A G     PT     P + +K  LQ    N K  TS +  
Sbjct: 125 KKIVTRSDSSSAQLTMGQMAAAGFISAIPTTLVTAPTERIKVVLQTAGANSK--TSFIGA 182

Query: 60  FRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPG--------VTV 111
            + I+ + G K ++ G  AT        A  +  YE  K   +   +          +  
Sbjct: 183 AKNIVKDGGVKSLFKGSLATLARDGPGSALYFASYEISKKFLNDRNATAESKTGEVNIAN 242

Query: 112 YLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVP 171
             +A   A     +++ P + IK K Q++      ++V   +++Y + GG+K F+ G+ P
Sbjct: 243 VCLAGGIAGMSMWLVVFPIDTIKTKLQSSSG--SQSMVAATREIYVKRGGIKGFFPGLGP 300

Query: 172 LWCRQIPYTMCKFTSFE 188
              R  P     F   E
Sbjct: 301 ALLRSFPANAATFLGVE 317

>Kwal_0.232
          Length = 274

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/274 (22%), Positives = 122/274 (44%), Gaps = 33/274 (12%)

Query: 15  KEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYT 74
           +  + T  L G  A   T     P+D +K RLQ     +           AN G+  VY 
Sbjct: 3   RSSFITSLLAGAAAGTSTDLFFFPIDTLKTRLQAAGGFF-----------ANGGYLGVYR 51

Query: 75  GFGATFVGYSLQGAGKYGGYE----YFKHLYSSWLSPGVTV-----YLMASATAEFLADI 125
           G G+  V  +   +  +  Y+    Y + ++++ ++    V     ++ +S+  E  A +
Sbjct: 52  GLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAACM 111

Query: 126 MLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGG---MKAFYKGIVPLWCRQIPYTMC 182
           +  P E IK + QT      ++ +   KK+     G    +  Y+G      R+IP+T  
Sbjct: 112 VRVPAEVIKQRTQTHK---SDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTCI 168

Query: 183 KFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSE 242
           +F  +E  ++K +++    +E++   Q    +F  G +AG + AA + P DV+ +++   
Sbjct: 169 QFPLYE-FLKKQWAI-SGGREQVAPWQG---AFC-GCVAGGIAAATTTPLDVLKTRLMLS 222

Query: 243 RKANESMSVASKRIYQKIGFTGLWNGLMVRIVMI 276
             +   + +A ++IY   G+   ++G+  R V I
Sbjct: 223 HTSVPVLHLA-RQIYATEGWKVFFSGVGPRTVWI 255

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 43/86 (50%), Gaps = 14/86 (16%)

Query: 21  CTLGGIIACGPTHSSITPLDLVKCRLQVN----PKLYTSNLQGFRKIIANEGWKKVYTGF 76
           C  GGI A     ++ TPLD++K RL ++    P L+ +     R+I A EGWK  ++G 
Sbjct: 199 CVAGGIAA-----ATTTPLDVLKTRLMLSHTSVPVLHLA-----RQIYATEGWKVFFSGV 248

Query: 77  GATFVGYSLQGAGKYGGYEYFKHLYS 102
           G   V  S  GA   G YE    + S
Sbjct: 249 GPRTVWISAGGAIFLGVYETVHSILS 274

>Scas_562.12
          Length = 300

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 83/191 (43%), Gaps = 22/191 (11%)

Query: 20  TCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGAT 79
           + T G +I  G     + PLD++K + Q NP+ +    +GF KI+ +EG   +Y G+G T
Sbjct: 122 SATAGSLIGIGEI--VLLPLDVLKIKRQTNPEAFKG--RGFVKILKDEGIFNLYRGWGWT 177

Query: 80  FVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLADIM--------LCPFE 131
               +      +GG  + K         G+  Y  AS +  F++ I+          P +
Sbjct: 178 AARNAPGSFALFGGNAFAKEYIL-----GLEDYSQASWSQNFISSIVGASCSLIVSAPLD 232

Query: 132 AIKVKQQTTMPPFCNNVVDGWK--KMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEK 189
            IK + Q       +N   G    K   ++ G+ AF+KG+ P      P  +  F   + 
Sbjct: 233 VIKTRIQNRS---FDNPETGLTIVKNTFKNEGITAFFKGLTPKLLTTGPKLVFSFALAQS 289

Query: 190 IVQKIYSVLPK 200
           ++ K  S+L K
Sbjct: 290 LIPKFDSLLSK 300

>Kwal_33.15446
          Length = 305

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 80/185 (43%), Gaps = 20/185 (10%)

Query: 21  CTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQG----FRKIIANEGWKKVYTGF 76
           C L G++A         P++L K +LQV     T+  +G     +K+ A +G + +Y G 
Sbjct: 119 CILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGL 178

Query: 77  GATFVGYSLQGAGKYGGYEYFKHLY--SSWLSPGVTVYLMASATAEFLADIMLCPFEAIK 134
            +T + +       +G YE     +  ++ LS     +     +A F       P + IK
Sbjct: 179 VSTLI-FRTHFVYWWGSYELLTRWFKANTNLSDTAINFWAGGFSASFGFWTTAYPSDVIK 237

Query: 135 VKQQTTMPPFCNNVVDG----WKKMYAE---SGGMKAFYKGIVPLWCRQIPYTMCKFTSF 187
              Q  +   CN+  DG    W+   ++   + G++ F+KG VP + R  P       SF
Sbjct: 238 ---QVIL---CNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASF 291

Query: 188 EKIVQ 192
           E +++
Sbjct: 292 EFVLR 296

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 65/305 (21%), Positives = 130/305 (42%), Gaps = 42/305 (13%)

Query: 15  KEFYATCTLGGIIACGPTHSSITPLDLVKCRLQ-----VNPKLYTSNLQGFRKIIAN--- 66
           KE  +  T  G I    TH    PLDL+K RLQ     + P  Y + +Q   +II +   
Sbjct: 14  KEIISGLT-AGTITTIVTH----PLDLIKLRLQLAAIDLKPSSYYNQVQ---RIIKDGSG 65

Query: 67  --EGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKH-LYSSWLSPGV------------TV 111
             +  K+ Y G G   +G ++     +G Y   K  +YS    P +            ++
Sbjct: 66  TQQLLKEAYRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSM 125

Query: 112 YLMASATAEFLADIMLCPFEAIKVKQQTTMPPFC-NNVVDGWKKMYAESGGMKAFYKGIV 170
           YL+++  +     ++  P   IK +  +T       ++++   ++Y E  G+K F++G+V
Sbjct: 126 YLVSAGASGLATALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIYTEE-GLKTFWRGLV 184

Query: 171 PLWCRQIPYTMCKFTSFEKIVQK-IYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVS 229
           P     +      F  ++ +  K ++     ++  +NA++ I +      L+ ++  +  
Sbjct: 185 PSLF-GVTQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGII----SLSKMISVSSV 239

Query: 230 HPADVMVSKI---NSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLI 286
           +P  ++ + +    +E   N  M+   + I+   G  G + GL   +V     T   + +
Sbjct: 240 YPLQLLKTNLQTFRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGV 299

Query: 287 YDSFK 291
           Y+ FK
Sbjct: 300 YEHFK 304

 Score = 29.6 bits (65), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 29/70 (41%), Gaps = 3/70 (4%)

Query: 34  SSITPLDLVKCRLQVNPKLYTSNLQG---FRKIIANEGWKKVYTGFGATFVGYSLQGAGK 90
           SS+ PL L+K  LQ     +  N +     R I    G    Y G  A  V         
Sbjct: 237 SSVYPLQLLKTNLQTFRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCIT 296

Query: 91  YGGYEYFKHL 100
           +G YE+FKH+
Sbjct: 297 FGVYEHFKHI 306

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 85/191 (44%), Gaps = 22/191 (11%)

Query: 20  TCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGAT 79
           + T G +I  G     + PLD++K + Q NP+ +    +GF KI+ +EG   +Y G+G T
Sbjct: 122 SATAGSLIGIGEI--VLLPLDVLKIKRQTNPEAFKG--RGFLKILKDEGIFNLYRGWGWT 177

Query: 80  FVGYSLQGAGKYGGYEYFK--------HLYSSWLSPGVTVYLMASATAEFLADIMLCPFE 131
               +      +GG  + K        +  ++W    ++  + ASA+      I+  P +
Sbjct: 178 AARNAPGSFALFGGNAFAKEYILGLQDYSQATWSQNFISSIVGASASL-----IVSAPLD 232

Query: 132 AIKVKQQTTMPPFCNNVVDGWK--KMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEK 189
            IK + Q       +N   G+K  K   ++ G  AF+KG+ P      P  +  F   + 
Sbjct: 233 VIKTRIQNRN---FDNPESGFKIVKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFALAQS 289

Query: 190 IVQKIYSVLPK 200
           ++    ++L K
Sbjct: 290 LIPMFDNMLKK 300

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 82/196 (41%), Gaps = 29/196 (14%)

Query: 20  TCTLGGIIACGPTHSSI-----TPLDLVKCRLQVNPKL-----YTSNLQGFRKIIANEGW 69
           T +LG    CG    S      TP++ V+ RLQ+  +      Y S L    K++     
Sbjct: 119 TLSLGQYYTCGFVSGSANALLATPIEHVRIRLQLQKEALANAEYKSTLDCTEKLLKQGSL 178

Query: 70  KKVYT--------GFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEF 121
            + +T        GFG  F+ Y    A +   + + +   S+W +        A + A F
Sbjct: 179 MRGFTATLMRTSHGFGIYFLTYETLIASQLA-HGFRREDISAWKA----CMFGALSGAFF 233

Query: 122 LADIMLCPFEAIKVKQQTTM---PPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIP 178
            A  M  PF+ +K   Q      P +  NVV   K +Y E G ++AF KG +P   R +P
Sbjct: 234 WA--MTYPFDVVKSVMQADKLVNPAYGTNVVQVAKNIYRERG-LRAFTKGFMPTMLRSLP 290

Query: 179 YTMCKFTSFEKIVQKI 194
                F +FE  +Q +
Sbjct: 291 VNGATFAAFEVTMQML 306

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 58/256 (22%), Positives = 110/256 (42%), Gaps = 40/256 (15%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYE-- 95
           P D++K RLQ  P   T+  +    ++  EG+   Y G  A  VG     + ++G  E  
Sbjct: 44  PFDIIKVRLQTMPGNATA-WEAITDLVKYEGFMGFYKGTMAPLVGVGACVSCQFGINEAM 102

Query: 96  --YFKHL------YSSWLSPG---VTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPF 144
             YF+ L      Y + LS G      ++  SA A     ++  P E ++++ Q      
Sbjct: 103 KRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSANA-----LLATPIEHVRIRLQLQKEAL 157

Query: 145 CN----NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPK 200
            N    + +D  +K+  +   M+ F   ++    R        F ++E +   I S L  
Sbjct: 158 ANAEYKSTLDCTEKLLKQGSLMRGFTATLM----RTSHGFGIYFLTYETL---IASQLAH 210

Query: 201 --KKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSV----ASK 254
             ++E+++A +    + + G L+G    A+++P DV+ S + +++  N +        +K
Sbjct: 211 GFRREDISAWK----ACMFGALSGAFFWAMTYPFDVVKSVMQADKLVNPAYGTNVVQVAK 266

Query: 255 RIYQKIGFTGLWNGLM 270
            IY++ G      G M
Sbjct: 267 NIYRERGLRAFTKGFM 282

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 43/100 (43%), Gaps = 4/100 (4%)

Query: 197 VLPKKKEEMNALQQISVSF---VGGYLAGILCAAVSHPADVMVSKINSERKANESMSVAS 253
           + P+  E++  L     +      G + G+    V  P D++  ++ +    N +   A 
Sbjct: 7   ITPQVVEDLTDLHGFRKTLKDVFSGTVGGVAQVLVGQPFDIIKVRLQT-MPGNATAWEAI 65

Query: 254 KRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAY 293
             + +  GF G + G M  +V +G   S Q+ I ++ K Y
Sbjct: 66  TDLVKYEGFMGFYKGTMAPLVGVGACVSCQFGINEAMKRY 105

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 89/196 (45%), Gaps = 30/196 (15%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNP---KLYTSNLQGFRKIIANEGWKKVYTGFGAT 79
           L    A   T +   P+ LVK RLQ++    K Y ++L   + ++ NEG   +Y G  A+
Sbjct: 174 LAAATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSAS 233

Query: 80  FVGYSLQGAGKYGGYEYFK--------------HLYSSWLSPGVTVYLMASAT---AEFL 122
           ++G S++G  ++  YE  K              H  +   S  V  +   S +   A+F+
Sbjct: 234 YLG-SVEGILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFV 292

Query: 123 ADIMLCPFEAIKVKQQTTMPPFCN------NVVDGWKKMYAESGGMKAFYKGIVPLWCRQ 176
           A I+  P E ++ + +    P  N       +V  ++ +  E  G+ + Y G+ P   R 
Sbjct: 293 ASIVTYPHEVVRTRLR--QAPTENGKLKYTGLVQSFRVIIKEE-GLVSMYSGLTPHLLRT 349

Query: 177 IPYTMCKFTSFEKIVQ 192
           +P ++  F ++E +++
Sbjct: 350 VPNSIIMFGTWELVIK 365

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 65/290 (22%), Positives = 117/290 (40%), Gaps = 49/290 (16%)

Query: 38  PLDLVKCRLQVNP------------------KLYTSNLQGFRK---IIAN----EGWKKV 72
           P D+VK RLQ +                      + +L  F++   II N    EG++ +
Sbjct: 70  PFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFRSL 129

Query: 73  YTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT---VYLMASATAEFLADIMLCP 129
           + G G   VG     +  +  Y   K +YS  L+ G     ++L+A+ATA +    +  P
Sbjct: 130 FKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEAPWIHLLAAATAGWATSTVTNP 189

Query: 130 FEAIKVKQQTTMP--PFCNNVVDGWKKMYAESG------GMKAFYKGIVPLWCRQIPYTM 181
              +K + Q          N +D  K +    G      G+ A Y G V    + I Y  
Sbjct: 190 IWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSASYLGSVEGILQWILYEQ 249

Query: 182 CKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINS 241
            K    E+ ++K   +    K   + +++         LA  + + V++P +V+ +++  
Sbjct: 250 MKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPHEVVRTRLRQ 309

Query: 242 ERKANESMS----VASKR-IYQKIGFTGLWNGL---MVR-----IVMIGT 278
               N  +     V S R I ++ G   +++GL   ++R     I+M GT
Sbjct: 310 APTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTVPNSIIMFGT 359

>Kwal_14.2210
          Length = 315

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 60/306 (19%), Positives = 120/306 (39%), Gaps = 47/306 (15%)

Query: 24  GGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFR---KIIANEGWKKVYTGFGATF 80
            G IA   + + ++P + VK  LQV    +  N   FR   ++   EG   +  G G   
Sbjct: 23  AGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGNGLNC 82

Query: 81  VGYSLQGAGKYGGYEYFKHLYSSWL--SPGVTVY----LMASATAEFLADIMLCPFEAIK 134
           +      A ++  YE+ K     W   +P   V     L++ A     + +   P + ++
Sbjct: 83  IRIFPYSAVQFLVYEFCK---KQWFQQNPDTVVLNWHRLVSGALCGGCSVLATYPLDLVR 139

Query: 135 VK----------------QQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIP 178
            +                     PP    V +  +K Y + GG+   Y+G+ P     +P
Sbjct: 140 TRLSIQTANLARLHKAKAASAAKPP---GVWELLRKTYTQEGGIFGLYRGVWPTSIGVVP 196

Query: 179 YTMCKFTSFEKIVQKIYSVLPKKKEEMNA-LQQISVSFVGGYLAGILCAAVSHPADVMVS 237
           Y    F  +E++ + I    P   +  +A L ++S+    G ++G +   +++P D++  
Sbjct: 197 YVALNFAVYEQLREYI----PASFDPASASLYKLSI----GAISGGVAQTITYPFDLLRR 248

Query: 238 KINSERKANESMSVASKRIYQKI-------GFTGLWNGLMVRIVMIGTLTSFQWLIYDSF 290
           +          +    K +   +       GF G + GL   +  +   T+  W++Y++ 
Sbjct: 249 RFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYETV 308

Query: 291 KAYVGL 296
           + Y+ L
Sbjct: 309 RDYMQL 314

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 39/79 (49%), Gaps = 3/79 (3%)

Query: 213 VSFVGGYLAGILCAAVSHPAD---VMVSKINSERKANESMSVASKRIYQKIGFTGLWNGL 269
           ++F  G +AG +   V  P +   +++   +S    N  +  A K++Y + G  GL  G 
Sbjct: 19  IAFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGN 78

Query: 270 MVRIVMIGTLTSFQWLIYD 288
            +  + I   ++ Q+L+Y+
Sbjct: 79  GLNCIRIFPYSAVQFLVYE 97

>Kwal_55.20868
          Length = 380

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 64/317 (20%), Positives = 128/317 (40%), Gaps = 28/317 (8%)

Query: 3   SNKQPRKIQLYTKEFYAT--CTLGGIIACGPTHSSITPLDLVKCRLQV-----NPKLYTS 55
           SN     I    + F  T    L G +A      ++ PLD+ K RLQ      NP  Y  
Sbjct: 58  SNDGSNTIPFVNRSFDDTEITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYK 117

Query: 56  NLQG-FRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLM 114
            + G    II +EG + +Y G     +GY       +  YE  K LY         +   
Sbjct: 118 GILGTLTTIIRDEGARGLYKGLVPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHS 177

Query: 115 ASA-TAEFLADIMLCPFEAIKVK--QQTTM---PPFCNNVVDGWKKMYAESGGMKAFYKG 168
           ASA TA  ++ I+  P   +K +   QT +        +  D + KMY  + G++ FY G
Sbjct: 178 ASALTAGTVSTILTNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYT-TEGLRTFYAG 236

Query: 169 IVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAV 228
           ++P     + +    F  +EK+   ++      + E + L  ++   +    + ++ + +
Sbjct: 237 LLPSLL-GLFHVAIHFPIYEKLKVWLHCTPSMSRTEDHNL-NLARLIIASSASKMVASTL 294

Query: 229 SHPADVMVSKINSERKANESMSVAS-----------KRIYQKIGFTGLWNGLMVRIVMIG 277
           ++P +++ +++  +    + ++              K  Y+  G  G ++G    +    
Sbjct: 295 TYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTL 354

Query: 278 TLTSFQWLIYDSFKAYV 294
             ++   + ++ F+ Y+
Sbjct: 355 PASAITLVSFEYFRKYL 371

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 114/279 (40%), Gaps = 39/279 (13%)

Query: 33  HSSITPLDLVKCRLQV--------NPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYS 84
           HS + P+D +K R+Q           +L ++ L    KI   EG   ++ G  +  +G  
Sbjct: 32  HSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALWKGVQSVVLGAG 91

Query: 85  LQGAGKYGGYEYFKHLYSSWLSPGVTVY------LMASATAEFLADIMLCPFEAIKVKQQ 138
              A  +  YE  K   S  + P            ++   A   AD ++ PF+ IK  Q+
Sbjct: 92  PAHAVYFATYEMCK---SRLIDPEDRQTHQPLKTALSGTLATVAADALMNPFDTIK--QR 146

Query: 139 TTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVL 198
             + P  +++     +MY +  G+ AF+          IP+    F  +E    KI++  
Sbjct: 147 LQLHP-SDSMTKCAVRMY-QREGIAAFFYSYPTTIAMNIPFAALNFVIYESST-KIFNPS 203

Query: 199 PKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVM--------VSKINSER-KANESM 249
                 ++ L        GG ++G  CAA++ P D +           + S+  K  ++ 
Sbjct: 204 NNYNPWIHCL-------CGG-ISGATCAAITTPLDCVKTVLQIRGADSVQSQLFKEADTF 255

Query: 250 SVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYD 288
             A+  I++  G++G + GL  RI+     T+  W  Y+
Sbjct: 256 RKAASAIHKTYGWSGFFRGLKPRIISNMPATAISWTSYE 294

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 38/91 (41%), Gaps = 14/91 (15%)

Query: 21  CTLGGIIACGPTHSSIT-PLDLVKCRLQ------VNPKLYTSNLQGFRK----IIANEGW 69
           C  GGI   G T ++IT PLD VK  LQ      V  +L+      FRK    I    GW
Sbjct: 212 CLCGGI--SGATCAAITTPLDCVKTVLQIRGADSVQSQLF-KEADTFRKAASAIHKTYGW 268

Query: 70  KKVYTGFGATFVGYSLQGAGKYGGYEYFKHL 100
              + G     +      A  +  YE+ KHL
Sbjct: 269 SGFFRGLKPRIISNMPATAISWTSYEFAKHL 299

>Scas_578.3*
          Length = 524

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/298 (20%), Positives = 118/298 (39%), Gaps = 32/298 (10%)

Query: 19  ATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGA 78
           A   L   +     H  I  L+L K R  +        ++  R +    G +  Y G G 
Sbjct: 238 ARTDLSSTLLNPKMHLRIQGLNLAKIRSPI--------IKAIRSLYRQGGLRAFYVGNGL 289

Query: 79  TFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYL------MASATAEFLADIMLCPFEA 132
           +      + + K+G +E  K L ++     +   L      +A   A  +A I + P + 
Sbjct: 290 SVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLSKLQTYVAGGIAGVMAQISIYPIDT 349

Query: 133 IKVKQQTTMPPFCNNV------VDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTS 186
           +K + Q    P   N+      +   K+MY E GG++ FY+G++       PY      +
Sbjct: 350 LKFRIQCA--PLEGNLKGNALLISTAKEMYKE-GGIRVFYRGVLLGALGIFPYAALDLGT 406

Query: 187 FEKIVQKIYSVLPKKK---EEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSER 243
           F  + +K Y     KK    E + +    +    G  +G + A   +P +++ +++ ++ 
Sbjct: 407 FSAL-KKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTVGATAVYPINLLRTRLQAQG 465

Query: 244 KANESMSVASKR-----IYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVGL 296
                 +    R       ++ G  G + GL+  +V +    S  +L Y+ FKA + L
Sbjct: 466 TYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLVKVCPAVSIGYLCYEKFKAAMSL 523

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 74/174 (42%), Gaps = 9/174 (5%)

Query: 37  TPLDLVKCRLQVNPKLYTSNLQGF--RKIIA---NEGWKKVYTGFGATFVGYSLQGAGKY 91
           +PL LVK R+Q         L G   R+++A   + G + +Y G  A  +   +  A + 
Sbjct: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQL 195

Query: 92  GGYEYFKHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDG 151
             Y + K   S  +  G+ +Y +ASA +     I + PF+    +            +D 
Sbjct: 196 AVYSHAKEALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPLDC 255

Query: 152 WKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFE---KIVQKIYSVLPKKK 202
             K   +  G  A YKG +    R  P+T+   T  E   ++V+ + + LP+ +
Sbjct: 256 LCKTVRQE-GFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVENRLPQIR 308

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/317 (20%), Positives = 119/317 (37%), Gaps = 46/317 (14%)

Query: 6   QPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGF----R 61
           QP  ++   K       L G +A   + + ++P + VK  LQV       N QG     R
Sbjct: 10  QPSYVKSILKNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYN-QGIVGAVR 68

Query: 62  KIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFK-HLYSSWLSPGVTVY-----LMA 115
           ++   EG   ++ G G   +      A ++  YE  K H +    S G         L +
Sbjct: 69  QVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFS 128

Query: 116 SATAEFLADIMLCPFEAIKVK----------------QQTTMPPFCNNVVDGWKKMYAES 159
            A     + +   P + ++ +                   + PP    V D   + Y E 
Sbjct: 129 GALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPP---GVWDLLCRTYKEE 185

Query: 160 GGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNA-LQQISVSFVGG 218
           GG+K  Y+G+ P     +PY    F  +E+  +     +P+  +   A   ++S+    G
Sbjct: 186 GGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE----FMPEGTDNTLANFYKLSI----G 237

Query: 219 YLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKI-------GFTGLWNGLMV 271
            L+G +   V++P D++  +          +    K +   +       GF G + GL  
Sbjct: 238 ALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTA 297

Query: 272 RIVMIGTLTSFQWLIYD 288
            +  +   T+  WL+Y+
Sbjct: 298 NLFKVIPSTAVSWLVYE 314

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/210 (19%), Positives = 88/210 (41%), Gaps = 23/210 (10%)

Query: 103 SWLSPGVTVYLMASATAEFLADIMLCPFEAIKV--KQQTTMPPFCNNVVDGWKKMYAESG 160
           S L     V  +A   A  ++  ++ PFE +K+  + Q +   +   +V   +++Y E G
Sbjct: 16  SILKNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEG 75

Query: 161 GMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKK-KEEMNALQQISVSFVGGY 219
                ++G      R  PY+  +F  +E   +  + V   K +E++   Q++      G 
Sbjct: 76  -TPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRL----FSGA 130

Query: 220 LAGILCAAVSHPADVM----------VSKINSERKANESM-----SVASKRIYQKIGFTG 264
           L G      ++P D++          ++K++  R  N S       +  +   ++ G  G
Sbjct: 131 LCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKG 190

Query: 265 LWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
           L+ G+    + +    +  + +Y+ FK ++
Sbjct: 191 LYRGVWPTSLGVVPYVALNFAVYEQFKEFM 220

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 57/107 (53%), Gaps = 4/107 (3%)

Query: 191 VQKIYSVLPKKKEEMNALQQIS-VSFVGGYLAGILCAAVSHPAD---VMVSKINSERKAN 246
           + ++  VLP+     + L+  S V+F+ G LAG +   V  P +   +++   NS    N
Sbjct: 1   MSELAQVLPQPSYVKSILKNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYN 60

Query: 247 ESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAY 293
           + +  A +++Y++ G  GL+ G  +  + I   ++ Q+++Y++ K +
Sbjct: 61  QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKH 107

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 88/199 (44%), Gaps = 22/199 (11%)

Query: 113 LMASATAEFLADIMLCPFEAIKVKQQ------TTMPPFCNNVVDGWKKMYAESGGMKAFY 166
            +A   A  +A  +  PFE +K + Q       T      N       ++ ++ G+K   
Sbjct: 27  FIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIF-KNEGVKGLQ 85

Query: 167 KGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKK---KEEMNALQQISVSFVGGYLAGI 223
           +G+V  +  QI     +   +E I     +VL K    + + + LQ ++V+   G  +GI
Sbjct: 86  RGLVSAYVYQIGLNGSRLGFYEPI----RTVLNKTFFPESDPHKLQNVAVNVTAGATSGI 141

Query: 224 LCAAVSHPADVMVSKINS--------ERKANESMSVASKRIYQKIGFTGLWNGLMVRIVM 275
           + A V  P  ++ +++ S        E+    SMS     I++K G  GL+ G+   I+ 
Sbjct: 142 IGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAILR 201

Query: 276 IGTLTSFQWLIYDSFKAYV 294
            G  +S Q  IY++ K ++
Sbjct: 202 TGAGSSVQLPIYNTTKNFL 220

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/239 (20%), Positives = 104/239 (43%), Gaps = 25/239 (10%)

Query: 24  GGIIACGPTHSSITPLDLVKCRLQV-------NPKLYTSNLQGFRKIIANEGWKKVYTGF 76
           GG+ AC    +   P +LVK R+Q+       N ++Y +  Q    I  NEG K +  G 
Sbjct: 30  GGLAACIAV-TVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGVKGLQRGL 88

Query: 77  GATFVGYSLQGAGKYGGYEYFKHLYSSWLSP--------GVTVYLMASATAEFLADIMLC 128
            + +V        + G YE  + + +    P         V V + A AT+  +  I+  
Sbjct: 89  VSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAGATSGIIGAIVGS 148

Query: 129 PFEAIKVKQQTTMPPFCNNVVDGWKKMYAE-SGGMKAFYK--GIVPLWCRQIPYTMCKFT 185
           P   +K + Q+    + N +  G +  Y   S G+   +K  G++ L+ R +   + +  
Sbjct: 149 PLFLVKTRMQS----YSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLF-RGVDAAILRTG 203

Query: 186 SFEKIVQKIYSVLPKKKEEMNALQQ-ISVSFVGGYLAGILCAAVSHPADVMVSKINSER 243
           +   +   IY+       + + +++  ++  +   + G+    V +P DV+++++ +++
Sbjct: 204 AGSSVQLPIYNTTKNFLLQNDIMKEGTALHLLSSTVTGLGVGIVMNPWDVVLTRVYNQK 262

 Score = 35.0 bits (79), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 80/206 (38%), Gaps = 24/206 (11%)

Query: 6   QPRKIQLYTKEFYATCT---LGGIIACGPTHSSITPLDLVKCRLQV--------NPKLYT 54
            P K+Q       A  T   +G I+         +PL LVK R+Q             YT
Sbjct: 122 DPHKLQNVAVNVTAGATSGIIGAIVG--------SPLFLVKTRMQSYSNAIKIGEQTHYT 173

Query: 55  SNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKH--LYSSWLSPGVTVY 112
           S   G   I   EG   ++ G  A  +      + +   Y   K+  L +  +  G  ++
Sbjct: 174 SMSNGLATIFKKEGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDIMKEGTALH 233

Query: 113 LMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVD-GWKKMYAESGGMKAFYKGIVP 171
           L++S        I++ P++ +  +            +D  +K +  E  G+ A YKG   
Sbjct: 234 LLSSTVTGLGVGIVMNPWDVVLTRVYNQKGNTYKGPIDCMFKTIKIE--GIGALYKGFGA 291

Query: 172 LWCRQIPYTMCKFTSFEKIVQKIYSV 197
              R  P+T+   T  E+ ++ +Y+V
Sbjct: 292 QLFRIAPHTILCLTFMEQTMKLVYAV 317

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 98/247 (39%), Gaps = 24/247 (9%)

Query: 38  PLDLVKCRLQV--NPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYE 95
           P D +K RLQ   N   +   L    K   N+G +  Y GF    VG+ L  +   G   
Sbjct: 43  PFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLH 102

Query: 96  YFKHLYSSWLSPG-----VTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNV-- 148
            ++ L   ++ P      ++  +++   A +    +  P E  K K Q            
Sbjct: 103 NYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKG 162

Query: 149 -VDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNA 207
            +D  KK+Y+   G++  YKG++         +   F +        Y +L +   E   
Sbjct: 163 PLDVIKKIYSAQ-GIRGLYKGLI---------STLIFRTHFVYWWGSYELLTRWFRENTK 212

Query: 208 LQQISVSF-VGGYLAGILCAAVSHPADVMVSKINSERKAN---ESMSVASKRIYQKIGFT 263
           + + +++F  GG+ A       ++P+DV+   +    K +   +S   A K IYQ  G  
Sbjct: 213 MSEAAINFWAGGFSASFGFWTTAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGIN 272

Query: 264 GLWNGLM 270
           G + G +
Sbjct: 273 GFFKGFV 279

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 79/185 (42%), Gaps = 20/185 (10%)

Query: 21  CTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQG----FRKIIANEGWKKVYTGF 76
           C + G++A         P++L K +LQV     T+  +G     +KI + +G + +Y G 
Sbjct: 124 CIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGL 183

Query: 77  GATFVGYSLQGAGKYGGYEYFKHLY--SSWLSPGVTVYLMASATAEFLADIMLCPFEAIK 134
            +T + +       +G YE     +  ++ +S     +     +A F       P + +K
Sbjct: 184 ISTLI-FRTHFVYWWGSYELLTRWFRENTKMSEAAINFWAGGFSASFGFWTTAYPSDVVK 242

Query: 135 VKQQTTMPPFCNNVVDG----WK---KMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSF 187
              Q  +   CN+  DG    W+   K   +S G+  F+KG VP + R  P       +F
Sbjct: 243 ---QVVL---CNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPANAAALAAF 296

Query: 188 EKIVQ 192
           E +++
Sbjct: 297 EFVLR 301

>Scas_558.2
          Length = 289

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/274 (21%), Positives = 112/274 (40%), Gaps = 34/274 (12%)

Query: 18  YATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFG 77
           +    L G  A   T     P+D +K RLQ     +            N G+  +Y G G
Sbjct: 6   FVMSLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGFF-----------QNGGYHGIYRGLG 54

Query: 78  ATFVGYSLQGAGKYGGYEYFK-----HLYSSWLSPGV--------TVYLMASATAEFLAD 124
           +  V  +   +  +  Y+  K     H+     S G          V+++AS+  E  A 
Sbjct: 55  SAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGELAAC 114

Query: 125 IMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKF 184
           ++  P E IK + Q               K   + G ++  Y+G      R+IP+T  +F
Sbjct: 115 LVRVPAEVIKQRTQVHSTNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIPFTCIQF 174

Query: 185 TSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERK 244
             +E  ++K +++   +   +   +      + G +AG + AA + P D + +++   + 
Sbjct: 175 PLYE-FMKKEWALYDNEVGHLKPWK----GAICGSIAGGIAAATTTPLDFLKTRLMLNK- 228

Query: 245 ANESMSVAS--KRIYQKIGFTGLWNGLMVRIVMI 276
             +S+ + S  + IY++ GF   ++G+  R + I
Sbjct: 229 --DSIPIKSLIRNIYKEEGFKIFFSGIYPRTMWI 260

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 86/188 (45%), Gaps = 31/188 (16%)

Query: 37  TPLDLVKCRLQVNP----KLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYG 92
            P+ +VK R+Q++     + Y ++    + I+ NEG   +Y G  A+++G S++G  ++ 
Sbjct: 198 NPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLG-SVEGILQWL 256

Query: 93  GYEYFKHLYSSWLSPGVTVYLMASAT-----------------AEFLADIMLCPFEAIKV 135
            YE  KHL           +  ++ T                 A+F+A I+  P E ++ 
Sbjct: 257 LYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHEVVRT 316

Query: 136 KQQTTMPPFCN------NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEK 189
           + + +  P  N       +V  ++ +  E  G+ + Y G+ P   R +P ++  F ++E 
Sbjct: 317 RLRQS--PLENGKVKYTGLVQSFRVIIKEE-GLASMYSGLTPHLMRTVPNSIIMFGTWEV 373

Query: 190 IVQKIYSV 197
           +++ +  +
Sbjct: 374 VIKLLSDI 381

 Score = 31.2 bits (69), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 116/295 (39%), Gaps = 54/295 (18%)

Query: 38  PLDLVKCRLQVN-------------------PKLYTSNLQG---FRK---IIAN----EG 68
           P DLVK RLQ +                   P++    LQ    F++   II N    EG
Sbjct: 76  PFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYRQEG 135

Query: 69  WKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT---VYLMASATAEFLADI 125
           ++ ++ G G   VG     +  +  Y   K +YS   + G     ++LMA+ATA +    
Sbjct: 136 FRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQEAPWIHLMAAATAGWATAT 195

Query: 126 MLCPFEAIKVKQQTTMPPFCN---NVVDGWKKMYAESG------GMKAFYKGIVPLWCRQ 176
              P   +K + Q           N  D  K +    G      G+ A Y G V    + 
Sbjct: 196 ATNPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVEGILQW 255

Query: 177 IPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMV 236
           + Y   K    ++ ++K  +         + ++Q      G  LA  + + V++P +V+ 
Sbjct: 256 LLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHEVVR 315

Query: 237 SKINSERKANESMS----VASKR-IYQKIGFTGLWNGL---MVR-----IVMIGT 278
           +++      N  +     V S R I ++ G   +++GL   ++R     I+M GT
Sbjct: 316 TRLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGT 370

>Kwal_47.19228
          Length = 281

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/257 (22%), Positives = 99/257 (38%), Gaps = 60/257 (23%)

Query: 71  KVY-TGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTV----YLMASATAEFLADI 125
           KVY  G  A  VG  L+ A ++  ++    L     +P  T+     L A     F+  +
Sbjct: 6   KVYFAGCSALNVGTLLKTATRFTTFDRACQLLHDPENPNGTISGPRLLAAGVITGFMESL 65

Query: 126 MLCPFEAIKV-------------------KQQTTMPPFCN--------NVVDGWKKMYAE 158
           ++ PFE IK                    K++ T+ P           +    W   Y E
Sbjct: 66  LVIPFENIKTTMIENALLLSERANAEPQEKKKVTVQPRATFHSQKKALHPRQKWALYYDE 125

Query: 159 ---------------SGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKE 203
                          S G++ F +G +P   RQ   +  +FT++  + Q I    P  + 
Sbjct: 126 HPSRQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLNE- 184

Query: 204 EMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSE---RKANESMSVASKRIYQKI 260
                     +F  G+++     AV+ P DV+ +++ S+        S++ A  RI+ + 
Sbjct: 185 --------YYAFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAY-RIFVEE 235

Query: 261 GFTGLWNGLMVRIVMIG 277
           GFT  W G   R++ +G
Sbjct: 236 GFTKFWKGWAPRLMKVG 252

 Score = 35.4 bits (80), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 4/87 (4%)

Query: 16  EFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKL--YTSNLQGFRKIIANEGWKKVY 73
           E+YA   LG I +C    +   P+D++K R+Q       Y ++L    +I   EG+ K +
Sbjct: 184 EYYA-FALGFISSCAVV-AVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEEGFTKFW 241

Query: 74  TGFGATFVGYSLQGAGKYGGYEYFKHL 100
            G+    +   L G   +G Y+Y  +L
Sbjct: 242 KGWAPRLMKVGLSGGVSFGVYQYVDNL 268

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 86/192 (44%), Gaps = 23/192 (11%)

Query: 20  TCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGAT 79
           + T G +I  G     + PLD++K + Q NP+ +    +GF KII +EG+  +Y G+G T
Sbjct: 122 SATAGSLIGIGEI--VLLPLDVLKIKRQTNPESFKG--RGFLKIIKDEGFG-LYRGWGWT 176

Query: 80  FVGYSLQGAGKYGGYEYFKHLY--------SSWLSPGVTVYLMASATAEFLADIMLCPFE 131
               +      +GG  + K           ++W    V+  + ASA+      I+  P +
Sbjct: 177 AARNAPGSFALFGGNAFAKEYILGLKDYGQATWSQNFVSSIVGASASL-----IVSAPLD 231

Query: 132 AIKVKQQTTMPPFCNNVVDGWK--KMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEK 189
            IK + Q       +N   G+K  K   ++ G  AF+KG+ P      P  +  F   + 
Sbjct: 232 VIKTRIQNRN---FDNPESGFKIIKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFALAQT 288

Query: 190 IVQKIYSVLPKK 201
           ++    +++ KK
Sbjct: 289 LIPIFDNLVSKK 300

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 110/283 (38%), Gaps = 39/283 (13%)

Query: 25  GIIACGPTHSSITPLDLVKCRLQVNPK--LYTSNLQG--FRKIIANEGWKKVYTGFGATF 80
           GI+  G  H    P+D +  RL  N      TS L    FR   +    +++ + F    
Sbjct: 21  GILEIGVFH----PVDTISKRLMSNHTKIASTSQLNSVIFRDFASEPLGRRLLSLFPG-- 74

Query: 81  VGYS-----LQGAGKYGGYEY--------FKHLYSSWLSPGVTVYLMASATAEFL---AD 124
           +GY+     LQ   KYGG  +        FK  +        T   + SATA  L    +
Sbjct: 75  LGYAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFGE-KTGKALRSATAGSLIGIGE 133

Query: 125 IMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKF 184
           I+L P + +K+K+QT    F      G+ K+  + G     Y+G      R  P +   F
Sbjct: 134 IVLLPLDVLKIKRQTNPESFKGR---GFLKIIKDEG--FGLYRGWGWTAARNAPGSFALF 188

Query: 185 TSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERK 244
                   K Y +  K   +    Q    S VG   + I    VS P DV+ ++I +   
Sbjct: 189 GG--NAFAKEYILGLKDYGQATWSQNFVSSIVGASASLI----VSAPLDVIKTRIQNRNF 242

Query: 245 AN-ESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLI 286
            N ES     K   +  GFT  + GL  +++  G    F + +
Sbjct: 243 DNPESGFKIIKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFAL 285

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/286 (20%), Positives = 121/286 (42%), Gaps = 32/286 (11%)

Query: 18  YATCTLGGIIACGPTHSSITPLDLVKCRLQV-------NPKLYTSNLQGFRKIIANEGWK 70
           + + T GG+ AC    +   P+++VK R+Q+       N ++YT+  Q    +  NEG +
Sbjct: 19  FGSFTAGGLAACIAV-TVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIR 77

Query: 71  KVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSP--------GVTVYLMASATAEFL 122
            +  G  A ++        + G YE  + + +    P         V + + A A +  +
Sbjct: 78  GLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGII 137

Query: 123 ADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAES-GGMKAFY--KGIVPLWCRQIPY 179
             +M  P   +K + Q+    + N +  G +  Y     G+K  Y  +G+  L+ R I  
Sbjct: 138 GAVMGSPLFLVKTRLQS----YSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLF-RGIDA 192

Query: 180 TMCKFTSFEKIVQKIYSVLPKKKEEMNALQQ-ISVSFVGGYLAGILCAAVSHPADVMVSK 238
            + +  +   +   IY+         + ++   S+      ++G+  A V +P DV++++
Sbjct: 193 AILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTR 252

Query: 239 INSER----KANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLT 280
           I +++    K      V + +I    G T L+ G   ++  IG  T
Sbjct: 253 IYNQKGDLYKGPIDCLVKTVKIE---GITALYKGFEAQVFRIGPHT 295

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/201 (20%), Positives = 83/201 (41%), Gaps = 30/201 (14%)

Query: 115 ASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYA----------ESGGMKA 164
           A   A  +A  +  P E +K++ Q        N     +++Y            + G++ 
Sbjct: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAAN-----QRIYTNPFQAMGVVFRNEGIRG 78

Query: 165 FYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKK---KEEMNALQQISVSFVGGYLA 221
             KG+V  +  QI     +   +E I     +V+ K     +E + +Q + ++   G  +
Sbjct: 79  LQKGLVAAYIYQIALNGSRLGFYEPI----RAVMNKTFYPDQESHKVQSVGINVFAGAAS 134

Query: 222 GILCAAVSHPADVMVSKINS--------ERKANESMSVASKRIYQKIGFTGLWNGLMVRI 273
           GI+ A +  P  ++ +++ S        E+     +    K IY   G  GL+ G+   I
Sbjct: 135 GIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAI 194

Query: 274 VMIGTLTSFQWLIYDSFKAYV 294
           +  G  +S Q  IY++ K ++
Sbjct: 195 LRTGAGSSVQLPIYNTAKNFL 215

 Score = 35.4 bits (80), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 69/170 (40%), Gaps = 11/170 (6%)

Query: 37  TPLDLVKCRLQV--------NPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGA 88
           +PL LVK RLQ             YT    G + I   EG K ++ G  A  +      +
Sbjct: 143 SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202

Query: 89  GKYGGYEYFKH--LYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCN 146
            +   Y   K+  L +  +  G +++L AS  +     +++ P++ I  +          
Sbjct: 203 VQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYK 262

Query: 147 NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYS 196
             +D   K   +  G+ A YKG      R  P+T+   T  E+ ++ +++
Sbjct: 263 GPIDCLVKT-VKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHA 311

>Scas_718.5
          Length = 324

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 111/291 (38%), Gaps = 32/291 (10%)

Query: 1   MESNKQPRKIQLYTKEFYATCTLGGIIA--CGPTHSSIT--PLDLVKCRLQVNPKLYTSN 56
           M SN        ++    +T  L  I+A  CG     I   P D  K R+Q + K     
Sbjct: 18  MASNGNDNNGSSHSMAKDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAK-SVGA 76

Query: 57  LQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT------ 110
           L   RK++ NEG    Y G     VG     + ++G  E  K  +  W +   T      
Sbjct: 77  LDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGT 136

Query: 111 ----VYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNV----VDGWKKMYAESGGM 162
                Y +   T   +   +  P E ++++ QT             +D  +K+  E    
Sbjct: 137 LQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---- 192

Query: 163 KAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAG 222
           K+  +G+ P+  R      C F ++E +   I + + K K+          S+  G L+G
Sbjct: 193 KSLMRGLRPMMLRAGHGLGCYFLTYEAL---IANEIKKGKDRSEIASWKLCSY--GSLSG 247

Query: 223 ILCAAVSHPADVMVSKINSERKAN----ESMSVASKRIYQKIGFTGLWNGL 269
           ++     +P DV+ S I ++   N     SM      +Y++ G +  + G 
Sbjct: 248 VVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGF 298

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 79/200 (39%), Gaps = 29/200 (14%)

Query: 14  TKEFYATCTLGGIIACGPTHSSI-----TPLDLVKCRLQV-----NPKLYTSNLQGFRKI 63
           T+    T  LG    CG T   +     +P++ V+ RLQ      N + +   L   RK+
Sbjct: 130 TQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKL 189

Query: 64  IANEGWKK--------VYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMA 115
           +  +   +           G G  F+ Y    A +    +    + +SW    +  Y   
Sbjct: 190 VKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEI-ASW---KLCSYGSL 245

Query: 116 SATAEFLADIMLCPFEAIKVKQQTTM---PPFCNNVVDGWKKMYAESGGMKAFYKGIVPL 172
           S    +LA   + P + +K   QT     P F N++ +    +Y E G + AF+KG  P 
Sbjct: 246 SGVVLWLA---IYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQG-ISAFFKGFAPT 301

Query: 173 WCRQIPYTMCKFTSFEKIVQ 192
             R  P     F +FE +++
Sbjct: 302 MLRAAPVNGATFVTFELVMR 321

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/319 (18%), Positives = 119/319 (37%), Gaps = 45/319 (14%)

Query: 5   KQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSN---LQGFR 61
           ++  +++ + K+      L G IA   + + ++P + VK  LQV       N        
Sbjct: 10  EEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIG 69

Query: 62  KIIANEGWKKVYTGFG--------------ATFVG-----YSLQGAGKYGGYEYFKHLYS 102
           ++   E  K ++ G G                F G     + +   GK      ++ L+S
Sbjct: 70  QVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFS 129

Query: 103 SWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDG---WK---KMY 156
             L  G +V       A +  D++                   +++      WK   K Y
Sbjct: 130 GALCGGCSV------VATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAY 183

Query: 157 AESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFV 216
           AE GG+   Y+G+ P     +PY    F  +E++ + + S         ++L ++S+   
Sbjct: 184 AEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM--- 240

Query: 217 GGYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKI-------GFTGLWNGL 269
            G ++G +   +++P D++  +          +      ++  +       GF G + GL
Sbjct: 241 -GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGL 299

Query: 270 MVRIVMIGTLTSFQWLIYD 288
              +  +   T+  WL+Y+
Sbjct: 300 TANLFKVVPSTAVSWLVYE 318

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/210 (20%), Positives = 93/210 (44%), Gaps = 23/210 (10%)

Query: 103 SWLSPGVTVYLMASATAEFLADIMLCPFEAIKV--KQQTTMPPFCNNVVDGWKKMYAESG 160
           ++L     V  +A   A  ++  ++ PFE +K+  + Q++   +   + D   ++Y E  
Sbjct: 17  NFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEEN 76

Query: 161 GMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPK-KKEEMNALQQISVSFVGGY 219
            +K  ++G      R  PY+  +F  FE   + I+ V  K K E++N  Q++      G 
Sbjct: 77  -IKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRL----FSGA 131

Query: 220 LAGILCAAVSHPADVM----------VSKINSERKANESM-----SVASKRIYQKIGFTG 264
           L G      ++P D++          +SK++  R ++ +       + SK   ++ G  G
Sbjct: 132 LCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMG 191

Query: 265 LWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
           L+ G+    + I    +  + +Y+  K ++
Sbjct: 192 LYRGVWPTSLGIVPYVALNFAVYEQLKEFM 221

 Score = 31.2 bits (69), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 54/106 (50%), Gaps = 9/106 (8%)

Query: 197 VLPKKKEEMNAL-----QQISVSFVGGYLAGILCAAVSHPAD---VMVSKINSERKANES 248
           +LP  +EE N L     Q  +V+F+ G +AG +   V  P +   +++   +S    N+ 
Sbjct: 5   ILPAIEEE-NQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKG 63

Query: 249 MSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
           +  A  ++Y++    GL+ G  +  + +   ++ Q+++++  K ++
Sbjct: 64  LFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHI 109

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 79/186 (42%), Gaps = 16/186 (8%)

Query: 27  IACGPTHSSI-----TPLDLVKCRLQV--------NPKLYTSNLQGFRKIIANEGWKKVY 73
           +A G T   +     +PL LVK R+Q             YTS   G   I  +EG K ++
Sbjct: 130 VAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLF 189

Query: 74  TGFGATFVGYSLQGAGKYGGYEYFKH--LYSSWLSPGVTVYLMASATAEFLADIMLCPFE 131
            G  A  +   +  A +   Y   K+  L    ++ G  ++L++S  A F   + + P++
Sbjct: 190 RGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAGFGVGVAMNPWD 249

Query: 132 AIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIV 191
            +  +         +  +D + K    + G+ A YKG      R  P+T+   T  E+ +
Sbjct: 250 VVLTRVYNQKGNLYSGPIDCFIKT-VRNEGLSALYKGFGAQILRIGPHTVLCLTFMEQTL 308

Query: 192 QKIYSV 197
           + +YSV
Sbjct: 309 KLVYSV 314

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 60/301 (19%), Positives = 122/301 (40%), Gaps = 30/301 (9%)

Query: 2   ESNKQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVN-------PKLYT 54
           +  K  +K   +    + +   GG+ AC    +   P D VK R+Q+         K+YT
Sbjct: 5   QEEKHNQKTAAHKVSKFGSFVAGGLAACIAV-TVTNPFDCVKTRMQLQGELHANAAKVYT 63

Query: 55  SNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT---- 110
           + +Q F  I  NEG   +  G  + ++        + G YE  + + ++   P V     
Sbjct: 64  NPIQAFGVIFKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKV 123

Query: 111 ----VYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAES-GGMKAF 165
               + + A AT+  +   +  P   +K + Q+    + N +  G +  Y  +  G+   
Sbjct: 124 QHIGINVAAGATSGVVGAFIGSPLFLVKTRMQS----YSNAIHIGQQTHYTSAFNGLATI 179

Query: 166 YK--GIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPK---KKEEMNALQQISVSFVGGYL 220
           ++  GI  L+ R +   M +      +   IY++      K + MN      +  +   +
Sbjct: 180 FRSEGIKGLF-RGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMN--DGTGLHLLSSTI 236

Query: 221 AGILCAAVSHPADVMVSKINSERKANESMSVAS-KRIYQKIGFTGLWNGLMVRIVMIGTL 279
           AG       +P DV+++++ +++    S  +    +  +  G + L+ G   +I+ IG  
Sbjct: 237 AGFGVGVAMNPWDVVLTRVYNQKGNLYSGPIDCFIKTVRNEGLSALYKGFGAQILRIGPH 296

Query: 280 T 280
           T
Sbjct: 297 T 297

 Score = 34.3 bits (77), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 37/196 (18%), Positives = 78/196 (39%), Gaps = 16/196 (8%)

Query: 113 LMASATAEFLADIMLCPFEAIKVKQQTTMPPFCN------NVVDGWKKMYAESGGMKAFY 166
            +A   A  +A  +  PF+ +K + Q       N      N +  +  ++   G +    
Sbjct: 24  FVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEG-IAGLQ 82

Query: 167 KGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCA 226
           KG+   +  QI     +   +E I   + +V     E  + +Q I ++   G  +G++ A
Sbjct: 83  KGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVES-HKVQHIGINVAAGATSGVVGA 141

Query: 227 AVSHPADVMVSKINSERKANE--------SMSVASKRIYQKIGFTGLWNGLMVRIVMIGT 278
            +  P  ++ +++ S   A          S       I++  G  GL+ G+   ++  G 
Sbjct: 142 FIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDAAMLRTGI 201

Query: 279 LTSFQWLIYDSFKAYV 294
            ++ Q  IY+  K ++
Sbjct: 202 GSAVQLPIYNICKNFL 217

>Kwal_26.7972
          Length = 358

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 113/293 (38%), Gaps = 44/293 (15%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQV-NPKL--YTSNLQGFRK----IIANEGWKKVYTG 75
           L G IA     + I PLD +K   Q  NP    Y+ +  G  +    I A++G +  Y G
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQG 91

Query: 76  FGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLADI-MLCPFEAIK 134
             AT +      A K+  YE  +H              +AS +   L  + M  P + I+
Sbjct: 92  HSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYETHARRLASGSMAGLCSVFMTYPLDLIR 151

Query: 135 VKQQTTMPPFCNNVVDGWKKMYAESGGMK---------------AFYKGIVPLWCRQIPY 179
           V+           ++   K++Y E                     FY+G  P     IPY
Sbjct: 152 VRLAYVTDRSRIKMLPVIKQIYTERASESLTSKSYVPRWFAHWCNFYRGFTPTVLGMIPY 211

Query: 180 TMCKFTSFE---KIVQ----KIYSVLPKKKEEMNALQQISVS--------FVGGYLAGIL 224
               F + +    I++      YSVLP   EE+    +   S         V G LAG+ 
Sbjct: 212 AGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPLKTWAELVAGGLAGMA 271

Query: 225 CAAVSHPADVM-----VSKINSERKAN-ESMSVASKRIYQKIGFTGLWNGLMV 271
               S+P +++     VS ++     N +++    + IY++ G+ G + GL +
Sbjct: 272 SQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWRGFFVGLSI 324

>Scas_721.129
          Length = 323

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/199 (20%), Positives = 86/199 (43%), Gaps = 22/199 (11%)

Query: 113 LMASATAEFLADIMLCPFEAIKVKQQ------TTMPPFCNNVVDGWKKMYAESGGMKAFY 166
            +A   A  +A     P E +K++ Q              N + G   ++   G ++   
Sbjct: 25  FIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEG-IRGLQ 83

Query: 167 KGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCA 226
           KG+V  +  QI     +   +E I   + S      EE + +Q++S++   G  +GI+ A
Sbjct: 84  KGLVAAYIYQIGLNGSRLGFYEPIRNALNSTF-YPNEESHKIQKVSINVAAGASSGIIGA 142

Query: 227 AVSHPADVMVSKINSERKANESMSVASKRIYQKI-----------GFTGLWNGLMVRIVM 275
            +  P  ++ +++ S    ++++ +  +  Y+ +           GF GL+ G+   I+ 
Sbjct: 143 VIGSPLFLVKTRMQS---YSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILR 199

Query: 276 IGTLTSFQWLIYDSFKAYV 294
            G  +S Q  IY++ K ++
Sbjct: 200 TGAGSSVQLPIYNTAKNFL 218

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 83/203 (40%), Gaps = 35/203 (17%)

Query: 3   SNKQPRKIQLYTKEFYATCTLGGIIACGPTH----SSITPLDLVKCRLQ-------VNPK 51
           S+ +P+K ++           G  IA G       +   P++LVK R+Q       V  K
Sbjct: 2   SDTKPQKKEIEKTAAQKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQK 61

Query: 52  LYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPG--- 108
           +Y + +QG   I  NEG + +  G  A ++        + G YE  ++  +S   P    
Sbjct: 62  VYRNPIQGMGVIFRNEGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEES 121

Query: 109 -----VTVYLMASATAEFLADIMLCPF-----------EAIKVKQQTTMPPFCNNVVDGW 152
                V++ + A A++  +  ++  P            +AIK+ +QT       NV +G 
Sbjct: 122 HKIQKVSINVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQT----HYRNVWNGL 177

Query: 153 KKMYAESGGMKAFYKGIVPLWCR 175
             + A + G K  ++GI     R
Sbjct: 178 STI-ARTEGFKGLFRGIDAAILR 199

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 87/210 (41%), Gaps = 22/210 (10%)

Query: 4   NKQPRKIQLYTKEFYATCT---LGGIIACGPTHSSITPLDLVKCRLQ-------VNPKLY 53
           N++  KIQ  +    A  +   +G +I         +PL LVK R+Q       +  + +
Sbjct: 118 NEESHKIQKVSINVAAGASSGIIGAVIG--------SPLFLVKTRMQSYSDAIKIGEQTH 169

Query: 54  TSNL-QGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKH--LYSSWLSPGVT 110
             N+  G   I   EG+K ++ G  A  +      + +   Y   K+  L +  +  G  
Sbjct: 170 YRNVWNGLSTIARTEGFKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPG 229

Query: 111 VYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIV 170
           ++L AS  +     +++ P++ I  +            VD + K    + G+ A YKG  
Sbjct: 230 LHLTASTISGLGVAVVMNPWDVILTRIYNQKGNLYKGPVDCFVKT-VRTEGISALYKGFQ 288

Query: 171 PLWCRQIPYTMCKFTSFEKIVQKIYSVLPK 200
               R  P+T+   T  E+ ++ +YSV  K
Sbjct: 289 AQILRIAPHTIICLTFMEQTMKLVYSVESK 318

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 83/191 (43%), Gaps = 22/191 (11%)

Query: 20  TCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGAT 79
           +   G +I  G     + PLD++K + Q NP+ +    +GF KI+ +EG   +Y G+G T
Sbjct: 122 SAAAGSLIGIGEI--VLLPLDVLKIKRQTNPESFKG--RGFIKILRDEGLFNLYRGWGWT 177

Query: 80  FVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLAD--------IMLCPFE 131
               +      +GG  + K         G+  Y  A+ +  F++         I+  P +
Sbjct: 178 AARNAPGSFALFGGNAFAKEYIL-----GLKDYSQATWSQNFISSIVGACSSLIVSAPLD 232

Query: 132 AIKVKQQTTMPPFCNNVVDGWK--KMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEK 189
            IK + Q       +N   G +  K   ++ G+ AF+KG+ P      P  +  F   + 
Sbjct: 233 VIKTRIQNRN---FDNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGPKLVFSFALAQS 289

Query: 190 IVQKIYSVLPK 200
           ++ +  ++L K
Sbjct: 290 LIPRFDNLLSK 300

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 108/275 (39%), Gaps = 36/275 (13%)

Query: 38  PLDLVKCRLQVNPKLYTS----NLQGFRKIIANEGWKKVYTGFGATFVGYS-----LQGA 88
           P+D +  RL  N    TS    N   FR   +    K+++T F    +GY+     LQ  
Sbjct: 30  PVDTISKRLMSNHTKITSGQELNRVIFRDHFSEPLGKRLFTLFPG--LGYAASYKVLQRV 87

Query: 89  GKYGGY--------EYFKHLYSSWLSPGVTVYLMASATAEFLA--DIMLCPFEAIKVKQQ 138
            KYGG         +++K  + +         + ++A    +   +I+L P + +K+K+Q
Sbjct: 88  YKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAAGSLIGIGEIVLLPLDVLKIKRQ 147

Query: 139 TTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVL 198
           T    F      G+ K+  +  G+   Y+G      R  P +   F        K Y + 
Sbjct: 148 TNPESFKGR---GFIKILRDE-GLFNLYRGWGWTAARNAPGSFALFGG--NAFAKEYILG 201

Query: 199 PKKKEEMNALQQISVSFVGGYLAGILCAA--VSHPADVMVSKINSERKAN-ESMSVASKR 255
            K   +    Q    S VG       C++  VS P DV+ ++I +    N ES     K 
Sbjct: 202 LKDYSQATWSQNFISSIVGA------CSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKN 255

Query: 256 IYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSF 290
             +  G T  + GL  +++  G    F + +  S 
Sbjct: 256 TLKNEGVTAFFKGLTPKLLTTGPKLVFSFALAQSL 290

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 124/308 (40%), Gaps = 52/308 (16%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNP----KLYTSNLQGFRKII---ANEGW---KKV 72
           + G+ A   T   + PLDL+K RLQ++     K +       ++II   AN G     ++
Sbjct: 14  ISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVTNEL 73

Query: 73  YTGFGATFVGYSLQGAGKYGGYEYFKHL-YSSWLSPGVT--------------VYLMASA 117
           Y G      G ++     +G Y   K L Y S   PG T              +YL A A
Sbjct: 74  YRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLSAGA 133

Query: 118 TAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYA------ESGGMKAFYKGIVP 171
           ++  +  I+  P   IK +  +T           +  MY        + G +  +KG+VP
Sbjct: 134 SSGLMTAILTNPIWVIKTRIMST----SKGAQGAYTSMYNGVQQLLRTDGFQGLWKGLVP 189

Query: 172 LWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKE-----EMNALQQISVSFVGGYLAGILCA 226
                +      F  ++ + Q+    L +K+E      +  L+ I ++ +G     ++  
Sbjct: 190 ALF-GVSQGALYFAVYDTLKQR---KLRRKRENGLDIHLTNLETIEITSLGK----MVSV 241

Query: 227 AVSHPADVMVSKINSERKANES---MSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQ 283
            + +P  ++ S + S R ANE    +    K I    GF GL+ GL   +V     T   
Sbjct: 242 TLVYPFQLLKSNLQSFR-ANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCIT 300

Query: 284 WLIYDSFK 291
           + +Y++ K
Sbjct: 301 FCVYENLK 308

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 78/188 (41%), Gaps = 25/188 (13%)

Query: 23  LGGIIACGPTHSS-----ITPLDLVKCRLQV-NPKL------YTSNLQGFRKIIANEGWK 70
           LG I+  G    S     +TP++LVKC+LQV N ++      +T  L   + II   G  
Sbjct: 107 LGQILISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLA 166

Query: 71  KVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLS--------PGVTVYLMASATAEFL 122
            ++ G   TF+  S  G   +  YE  K       S          +   L++  +A   
Sbjct: 167 GLWQGQSGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLA 226

Query: 123 ADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMC 182
            +  + P + +K   QT      N V    KK++ +  G+K FY+G+     R +P    
Sbjct: 227 FNASIFPADTVKSVMQTEHISLTNAV----KKIFGKF-GLKGFYRGLGITLFRAVPANAA 281

Query: 183 KFTSFEKI 190
            F  FE +
Sbjct: 282 VFYIFETL 289

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/271 (22%), Positives = 114/271 (42%), Gaps = 28/271 (10%)

Query: 38  PLDLVKCRLQVNP-KLYTSNLQGFRKIIANEGWKK-VYTGFGATFVGYSLQGAGKYGGYE 95
           P D VK RLQ     ++ +     +    NEG  +  + G  +  VG  L+ A  +  Y 
Sbjct: 33  PFDTVKVRLQTQASNVFPTTWSCIKFTYQNEGIARGFFQGIASPLVGACLENATLFVSY- 91

Query: 96  YFKHLYSSWLSPGVTVY-----LMASATAEFLADIMLCPFEAIKVKQQTTMPPFCN---- 146
              +  S +L     V+     L++   A   A ++L P E +K K Q       +    
Sbjct: 92  ---NQCSKFLEKHTNVFPLGQILISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTK 148

Query: 147 --NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFE---KIVQKIYSVLPKK 201
              V+   K +  E G +   ++G    + R+    +  F ++E   K ++  +S+   K
Sbjct: 149 HTKVLPTIKAIITERG-LAGLWQGQSGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPK 207

Query: 202 KEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIG 261
           ++E     +I    + G  AG+   A   PAD + S + +E   + S++ A K+I+ K G
Sbjct: 208 RDE----SKIWELLISGGSAGLAFNASIFPADTVKSVMQTE---HISLTNAVKKIFGKFG 260

Query: 262 FTGLWNGLMVRIVMIGTLTSFQWLIYDSFKA 292
             G + GL + +       +  + I+++  A
Sbjct: 261 LKGFYRGLGITLFRAVPANAAVFYIFETLSA 291

>Kwal_27.12081
          Length = 369

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 91/193 (47%), Gaps = 31/193 (16%)

Query: 32  THSSITPLDLVKCRLQVNP----KLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQG 87
           T ++  P+ L+K RLQ++     + Y ++    + II  EG+  +Y G  A+++G S++G
Sbjct: 181 TSTATNPIWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLG-SVEG 239

Query: 88  AGKYGGYEYFKHLYS-------SWLSPG-------VTVYLMASAT---AEFLADIMLCPF 130
             ++  YE  K +           +S G       +  +   S +   A+FLA I+  P 
Sbjct: 240 ILQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTYPH 299

Query: 131 EAIKVKQQTTMPPFCNN------VVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKF 184
           E ++ + +    P  N+      ++  ++ +  E  G+ + Y G+ P   R +P ++  F
Sbjct: 300 EVVRTRLRQA--PLENDKLKYTGLIQSFRVIIKEE-GLASMYGGLTPHLLRTVPNSIIMF 356

Query: 185 TSFEKIVQKIYSV 197
            ++E +++ +  V
Sbjct: 357 GTWELVIKLLSDV 369

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/287 (21%), Positives = 117/287 (40%), Gaps = 46/287 (16%)

Query: 38  PLDLVKCRLQVN--------------PKLYTSNLQGFRK---IIAN----EGWKKVYTGF 76
           P D+VK RLQ +                + +S ++ FR+   II+N    EG++ ++ G 
Sbjct: 72  PFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSLFKGL 131

Query: 77  GATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT---VYLMASATAEFLADIMLCPFEAI 133
           G   VG     +  +  Y   K +YS   + G     ++L+++ATA +       P   I
Sbjct: 132 GPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPWIHLISAATAGWATSTATNPIWLI 191

Query: 134 KVKQQTTMPPFCNNVVDGW---KKMYAESG------GMKAFYKGIVPLWCRQIPYTMCKF 184
           K + Q           + W   K +  + G      G+ A Y G V    + + Y   K 
Sbjct: 192 KTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLGSVEGILQWLLYEQMKQ 251

Query: 185 TSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERK 244
               + ++K   +   +K     +++         LA  L + V++P +V+ +++     
Sbjct: 252 MIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTYPHEVVRTRLRQAPL 311

Query: 245 ANESMS----VASKR-IYQKIGFTGLWNGL---MVR-----IVMIGT 278
            N+ +     + S R I ++ G   ++ GL   ++R     I+M GT
Sbjct: 312 ENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGT 358

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 57/316 (18%), Positives = 123/316 (38%), Gaps = 39/316 (12%)

Query: 5   KQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSN---LQGFR 61
           +QP  I+ + K+      L G +A   + + ++P + VK  LQV     + N       R
Sbjct: 9   EQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIR 68

Query: 62  KIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKH-LYSSWLSPGV-----TVYLMA 115
           ++   EG K ++ G G   +      A ++  YE  K  L+    + G      T  L +
Sbjct: 69  QVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFS 128

Query: 116 SATAEFLADIMLCPFEAIKVK----------------QQTTMPPFCNNVVDGWKKMYAES 159
            A     + +   P + IK +                +  + PP    ++    + Y   
Sbjct: 129 GALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLS---ETYRLE 185

Query: 160 GGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGY 219
           GG++  Y+G+ P     +PY    F  +E++ +   +    +    + L ++++    G 
Sbjct: 186 GGLRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTI----GA 241

Query: 220 LAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKI-------GFTGLWNGLMVR 272
           ++G +   +++P D++  +          +      ++  +       G +G + GL   
Sbjct: 242 ISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAAN 301

Query: 273 IVMIGTLTSFQWLIYD 288
           +  +   T+  WL+Y+
Sbjct: 302 LFKVVPSTAVSWLVYE 317

 Score = 31.2 bits (69), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 22/103 (21%), Positives = 54/103 (52%), Gaps = 4/103 (3%)

Query: 193 KIYSVLPKKKEEMNALQQIS-VSFVGGYLAGILCAAVSHPAD---VMVSKINSERKANES 248
           ++ +VL +     + L+Q S ++F+ G +AG +   V  P +   +++   +S    N  
Sbjct: 3   EVLTVLEQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRG 62

Query: 249 MSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFK 291
           +  + +++Y + G  GL+ G  +  + I   ++ Q+++Y++ K
Sbjct: 63  IFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACK 105

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/282 (18%), Positives = 121/282 (42%), Gaps = 40/282 (14%)

Query: 38  PLDLVKCRLQV-------NPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGK 90
           PLD+VK R+Q+       +   Y   +    +I+  EG+ ++Y G  +  +  + + A K
Sbjct: 28  PLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATK 87

Query: 91  YGGYEYFKHLYSSWLSPGVT-----VYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFC 145
           +   + ++ ++      GV      + +++ + A      ++ PFE +K++ Q     F 
Sbjct: 88  FACNDSYQKMFKDLY--GVDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSKF- 144

Query: 146 NNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEM 205
           N  ++   K   E+G + + Y G+     R   +    F     ++ +I ++LPK K   
Sbjct: 145 NGPMEVVFKTIRETG-ILSLYNGLESTMWRNAFWNGGYF----GVIFQIRALLPKAKTNT 199

Query: 206 NALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASK----------- 254
              ++ +   + G + G    +  H    ++S + S  ++  + ++A             
Sbjct: 200 ---EKTTNDLIAGTIGGYCRYSTEH---TILSVVKSRIQSGATTTLADGTVVPKYNWTWP 253

Query: 255 ---RIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAY 293
              +IY + GFT L+ G + +I+ +G       ++++   A+
Sbjct: 254 SLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAF 295

>Kwal_27.11626
          Length = 299

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 87/192 (45%), Gaps = 23/192 (11%)

Query: 20  TCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGAT 79
           + T G +I  G     + PLD++K + Q NP+ +    +GF KI+ +EG+  +Y G+G T
Sbjct: 121 SATAGSLIGIGEI--VLLPLDVLKIKRQTNPESFKG--RGFIKILKDEGFG-LYRGWGWT 175

Query: 80  FVGYSLQGAGKYGGYEYFKHL------YSS--WLSPGVTVYLMASATAEFLADIMLCPFE 131
               +      +GG  + K        YSS  W    V+  + ASA+      I+  P +
Sbjct: 176 AARNAPGSFALFGGNAFAKEYILGLKDYSSATWSQNFVSSIVGASASL-----IVSAPLD 230

Query: 132 AIKVKQQTTMPPFCNNVVDGWK--KMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEK 189
            IK + Q       +N   G++  +   ++ G+ AF+KG+ P      P  +  F   + 
Sbjct: 231 VIKTRIQNRH---FDNPESGFRIVQNTLKNEGITAFFKGLTPKLLTTGPKLVFSFALAQS 287

Query: 190 IVQKIYSVLPKK 201
           ++     +L +K
Sbjct: 288 LIPAFDKMLGQK 299

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 115/287 (40%), Gaps = 39/287 (13%)

Query: 25  GIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQG----FRKIIANEGWKKVYTGFGATF 80
           GI+  G  H    P+D V  RL  N    +S+ Q     FR+       K+++T F    
Sbjct: 20  GILEIGVFH----PVDTVSKRLMSNHTKISSSAQLNSVIFREHAGEALGKRLFTLFPG-- 73

Query: 81  VGYS-----LQGAGKYGGYEY--------FKHLYSSWLSPGVTVYLMASATAEFL---AD 124
           +GY+     LQ   KYGG  +        FK  + +      T   + SATA  L    +
Sbjct: 74  LGYAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFGE-KTGKALRSATAGSLIGIGE 132

Query: 125 IMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKF 184
           I+L P + +K+K+QT    F      G+ K+  + G     Y+G      R  P +   F
Sbjct: 133 IVLLPLDVLKIKRQTNPESFKGR---GFIKILKDEG--FGLYRGWGWTAARNAPGSFALF 187

Query: 185 TSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERK 244
                   K Y +L  K        Q  VS + G  A ++   VS P DV+ ++I +   
Sbjct: 188 GG--NAFAKEY-ILGLKDYSSATWSQNFVSSIVGASASLI---VSAPLDVIKTRIQNRHF 241

Query: 245 AN-ESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSF 290
            N ES     +   +  G T  + GL  +++  G    F + +  S 
Sbjct: 242 DNPESGFRIVQNTLKNEGITAFFKGLTPKLLTTGPKLVFSFALAQSL 288

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 64/266 (24%), Positives = 110/266 (41%), Gaps = 37/266 (13%)

Query: 25  GIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYS 84
           G  A   T  +  P+D +K RLQ     +           AN G+K VY G G+  +  +
Sbjct: 13  GAAAGTSTDLAFFPIDTLKTRLQAKGGFF-----------ANGGYKGVYRGLGSAVIASA 61

Query: 85  LQGAGKYGGYEYFKHLYSSWLSPGVT---------VYLMASATAEFLADIMLCPFEAIKV 135
              +  +  Y+  K      +S  VT          ++ +S+  E  A ++  P E IK 
Sbjct: 62  PSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGEVSACLVRVPAEVIKQ 121

Query: 136 KQQTTMPPFCNNVVDGWKKMYAESGG---MKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQ 192
           + QT      N+    + K+     G   ++  Y+G      R+IP+T  +F        
Sbjct: 122 RTQTHK---TNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCIQF-------- 170

Query: 193 KIYSVLPKKKEEMNALQQIS--VSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMS 250
            +Y  L K   + N    ++     V G +AG + AA + P DV+ +++    K+     
Sbjct: 171 PLYEFLKKTWAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLMLSHKSIPVAQ 230

Query: 251 VASKRIYQKIGFTGLWNGLMVRIVMI 276
           +A K IY + GF   ++G+  R + I
Sbjct: 231 LA-KNIYAEEGFKVFFSGVGPRTMWI 255

 Score = 28.9 bits (63), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 1/65 (1%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYF 97
           PLD++K RL ++ K      Q  + I A EG+K  ++G G   +  S  GA   G YE  
Sbjct: 211 PLDVLKTRLMLSHK-SIPVAQLAKNIYAEEGFKVFFSGVGPRTMWISAGGAIFLGVYETV 269

Query: 98  KHLYS 102
             + S
Sbjct: 270 HSILS 274

>Scas_667.22
          Length = 306

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 102/248 (41%), Gaps = 28/248 (11%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYF 97
           P D  K RLQ +    T+ ++  RK++ NEG K  Y G     +G     + ++G  E  
Sbjct: 45  PFDTTKVRLQTS-STPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAM 103

Query: 98  KHLYSSWLSPGVTV-------YLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCN---- 146
           K  + S  +P  T        Y +   T       +  P E ++++ QT      N    
Sbjct: 104 KRFFHSR-NPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFK 162

Query: 147 NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIV-QKIYSVLPKKKEEM 205
             +D  +K+ A+ G    F +G+ P   R+       F  +E +V  +I      K+ E+
Sbjct: 163 GPLDCIRKLRAQGG----FMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGF--KRTEV 216

Query: 206 NALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSER----KANESMSVASKRIYQKIG 261
            A +      + G L+G     + +P DV+ S + ++     K   S+S  +K +Y K G
Sbjct: 217 PAWKLC----LFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYAKGG 272

Query: 262 FTGLWNGL 269
               + G 
Sbjct: 273 LGAFFKGF 280

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 125 IMLCPFEAIKVKQQTT---MPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTM 181
           +M+ P + IK   QT     P + N++    K +YA+ GG+ AF+KG  P   R  P   
Sbjct: 234 MMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYAK-GGLGAFFKGFGPTMLRAAPANG 292

Query: 182 CKFTSFE 188
             F +FE
Sbjct: 293 ATFATFE 299

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 70/144 (48%), Gaps = 18/144 (12%)

Query: 123 ADIMLCPFEAIKVKQQTTMPPFCN------NVVDGWKKMYAESGGMKAFYKGIVPLWCRQ 176
           A  ++ P + IK+  QT+ P +         +V+  K ++  + G++ F++G      R 
Sbjct: 47  AKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWI-NDGVRGFFQGHSATLLRI 105

Query: 177 IPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMV 236
            PY   KF ++E+I     +++P K+ E +  + +S     G LAG+    +++P D++ 
Sbjct: 106 FPYAAVKFVAYEQIRN---TLIPSKEFESHWRRLVS-----GSLAGLCSVFITYPLDLVR 157

Query: 237 SKINSERKANESMSVASKRIYQKI 260
            ++  E    E   V   RI +KI
Sbjct: 158 VRLAYE---TEHKRVKLGRIIKKI 178

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 68/333 (20%), Positives = 128/333 (38%), Gaps = 58/333 (17%)

Query: 16  EFYATCTLGGIIACGPTHSSITPLDLVKCRLQV-NPKL--YTSNLQGF----RKIIANEG 68
           ++     L G I+     + I PLD +K   Q  NP    YT +L G     + I  N+G
Sbjct: 31  DYIVRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDG 90

Query: 69  WKKVYTGFGATFVGYSLQGAGKYGGYEYF-------KHLYSSWLSPGVTVYLMASATAEF 121
            +  + G  AT +      A K+  YE         K   S W        L++ + A  
Sbjct: 91  VRGFFQGHSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFESHWRR------LVSGSLAGL 144

Query: 122 LADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMK---------------AFY 166
            +  +  P + ++V+           +    KK+Y E                     FY
Sbjct: 145 CSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFY 204

Query: 167 KGIVPLWCRQIPYTMCKFTSFEKIVQKI-------YSVLP-KKKEEMNALQQIS------ 212
           +G VP     IPY    F + + +   +       YSVL   + +E+  +Q+        
Sbjct: 205 RGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRT 264

Query: 213 -VSFVGGYLAGILCAAVSHPADVM-----VSKINSERKAN---ESMSVASKRIYQKIGFT 263
               + G LAG+     ++P +++     VS ++ +   +   +S+S  +  I+++ G  
Sbjct: 265 WAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVR 324

Query: 264 GLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVGL 296
           G + GL +  + +  + +  + +Y+  K   G+
Sbjct: 325 GFFVGLSIGYIKVTPMVACSFFVYERMKWNFGI 357

>Scas_662.12
          Length = 308

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 86/189 (45%), Gaps = 21/189 (11%)

Query: 24  GGIIACGPTHSSITPLDLVKCRLQVNPKL----YTSNLQGFRKIIANEGWKKVYTGFGAT 79
            G+I+   T     PL ++K R+    +     Y S   GF+ ++  EG K ++ G   +
Sbjct: 123 SGLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLLPS 182

Query: 80  FVGYSLQGAGKYGGYEYFKHLYSSWLS--------PGVTVYLMASATAEFLADIMLCPFE 131
            +G S QGA  +  Y+  K  ++  L+          + + L++S  ++ L+ + + PF+
Sbjct: 183 LLGVS-QGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSL-SKMLSVMSVYPFQ 240

Query: 132 AIKVKQQT------TMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFT 185
            +K   QT       +P    + +   +K+Y ++G +K  YKG+     R IP T   F 
Sbjct: 241 LLKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNG-IKGLYKGLSANLLRAIPSTCITFC 299

Query: 186 SFEKIVQKI 194
            +E    K+
Sbjct: 300 IYENFKSKL 308

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 58/299 (19%), Positives = 118/299 (39%), Gaps = 33/299 (11%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANE---GWKK------VY 73
           + G+ A   T   + PLDL+K RLQ+     T   Q     + NE     KK      +Y
Sbjct: 12  ISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQGPIY 71

Query: 74  TGFGATFVGYSLQGAGKYGGYEYFKHLYSS----------WLSPGVTVYLMASATAEFLA 123
                ++ G  +   G    +  +  +Y+S            +   T++L +   +    
Sbjct: 72  NLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTIFLTSGLISGIST 131

Query: 124 DIMLCPFEAIKVKQQTTMPPFCNN---VVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYT 180
            ++  P   IK +  +T     ++   +  G+K +  + G  KA + G++P     +   
Sbjct: 132 TLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGP-KAIWMGLLPSLL-GVSQG 189

Query: 181 MCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKIN 240
              F  ++ +       L K K++ NA   + +  +   L+ +L     +P  ++ S + 
Sbjct: 190 AIYFMIYDNLKLHFNVNLNKSKKD-NANANLKIVLISS-LSKMLSVMSVYPFQLLKSNLQ 247

Query: 241 SERKANESMSVAS-------KRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKA 292
           + R    ++           ++IY+  G  GL+ GL   ++     T   + IY++FK+
Sbjct: 248 TFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTCITFCIYENFKS 306

>Kwal_55.21335
          Length = 317

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/261 (22%), Positives = 110/261 (42%), Gaps = 19/261 (7%)

Query: 38  PLDLVKCRLQVNP-KLYTSNLQGFRKIIANEGW-KKVYTGFGATFVGYSLQGAG---KYG 92
           PLD +K RLQ  P  ++ ++    +     EG+ K  Y G  +  VG +L+ A     + 
Sbjct: 65  PLDTIKVRLQTQPAHVFPTSWSCIKYTYQKEGFVKGFYQGVASPLVGAALENAVLFVTFN 124

Query: 93  GYEYFKHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQ-TTMPPFCNNVVDG 151
             + F   Y S +SP ++  +++ A A      +L P E IK   Q + +          
Sbjct: 125 RAQNFLQQYES-VSP-LSQTVLSGAFAGACTSYVLTPVELIKCTLQVSNLEGATTRHSKI 182

Query: 152 WK--KMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQ 209
           W   K   +  G+   ++G    + R+       FT++E +  K Y    +   E +  +
Sbjct: 183 WPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESL--KSYLARRRNDTENHTWE 240

Query: 210 QISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGL 269
            ++     G  AG+   A   PAD + S   ++   +  +  A+KRI  + G  GL+ GL
Sbjct: 241 LLA----SGASAGVAFNASIFPADTIKSTAQTQ---HLGIVDATKRILARSGPAGLYRGL 293

Query: 270 MVRIVMIGTLTSFQWLIYDSF 290
            + ++      +  +  Y++ 
Sbjct: 294 GITLIRAAPANAIVFYTYETL 314

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 78/182 (42%), Gaps = 25/182 (13%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQG-----------FRKIIANEGWKK 71
           L G  A   T   +TP++L+KC LQV      SNL+G            + I+ ++G   
Sbjct: 144 LSGAFAGACTSYVLTPVELIKCTLQV------SNLEGATTRHSKIWPTVKHIVQHKGIGG 197

Query: 72  VYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWL--SPGVTVYLMAS-ATAEFLADIMLC 128
           ++ G  +TF+     GA  +  YE  K   +     +   T  L+AS A+A    +  + 
Sbjct: 198 LWQGQSSTFIRECAGGAVWFTTYESLKSYLARRRNDTENHTWELLASGASAGVAFNASIF 257

Query: 129 PFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFE 188
           P + IK   QT        +VD  K++ A S G    Y+G+     R  P     F ++E
Sbjct: 258 PADTIKSTAQTQHL----GIVDATKRILARS-GPAGLYRGLGITLIRAAPANAIVFYTYE 312

Query: 189 KI 190
            +
Sbjct: 313 TL 314

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/274 (19%), Positives = 114/274 (41%), Gaps = 33/274 (12%)

Query: 38  PLDLVKCRLQVNP---KLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGY 94
           P+D VK R Q+ P     Y       R I+  EG + ++ G       Y + GA ++G Y
Sbjct: 38  PMDTVKIRYQLQPVQEDKYKGIASTVRTIMKEEGLRALWKGNIPATAMYVVYGAVQFGSY 97

Query: 95  EYFKHLYSS----WLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVD 150
            +F +++S+    +   G T  L   A A   + ++  P + ++ +          +V +
Sbjct: 98  SWFNNVWSAKFPRFSQQGQT--LTVGALAGMTSSVVSYPLDLLRTRLIANRTSHRTSVAE 155

Query: 151 GWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQ 210
             ++M+    G++ F+ GI          T   F ++E +     +++ +  E+    + 
Sbjct: 156 ECRQMWLNE-GVRGFFTGISTAMTTVTLSTAIMFLTYETV-----NIVCENHEKEFWSRP 209

Query: 211 ISVSFVGGYLAGILCAAVSHPADVMVSK---INSERKAN-------------ESMSVASK 254
           +S S   G +AG +   +  P D +  +   +NS+R  +             +S +    
Sbjct: 210 VSAS--SGIIAGFVSKTMVFPIDTLRRRMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIY 267

Query: 255 RIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYD 288
           +I ++ G + L+ GL + +      T+    +Y+
Sbjct: 268 KILRQEGVSALYRGLTMGLCKSVPTTAISLFVYE 301

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 81/196 (41%), Gaps = 30/196 (15%)

Query: 20  TCTLGGIIACGPTHSSIT-PLDLVKCRLQVNPKLY-TSNLQGFRKIIANEGWKKVYTGFG 77
           T T+G +   G T S ++ PLDL++ RL  N   + TS  +  R++  NEG +  +TG  
Sbjct: 117 TLTVGAL--AGMTSSVVSYPLDLLRTRLIANRTSHRTSVAEECRQMWLNEGVRGFFTGIS 174

Query: 78  ATFVGYSLQGAGKYGGYEYFK-----HLYSSWLSPGVTVYLMASATAEFLADIMLCPFEA 132
                 +L  A  +  YE        H    W  P   V   +   A F++  M+ P + 
Sbjct: 175 TAMTTVTLSTAIMFLTYETVNIVCENHEKEFWSRP---VSASSGIIAGFVSKTMVFPIDT 231

Query: 133 IKVKQQ----------TTMPP------FCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQ 176
           ++ + Q          T  P       + ++    +K +  E  G+ A Y+G+    C+ 
Sbjct: 232 LRRRMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQE--GVSALYRGLTMGLCKS 289

Query: 177 IPYTMCKFTSFEKIVQ 192
           +P T      +E+ + 
Sbjct: 290 VPTTAISLFVYERTMD 305

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 74/181 (40%), Gaps = 18/181 (9%)

Query: 25  GIIACGPTHSSITPLDLVKCRLQVNPKL------YTSNLQGFRKIIANEGWKKVYTGFGA 78
            I A   +  +  P+ +VK RL +   +      Y   +  FRKII  EG K +Y G   
Sbjct: 145 AITAGAISTVATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVP 204

Query: 79  TFVGYSLQGAGKYGGYEYFKHLY----SSWLSPGVTV-----YLMASATAEFLADIMLCP 129
             +G  L  A ++  YE  K  +    S+ +S  VT       ++AS  ++ +A  +  P
Sbjct: 205 ALLGM-LNVAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYP 263

Query: 130 FEAIKVKQQ--TTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSF 187
            E ++ + Q  + +P      +    K+     G   FY G      R +P  +    SF
Sbjct: 264 HEILRTRMQLKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSF 323

Query: 188 E 188
           E
Sbjct: 324 E 324

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/281 (21%), Positives = 121/281 (43%), Gaps = 43/281 (15%)

Query: 36  ITPLDLVKCRLQVN--------PKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQG 87
           + P D+ K RLQ           + Y      F  I  +EG   +Y G   T +GY    
Sbjct: 56  VCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYKGLQPTVLGYIPTL 115

Query: 88  AGKYGGYEYFKHLYSSWLSPGVTVYLMASA--TAEFLADIMLCPFEAIKVK--QQTTMPP 143
              +  Y++ +  YS  + P       AS+  TA  ++ +   P   +K +   QT +  
Sbjct: 116 MIYFSVYDFCRK-YSVDIFPHSPFLSNASSAITAGAISTVATNPIWVVKTRLMLQTGIGK 174

Query: 144 FCNN---VVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKI-YSVLP 199
           +  +    +D ++K+  + G  KA Y G+VP     +   + +F  +E +  +  YS   
Sbjct: 175 YSTHYKGTIDTFRKIIQQEGA-KALYAGLVPALLGMLNVAI-QFPLYENLKIRFGYS--- 229

Query: 200 KKKEEMNALQQISVS-----FVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVAS- 253
              E  +    ++ S      +   L+ ++ + V++P +++ +++  + K++   +V   
Sbjct: 230 ---ESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRM--QLKSDLPNTVQRH 284

Query: 254 -----KRIYQKIGFTGLWNGL---MVRIV--MIGTLTSFQW 284
                K  Y++ GF G ++G    +VR V   + TL SF++
Sbjct: 285 LLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEY 325

 Score = 28.5 bits (62), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 39/198 (19%), Positives = 78/198 (39%), Gaps = 23/198 (11%)

Query: 111 VYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYA------ESGGMKA 164
           V  ++ A +  L+ +++CPF+  K + Q        +    +K  +       +  G   
Sbjct: 40  VAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAG 99

Query: 165 FYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGIL 224
            YKG+ P     IP  M  F+ ++   +    + P      NA   I+        AG +
Sbjct: 100 LYKGLQPTVLGYIPTLMIYFSVYDFCRKYSVDIFPHSPFLSNASSAIT--------AGAI 151

Query: 225 CAAVSHPADVMVSK------INSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGT 278
               ++P  V+ ++      I       +      ++I Q+ G   L+ GL+    ++G 
Sbjct: 152 STVATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVP--ALLGM 209

Query: 279 LT-SFQWLIYDSFKAYVG 295
           L  + Q+ +Y++ K   G
Sbjct: 210 LNVAIQFPLYENLKIRFG 227

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 76/160 (47%), Gaps = 28/160 (17%)

Query: 147 NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMN 206
           NV+    ++Y + G ++A++KG +P   RQ+  ++ +FT+F  + Q      PK+ +   
Sbjct: 180 NVLTTAAELYRQHG-LRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQ----FAPKEYQN-- 232

Query: 207 ALQQISVSFVGGYLAGIL-----CAAV--SHPADVMVSKINSERKA---NESMSVASKRI 256
                       Y A +L     CA V  + P DV+ +++ ++        S++ A  RI
Sbjct: 233 ----------NEYFATLLGLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAY-RI 281

Query: 257 YQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVGL 296
           + + GF  LW G + R++ +G   S  + IY   +  + L
Sbjct: 282 FVEEGFAMLWKGWLPRLMKVGLSGSVSFGIYQYTENMIAL 321

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 50/96 (52%), Gaps = 6/96 (6%)

Query: 7   PRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPK--LYTSNLQGFRKII 64
           P++ Q    E++AT  L G+I+      +  PLD++K R+Q      LY +++    +I 
Sbjct: 227 PKEYQ--NNEYFAT--LLGLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAYRIF 282

Query: 65  ANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHL 100
             EG+  ++ G+    +   L G+  +G Y+Y +++
Sbjct: 283 VEEGFAMLWKGWLPRLMKVGLSGSVSFGIYQYTENM 318

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 78/179 (43%), Gaps = 29/179 (16%)

Query: 36  ITPLDLVKCRLQVN---------------PKLYTSNLQGFRKIIANEGWKKVYTGFGATF 80
           +TP++L+KC+LQV+                + +T  +   + +I N G+  ++ G   TF
Sbjct: 125 LTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTF 184

Query: 81  VGYSLQGAGKYGGYE----YFKHLYS----SWLSPGVTVYLMASATAEFLA-DIMLCPFE 131
           +  S  G   +  YE    Y K  ++    S  +   T  L+AS  +  LA +  + P +
Sbjct: 185 IRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPAD 244

Query: 132 AIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKI 190
            +K   QT        +    KK++ E  G++ FY+G+     R IP     F  +E +
Sbjct: 245 TVKSMMQTEHLGLKTAI----KKIFVEK-GLRGFYRGLGITLIRAIPANATVFYVYETL 298

 Score = 35.0 bits (79), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 52/253 (20%), Positives = 99/253 (39%), Gaps = 19/253 (7%)

Query: 38  PLDLVKCRLQVNPK-LYTSNLQGFRKIIANEGW-KKVYTGFGATFVGYSLQGAGKYGGYE 95
           P D VK RLQ   + ++            NEG  K  + G  +   G +++ A  +  Y 
Sbjct: 33  PFDTVKVRLQTQGRHVFPDTWSCITYTYKNEGIIKGFFQGIASPLAGAAIENAALFLSYN 92

Query: 96  YFKHLYSSWLS-PGVTVYLMASATAEFLADIMLCPFEAIKVKQQTT----MP---PFCNN 147
                   + +   +T  L++ A A   A  +L P E IK K Q +    +P      N 
Sbjct: 93  QCSKFLQHYTNVSDLTNILISGAFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNT 152

Query: 148 VVDGWKKMYA------ESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKK 201
           V +   ++        ++ G    ++G    + R+    +  F ++E + + + S    +
Sbjct: 153 VTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRESFGGVAWFATYELMKKYLKSRHNIE 212

Query: 202 KEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIG 261
              +    +       G  AG+   A   PAD + S + +E      +  A K+I+ + G
Sbjct: 213 DPSLPNDNKTWELLASGASAGLAFNASIFPADTVKSMMQTEHLG---LKTAIKKIFVEKG 269

Query: 262 FTGLWNGLMVRIV 274
             G + GL + ++
Sbjct: 270 LRGFYRGLGITLI 282

 Score = 28.5 bits (62), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 36/182 (19%), Positives = 63/182 (34%), Gaps = 24/182 (13%)

Query: 102 SSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGG 161
           + WL+      L  S  A  L  ++  PF+ +KV+ QT       +        Y   G 
Sbjct: 7   TQWLAAAFRDILYGS-IAGALGKVIEYPFDTVKVRLQTQGRHVFPDTWSCITYTYKNEGI 65

Query: 162 MKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLA 221
           +K F++GI              F S        Y+   K  +    +  ++   + G  A
Sbjct: 66  IKGFFQGIASPLAGAAIENAALFLS--------YNQCSKFLQHYTNVSDLTNILISGAFA 117

Query: 222 GILCAAVSHPADVMVSKINSERKANESMSVAS---------------KRIYQKIGFTGLW 266
           G   + V  P +++  K+      +  + VA                + + +  GF GLW
Sbjct: 118 GSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLW 177

Query: 267 NG 268
            G
Sbjct: 178 QG 179

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/250 (21%), Positives = 107/250 (42%), Gaps = 26/250 (10%)

Query: 68  GWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHL--------YSSWLSPGVTVYLMASATA 119
           G +  Y G G   +    + A K+G +E  K L        ++S LS   T   +A    
Sbjct: 268 GIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFST--YIAGGMG 325

Query: 120 EFLADIMLCPFEAIKVKQQ----TTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCR 175
             +A   + P + +K + Q     T       ++   ++MY + GG+K FY+G+      
Sbjct: 326 GVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRD-GGLKLFYRGVTVGVMG 384

Query: 176 QIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVS-FV---GGYLAGILCAAVSHP 231
             PY      +F  +  K + +  + K     + Q+++S F+    G  +G + A V +P
Sbjct: 385 IFPYAALDLGTFSAL--KKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGTVGATVVYP 442

Query: 232 ADVMVSKINSERKANESMSVASKR-----IYQKIGFTGLWNGLMVRIVMIGTLTSFQWLI 286
            +++ +++ ++       +    R       Q+ G+ GL+ GL+  +  +    S  +L 
Sbjct: 443 INLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNLAKVCPAVSISYLC 502

Query: 287 YDSFKAYVGL 296
           Y++FK  + L
Sbjct: 503 YENFKRLMKL 512

>Scas_717.20
          Length = 356

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 75/349 (21%), Positives = 140/349 (40%), Gaps = 64/349 (18%)

Query: 2   ESNKQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQV-NPKL--YTSNLQ 58
           + N+ P  I   + E+     L G I+     + I PLD +K   Q  NP    Y  +L 
Sbjct: 18  KRNQMP--IDKNSLEYITRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLV 75

Query: 59  GFRK----IIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYF-------KHLYSSWLSP 107
           G ++    I  N+G +  + G   T +      A K+  YE         K   S W   
Sbjct: 76  GLKEAAKHIWLNDGIRGFFQGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYESHWRR- 134

Query: 108 GVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAE--SGGMKA- 164
                LM+ + A   +     P + I+V+          +++   K +Y E  S  ++A 
Sbjct: 135 -----LMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAK 189

Query: 165 ------------FYKGIVPLWCRQIPYTMCKFTSFEKIVQKI-------YSVLP----KK 201
                       FY+G  P     IPY    F + + +   +       YSVL     ++
Sbjct: 190 GYIPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQ 249

Query: 202 KEEMNALQQISV----SFVGGYLAGILCAAVSHPADVM----------VSKINSERKANE 247
           +E     Q++ +      + G LAG+     ++P +++          VS++   R   +
Sbjct: 250 EERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHR--FQ 307

Query: 248 SMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVGL 296
           S+S  +K IY++ G+ G + GL +  + +  + +  + +Y+  K ++G+
Sbjct: 308 SISEIAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHLGI 356

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/318 (17%), Positives = 121/318 (38%), Gaps = 62/318 (19%)

Query: 12  LYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSN---LQGFRKIIANEG 68
           +Y  + +     GG+     + + ++P++ VK  LQV       N   +   +++   EG
Sbjct: 11  VYKNDGFIAFVAGGV-GGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEG 69

Query: 69  WKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLAD---- 124
            K ++ G G   +      A +Y  YE+ K            V+ +  +  E L      
Sbjct: 70  VKGLFRGNGINCLRIFPYSAVQYAVYEFCK----------TRVFHVGQSGHEQLRSWERL 119

Query: 125 -----------IMLCPFEAIKVK----------------QQTTMPPFCNNVVDGWKKMYA 157
                      ++  P + ++ +                     PP    +V+  ++++ 
Sbjct: 120 VGGALGGGASVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPP---GIVELLRRIFR 176

Query: 158 ESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVG 217
           E GG++ +Y+G+ P     +P+    F  +E    ++ +++P    + +A    +     
Sbjct: 177 EEGGLRGWYRGVYPTSLGVVPFVALNFALYE----RLKALIP---HDYDAGSVAAAKLAI 229

Query: 218 GYLAGILCAAVSHPADVMVSKINSERKANESM-----SVASK--RIYQKIGFTGLWNGLM 270
           G ++G +   V +P D++  +          +     SVA     I ++ G  G + GL 
Sbjct: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289

Query: 271 VRIVMIGTLTSFQWLIYD 288
             +V +    + QW +Y+
Sbjct: 290 ANLVKVVPAMAVQWFVYE 307

 Score = 31.6 bits (70), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 30/197 (15%), Positives = 83/197 (42%), Gaps = 14/197 (7%)

Query: 111 VYLMASATAEFLADIMLCPFEAIKV--KQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKG 168
           +  +A      ++  ++ P E +K+  + Q++   +   +V   K++Y E G +K  ++G
Sbjct: 18  IAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEG-VKGLFRG 76

Query: 169 IVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQIS-----------VSFVG 217
                 R  PY+  ++  +E    +++ V     E++ + +++            V++  
Sbjct: 77  NGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPL 136

Query: 218 GYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIG 277
             +   L    ++ A +  SK +  R+    + +  +   ++ G  G + G+    + + 
Sbjct: 137 DLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVV 196

Query: 278 TLTSFQWLIYDSFKAYV 294
              +  + +Y+  KA +
Sbjct: 197 PFVALNFALYERLKALI 213

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 74/184 (40%), Gaps = 26/184 (14%)

Query: 38  PLDLVKCRLQVN----PKLYTSN----------LQGFRKIIANE-GWKKVYTGFGATFVG 82
           PLDLV+ RL +      KL+ S           ++  R+I   E G +  Y G   T +G
Sbjct: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194

Query: 83  YSLQGAGKYGGYEYFKHLYSSWLSPG--VTVYLMASATAEFLADIMLCPFEAIKVK---- 136
                A  +  YE  K L       G      L   A +  +A  ++ PF+ ++ +    
Sbjct: 195 VVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVL 254

Query: 137 --QQTTMPPFCNNVVDG-WKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQK 193
              Q+ +     +V D  W     E  G++ +YKG+     + +P    ++  +E I + 
Sbjct: 255 TMGQSELGFRYASVADALWTIGRQE--GLRGYYKGLTANLVKVVPAMAVQWFVYELISEN 312

Query: 194 IYSV 197
           ++ +
Sbjct: 313 MHGL 316

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 85/185 (45%), Gaps = 33/185 (17%)

Query: 37  TPLDLVKCRLQVNP------KLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGK 90
            P+ L+K R+Q++       + Y ++    + +I NEG+  +Y G  A+++G S++G  +
Sbjct: 194 NPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLG-SVEGILQ 252

Query: 91  YGGYEYFKHLY--------------SSWLSPGVTVYLMASAT---AEFLADIMLCPFEAI 133
           +  YE  K L               +   S  V  +   S +   A+F+A I   P E +
Sbjct: 253 WLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLAKFVASIATYPHEVV 312

Query: 134 KVKQQTTMPPFCN------NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSF 187
           + + + T  P  N       +V  +K +  E  G+ + Y G+ P   R +P ++  F ++
Sbjct: 313 RTRLRQT--PKENGKRKYTGLVQSFKVIIKEE-GLFSMYSGLTPHLMRTVPNSIIMFGTW 369

Query: 188 EKIVQ 192
           E +++
Sbjct: 370 EIVIR 374

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/290 (21%), Positives = 115/290 (39%), Gaps = 49/290 (16%)

Query: 38  PLDLVKCRLQ--------------VNPKLYTSNLQGFR----------KIIANEGWKKVY 73
           P D+VK RLQ              + P       QG R           +  NEG++ ++
Sbjct: 72  PFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFRSLF 131

Query: 74  TGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPG---VTVYLMASATAEFLADIMLCPF 130
            G G   VG     +  +  Y   K +YS  L+ G   V ++LMA+ATA +       P 
Sbjct: 132 KGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEAVWIHLMAAATAGWATSTATNPI 191

Query: 131 EAIKVKQQTTMPPFCNNVVDGW---KKMYAESG------GMKAFYKGIVPLWCRQIPYTM 181
             +K + Q           + W   K +  + G      G+ A Y G V    + + Y  
Sbjct: 192 WLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSASYLGSVEGILQWVLYEQ 251

Query: 182 CKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINS 241
            K    ++ ++K  ++   +K   + +++         LA  + + +++P +V+ +++  
Sbjct: 252 MKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKFVASIITYPHEVVRTRLRQ 311

Query: 242 ERKANESMS----VASKR-IYQKIGFTGLWNGL---MVR-----IVMIGT 278
               N  +     V S R I ++ G   ++ GL   ++R     I+M GT
Sbjct: 312 APLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGT 361

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/196 (20%), Positives = 84/196 (42%), Gaps = 27/196 (13%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVN------PKLYTSNLQGFRKIIANEGWKKVYTGF 76
           L G  A   T ++  P+ LVK RLQ++       + Y ++    + ++ NEG   +Y G 
Sbjct: 168 LAGATAGWATSTATNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGL 227

Query: 77  GATFVGYSLQGAGKYGGYEYFKHL--------YSSWLSPGVTVYLM---------ASATA 119
            A+++G S++   ++  YE  KH+        +        T Y+          ++  A
Sbjct: 228 SASYLG-SVESILQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAA 286

Query: 120 EFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYA---ESGGMKAFYKGIVPLWCRQ 176
           +  A I+  P E ++ + +            G  + ++   +  G  + Y G+ P   R 
Sbjct: 287 KLFASILTYPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRT 346

Query: 177 IPYTMCKFTSFEKIVQ 192
           +P ++  F ++E +++
Sbjct: 347 VPNSIIMFGTWELVIK 362

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 58/294 (19%), Positives = 109/294 (37%), Gaps = 59/294 (20%)

Query: 38  PLDLVKCRLQVN-------------PKLYTSNLQGFRK---IIAN----EGWKKVYTGFG 77
           P D+VK RLQ +               +    L  FR+   II N    EG++ ++ G G
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 78  ATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT---VYLMASATAEFLADIMLCPFEAIK 134
              VG     +  +  Y   K   S  L+ G     ++ +A ATA +       P   +K
Sbjct: 129 PNLVGVIPARSINFFTYGVTKDTASRLLNDGQEAPWIHFLAGATAGWATSTATNPIWLVK 188

Query: 135 VKQQTTMPPFCNNVVDGWKKMYAES-----------------GGMKAFYKGIVPLWCRQI 177
            + Q       +   DG  + Y  S                  G+ A Y G V    + +
Sbjct: 189 TRLQ------LDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLGSVESILQWV 242

Query: 178 PYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVS 237
            Y   K    ++ +++   +  + K     +++          A +  + +++P +V+ +
Sbjct: 243 LYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHEVVRT 302

Query: 238 KINSERKANESMSVAS-----KRIYQKIGFTGLWNGL---MVR-----IVMIGT 278
           ++    K N  +           I ++ GF  +++GL   ++R     I+M GT
Sbjct: 303 RLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIMFGT 356

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 7/63 (11%)

Query: 21  CTLGGIIACGPTHSSIT--PLDLVKCRLQVNPKL-----YTSNLQGFRKIIANEGWKKVY 73
           C   G        +SI   P ++V+ RL+  PK      YT   Q F  II  EG+  +Y
Sbjct: 277 CQRSGSAGAAKLFASILTYPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMY 336

Query: 74  TGF 76
           +G 
Sbjct: 337 SGL 339

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/246 (21%), Positives = 97/246 (39%), Gaps = 25/246 (10%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYF 97
           P D  K RLQ +    T+ ++  RK++ANEG +  Y G     +G     + ++G  E  
Sbjct: 45  PFDTTKVRLQTS-STPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAM 103

Query: 98  KHLY-------SSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVD 150
           K  +       SS LS  +  Y     T   +   +  P E ++++ QT      N    
Sbjct: 104 KRFFHHRNADMSSTLS--LPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFK 161

Query: 151 GWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQ 210
           G  +   +    KA  +G+ P   R+       F  +E ++         +  +   L++
Sbjct: 162 GPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIA-------NQMNKRRGLER 214

Query: 211 ISVSF----VGGYLAGILCAAVSHPADVMVSKINSER----KANESMSVASKRIYQKIGF 262
             +      + G L+G     + +P DV+ S + ++     K   S+S  +K +Y   G 
Sbjct: 215 KDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGI 274

Query: 263 TGLWNG 268
              + G
Sbjct: 275 GAFFKG 280

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 125 IMLCPFEAIKVKQQTT---MPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTM 181
           +M+ P + IK   QT     P F N++    K +YA +GG+ AF+KG  P   R  P   
Sbjct: 235 LMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYA-NGGIGAFFKGFGPTMLRAAPANG 293

Query: 182 CKFTSFE 188
             F +FE
Sbjct: 294 ATFATFE 300

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (42%), Gaps = 19/181 (10%)

Query: 27  IACGPTHSSIT-PLDLVKCRLQV------NPKLYTSNLQGFRKIIANEGWKKVYTGFGAT 79
           I  G   + +T P+ +VK RL +      N   Y      F+KII  EG K +Y G   +
Sbjct: 176 ITAGAVSTVVTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPS 235

Query: 80  FVGYSLQGAGKYGGYEYFKHLY--------SSWLSPGVTVYLMASATAEFLADIMLCPFE 131
            +G  L  A  +  YE  K  +        S+     +   ++AS+ ++ +A ++  P E
Sbjct: 236 LLGL-LHVAIHFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHE 294

Query: 132 AIKVKQQ--TTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEK 189
            ++ + Q  + +P     ++   K  Y +  G+  FY G      R +P +     SFE 
Sbjct: 295 ILRTRLQLKSDLPSHQRRLIPLIKITYIQE-GIFGFYSGFGTNLFRTLPASAITLVSFEY 353

Query: 190 I 190
           +
Sbjct: 354 V 354

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 58/287 (20%), Positives = 122/287 (42%), Gaps = 37/287 (12%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQ--------VNPKLYTSNLQGFRKIIANEGWKKVYT 74
           L GI+ C        PLD+ K RLQ             Y  ++     I+ +EG + +Y 
Sbjct: 81  LSGIVVC--------PLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYK 132

Query: 75  GFGATFVGYSLQGAGKYGGYEYFK-HLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAI 133
           G     +GY       +  YE+ K +L ++  +     +  ++ TA  ++ ++  P   +
Sbjct: 133 GLVPIIMGYFPTWMIYFSVYEFCKDNLRTNSSNWSFVSHSFSAITAGAVSTVVTNPIWVV 192

Query: 134 KVKQQTTMPPFCNN-----VVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFE 188
           K +         N        D +KK+  +  G+KA Y G+VP     + +    F  +E
Sbjct: 193 KTRLMLQTHIGSNTTHYQGTYDAFKKIINQE-GVKALYAGLVPSLLGLL-HVAIHFPVYE 250

Query: 189 --KIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKIN--SERK 244
             K+  K Y       E    L+++    +   ++ ++ + +S+P +++ +++   S+  
Sbjct: 251 RLKVSFKCYQRDESSNESKINLKRL---ILASSVSKMVASVLSYPHEILRTRLQLKSDLP 307

Query: 245 ANESMSVASKRI-YQKIGFTGLWNGL---MVRIVMIG--TLTSFQWL 285
           +++   +   +I Y + G  G ++G    + R +     TL SF+++
Sbjct: 308 SHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYV 354

 Score = 31.2 bits (69), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 36/82 (43%), Gaps = 8/82 (9%)

Query: 114 MASATAEFLADIMLCPFEAIKVKQQ-------TTMPPFCNNVVDGWKKMYAESGGMKAFY 166
           ++ A A  L+ I++CP +  K + Q       TT   +    + G         G++  Y
Sbjct: 73  ISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSI-GTMTTIVRDEGVRGLY 131

Query: 167 KGIVPLWCRQIPYTMCKFTSFE 188
           KG+VP+     P  M  F+ +E
Sbjct: 132 KGLVPIIMGYFPTWMIYFSVYE 153

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 111/268 (41%), Gaps = 33/268 (12%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSN-----LQGFRKIIANEGWKKV---YT 74
           +GG+ A    H    P DLVK R Q N      +     LQ  R+         V   Y 
Sbjct: 37  VGGVCAVLTGH----PFDLVKVRCQSNQARSAMDAVSHILQAARQAAGPTSLNAVRGFYK 92

Query: 75  GFGATFVGYSLQGAGKYGGYEYFKHLYSS----------WLSPGVTVYLMASA--TAEFL 122
           G     +G +   A  + GY+  K L +S           + P +T+  MA+A   +   
Sbjct: 93  GVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQMAAAGFISAIP 152

Query: 123 ADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMC 182
             ++  P E +KV  QTT      + +D  K++   + G ++ +KG +    R  P +  
Sbjct: 153 TTLVTAPTERVKVVLQTTQGK--ASFLDAAKQIV-RTQGFQSLFKGSLATLSRDGPGSAL 209

Query: 183 KFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSE 242
            F S+E  + K Y  L K     +    I+   + G +AG+    V  P D + +++ S 
Sbjct: 210 YFASYE--ICKEY--LNKASGHTSGELSITNVCISGGMAGVSMWVVVFPIDTVKTQLQSS 265

Query: 243 RKANESMSVASKRIYQ-KIGFTGLWNGL 269
            K  +SM   ++ IY  + G  G + G+
Sbjct: 266 SK-RQSMLEVTRMIYNTRGGIKGFFPGV 292

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 74/172 (43%), Gaps = 14/172 (8%)

Query: 25  GIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYS 84
           G I+  PT     P + VK  LQ   +   S L   ++I+  +G++ ++ G  AT    S
Sbjct: 146 GFISAIPTTLVTAPTERVKVVLQTT-QGKASFLDAAKQIVRTQGFQSLFKGSLATL---S 201

Query: 85  LQGAGK---YGGYEYFKHLY--SSWLSPG---VTVYLMASATAEFLADIMLCPFEAIKVK 136
             G G    +  YE  K     +S  + G   +T   ++   A     +++ P + +K +
Sbjct: 202 RDGPGSALYFASYEICKEYLNKASGHTSGELSITNVCISGGMAGVSMWVVVFPIDTVKTQ 261

Query: 137 QQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFE 188
            Q++      ++++  + +Y   GG+K F+ G+ P   R  P     F   E
Sbjct: 262 LQSSSKR--QSMLEVTRMIYNTRGGIKGFFPGVGPAILRSFPANAATFLGVE 311

 Score = 35.0 bits (79), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 37/179 (20%), Positives = 76/179 (42%), Gaps = 18/179 (10%)

Query: 129 PFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGG------MKAFYKGIVPLWCRQIPYTMC 182
           PF+ +KV+ Q+       + V    +   ++ G      ++ FYKG+VP      P    
Sbjct: 48  PFDLVKVRCQSNQARSAMDAVSHILQAARQAAGPTSLNAVRGFYKGVVPPLLGVTPIFAV 107

Query: 183 KFTSFEKIVQKIYSVLPKKK-------EEMNALQQISVSFVGGYLAGILCAAVSHPADVM 235
            F  ++ + +K+ + +P          E    L Q++ +   G+++ I    V+ P +  
Sbjct: 108 SFWGYD-VGKKLVTSVPSSAASGAAAVEPELTLSQMAAA---GFISAIPTTLVTAPTE-R 162

Query: 236 VSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
           V  +    +   S   A+K+I +  GF  L+ G +  +   G  ++  +  Y+  K Y+
Sbjct: 163 VKVVLQTTQGKASFLDAAKQIVRTQGFQSLFKGSLATLSRDGPGSALYFASYEICKEYL 221

>Kwal_26.7653
          Length = 325

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 71/171 (41%), Gaps = 11/171 (6%)

Query: 37  TPLDLVKCRLQV--------NPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGA 88
           +PL L+K R+Q             YTS   G   I   EG+K +Y G  A  +      +
Sbjct: 149 SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSS 208

Query: 89  GKYGGYEYFKH--LYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCN 146
            +   Y   KH  L    +  G  ++L+AS  + F   +++ P++ I  +          
Sbjct: 209 VQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGNLYK 268

Query: 147 NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSV 197
             +D + K      G+ A YKG      R  P+T+   T  E+ ++ +Y+V
Sbjct: 269 GPLDCFVKT-VRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAV 318

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/239 (19%), Positives = 103/239 (43%), Gaps = 25/239 (10%)

Query: 24  GGIIACGPTHSSITPLDLVKCRLQVN-------PKLYTSNLQGFRKIIANEGWKKVYTGF 76
           GG+ AC    +   P++LVK R+Q+         ++Y + +Q  + I  NEG + +  G 
Sbjct: 31  GGMAACIAV-TVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGL 89

Query: 77  GATFVGYSLQGAGKYGGYEYFKHLYSSWLSPG--------VTVYLMASATAEFLADIMLC 128
              ++        + G YE  + + +    P         V V +++ AT+  +  IM  
Sbjct: 90  SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGS 149

Query: 129 PFEAIKVKQQTTMPPFCNNVVDGWKKMYAES-GGMKAFYK--GIVPLWCRQIPYTMCKFT 185
           P   IK + Q+    + N +  G +  Y     G+ + Y+  G   L+ R +   + +  
Sbjct: 150 PLFLIKTRMQS----YSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLY-RGVDAAILRTG 204

Query: 186 SFEKIVQKIYSVLPKKKEEMNALQQ-ISVSFVGGYLAGILCAAVSHPADVMVSKINSER 243
           +   +   IY+       + + +++   +  V   ++G     V +P DV+++++ +++
Sbjct: 205 AGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQK 263

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 86/199 (43%), Gaps = 22/199 (11%)

Query: 113 LMASATAEFLADIMLCPFEAIKVKQQ------TTMPPFCNNVVDGWKKMYAESGGMKAFY 166
            +A   A  +A  +  P E +K + Q              N +   K ++ ++ G++   
Sbjct: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIF-KNEGIRGLQ 86

Query: 167 KGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKK---KEEMNALQQISVSFVGGYLAGI 223
           KG+   +  QI     +   +E I     SVL K      + + +Q ++V+ V G  +GI
Sbjct: 87  KGLSCAYIYQIGLNGSRLGFYEPI----RSVLNKTFYPAMDPHKVQNVAVNVVSGATSGI 142

Query: 224 LCAAVSHPADVMVSKINSERKANE--------SMSVASKRIYQKIGFTGLWNGLMVRIVM 275
           + A +  P  ++ +++ S   A +        S+      IY+  GF GL+ G+   I+ 
Sbjct: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202

Query: 276 IGTLTSFQWLIYDSFKAYV 294
            G  +S Q  IY++ K ++
Sbjct: 203 TGAGSSVQLPIYNTAKHFL 221

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 76/182 (41%), Gaps = 28/182 (15%)

Query: 25  GIIACGPTHSSITPLDLVKCRLQVN-------PKLYTSNLQGFRKIIANEGWKKVYTGFG 77
           G IA   T   +TP++LVKC+LQV+       P+ YT+ L   R I+   G   ++ G  
Sbjct: 109 GAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPR-YTAVLPTLRAIVKQNGLGGLWQGQS 167

Query: 78  ATFVGYSLQGAGKYGGYEYFKHLYSSWL-----SPGVTVYLM----ASATAEFLADIMLC 128
            TF+  S  GA  +  YE  K     WL     S   TV+ +    A A A F A I   
Sbjct: 168 GTFIRESAGGAVWFTAYEVLK----GWLARRRGSTENTVWELLASGAGAGAAFHASIF-- 221

Query: 129 PFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFE 188
           P + +K   QT        V    KK      G   FY+G+     R +P     F  +E
Sbjct: 222 PADTVKSTMQTEHLGLGPAVRTVLKKH-----GPTGFYRGVGITLLRALPANAVIFYVYE 276

Query: 189 KI 190
            +
Sbjct: 277 SL 278

 Score = 32.0 bits (71), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 69/166 (41%), Gaps = 22/166 (13%)

Query: 113 LMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIV-P 171
           L+    A  L  ++  PF+ +KV+ QT                Y + G  + FY+G+  P
Sbjct: 12  LLYGGVAGSLGKLVEYPFDTVKVRLQTQSAALFPTTWSCVSHTYKQEGLWRGFYQGMASP 71

Query: 172 LWCRQIPYTMCKFTSFEK---IVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAV 228
           ++   + + +  F SF +   +++  YS  P +K          V F G  +AG   + V
Sbjct: 72  VFGAFLEHAVL-FVSFNRAQAVLENCYSCGPLEK----------VVFAGA-IAGACTSYV 119

Query: 229 SHPADVM-----VSKINSERKANESMSVASKR-IYQKIGFTGLWNG 268
             P +++     VS +        +  + + R I ++ G  GLW G
Sbjct: 120 LTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQG 165

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 120/291 (41%), Gaps = 31/291 (10%)

Query: 32  THSSITPLDLVKCRLQVNP-----KLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQ 86
           T  S T L+  +  L  NP     KL +  ++    +    G K  Y G G   +    +
Sbjct: 232 TDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVKAIISLYRQGGIKSFYVGNGLNALKVFPE 291

Query: 87  GAGKYGGYEYFKHLYSSWLSPGVTVYL------MASATAEFLADIMLCPFEAIKVKQQTT 140
            + K+G +E  K L +   +   T  L      +A   A   A   + P + +K + Q  
Sbjct: 292 SSIKFGSFEITKKLMTKVENCKDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCA 351

Query: 141 MPPFCNNV------VDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKI 194
             P    +      +   K+MY E GG+K FY+G+        PY      +F  + +  
Sbjct: 352 --PLNAELKGRKLMIQTAKEMYTE-GGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWY 408

Query: 195 YSVLPKK---KEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSE------RKA 245
            S   KK   KEE   L  + V  +G + +G   A V +P +++ +++ ++       + 
Sbjct: 409 ISSKAKKLNKKEEDVELSNLVVLPMGAF-SGTFGATVVYPINLLRTRLQAQGTFAHPYRY 467

Query: 246 NESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVGL 296
           +    V  K I Q+ G+ GL+ GL+  +  +    S  +L Y++ K  + L
Sbjct: 468 DGFRDVLLKTI-QREGYPGLFKGLVPTLAKVCPAVSISYLCYENLKKLMKL 517

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 62/275 (22%), Positives = 112/275 (40%), Gaps = 36/275 (13%)

Query: 16  EFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTG 75
           + +    + G  A   T  +  P+D +K RLQ     +           AN G+K VY G
Sbjct: 4   QMFIASLVSGAAAGTSTDLAFFPIDTLKTRLQAKGGFF-----------ANGGYKGVYRG 52

Query: 76  FGATFVGYSLQGAGKYGGYEYFKHLYSSWLSP--------------GVTVYLMASATAEF 121
            G+  V  +   +  +  Y+  K     W  P                  ++++S+  E 
Sbjct: 53  LGSAVVASAPSASLFFVAYDSMK----CWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEI 108

Query: 122 LADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTM 181
            A ++  P E IK + QT         +    +     G  +  Y+G      R+IP+T 
Sbjct: 109 SACMVRVPAEVIKQRTQTHRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPFTC 168

Query: 182 CKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINS 241
            +F  +E + ++   V   + +E  A  Q SV      +AG + AA + P DV+ ++I  
Sbjct: 169 IQFPLYEYMKKRWAEV---QGKERAAPWQGSVCGC---IAGGIAAAATTPLDVLKTRIML 222

Query: 242 ERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMI 276
             K+  ++ +A K + Q+ G    ++G+  R + I
Sbjct: 223 HHKSVSALHLA-KTMLQEEGVKVFFSGVGPRTMWI 256

 Score = 31.2 bits (69), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 37  TPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEY 96
           TPLD++K R+ ++ K   S L   + ++  EG K  ++G G   +  S  GA   G YE 
Sbjct: 211 TPLDVLKTRIMLHHK-SVSALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYET 269

Query: 97  FKHLY 101
              L+
Sbjct: 270 VHSLF 274

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/236 (21%), Positives = 103/236 (43%), Gaps = 22/236 (9%)

Query: 53  YTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLY---------SS 103
           Y   L    K+  NEG+  +Y G  A+ +G  +Q    +  Y   +  Y         ++
Sbjct: 87  YKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKKVKGEAA 146

Query: 104 WLS--PGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGG 161
             S    + + ++A+AT++   +    P   +  KQQT      +N      K   +  G
Sbjct: 147 RFSTIEELLLSMLAAATSQLFTN----PINIVSTKQQTRRGLEGDNSFKAIAKEVYDEDG 202

Query: 162 MKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQIS--VSFVGGY 219
           +  F+K +       I  ++  + S EK+   +Y V    K+  ++  Q+    +F+ G 
Sbjct: 203 ITGFWKSLKVSLVLTINPSIT-YASAEKLKDILYHVEWNAKDLNDSSLQLKPGQNFLIGV 261

Query: 220 LAGILCAAVSHPADVMVSKINSERKANE--SMSVASKRIYQKIGFTGLWNGLMVRI 273
           L+ I+   ++HP  ++V+K + +R +++  S       +Y+  G   LW GL+ ++
Sbjct: 262 LSKIISTCLTHP--LIVAKASLQRSSSKFTSFQEVLTYLYRHEGAHALWKGLLPQL 315

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 6/62 (9%)

Query: 220 LAGILCAAVS----HPADVMVSKINSER--KANESMSVASKRIYQKIGFTGLWNGLMVRI 273
           L  +L AA S    +P +++ +K  + R  + + S    +K +Y + G TG W  L V +
Sbjct: 155 LLSMLAAATSQLFTNPINIVSTKQQTRRGLEGDNSFKAIAKEVYDEDGITGFWKSLKVSL 214

Query: 274 VM 275
           V+
Sbjct: 215 VL 216

>Scas_705.9
          Length = 323

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 108/279 (38%), Gaps = 38/279 (13%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSN---------------LQGFRKIIANE 67
           + G IA    +  + PLD+ K  +Q   K   ++               ++   +I    
Sbjct: 8   ITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKR 67

Query: 68  GWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWL-----------SPGVTVYLMAS 116
           G + +Y G   +     +Q    +  Y + +  Y S             S      L+  
Sbjct: 68  GLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSISTVEELIVG 127

Query: 117 ATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGG-MKAFYKGI-VPLWC 174
             A  L  ++  P E I  KQQTT      +     K++Y ES G + +++KG  V L  
Sbjct: 128 VGAAALTQVVNNPIEVILTKQQTTDDKDNVDFYSVLKQIYVESNGKLSSYWKGFKVSLIL 187

Query: 175 RQIP-YTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHP-- 231
              P  T   +  F+ I+ K  S   K       + Q   +F+ G LA I+   ++ P  
Sbjct: 188 TVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQ---NFILGALAKIISTIITQPLI 244

Query: 232 -ADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGL 269
            A V + + NS+ K  E +    + +Y++ G   LW G+
Sbjct: 245 VAKVSLQRSNSKFKHFEEV---LRYLYKEEGVLALWKGV 280

>Kwal_23.3042
          Length = 542

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 53/246 (21%), Positives = 101/246 (41%), Gaps = 28/246 (11%)

Query: 68  GWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYL------MASATAEF 121
           G +  Y G G   +    + A K+G +E  K L +       T  L      +A      
Sbjct: 297 GIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFSTYLAGGLGGV 356

Query: 122 LADIMLCPFEAIKVKQQ----TTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQI 177
           +A + + P + +K + Q     T       ++   K MY E GG++ FY+GI        
Sbjct: 357 MAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKE-GGLRIFYRGITVGIMGIF 415

Query: 178 PYTMCKFTSFEKI------VQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHP 231
           PY      +F  +       Q   + LP   E+   +  + V  +G + +G + A   +P
Sbjct: 416 PYAAMDLGTFSALKKWYIARQARLTGLP---EDQVTMSNMFVLLMGAF-SGTVGATAVYP 471

Query: 232 ADVMVSKINSE------RKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWL 285
            +++ +++ ++       + N    V  K + Q+ G+ GL+ GL+  +  +    S  +L
Sbjct: 472 VNLLRTRLQAQGTFAHPHRYNGFRDVLLKTV-QREGYQGLFKGLVPNLAKVCPAVSISYL 530

Query: 286 IYDSFK 291
            Y++ K
Sbjct: 531 CYENLK 536

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 61/118 (51%), Gaps = 11/118 (9%)

Query: 161 GMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYL 220
           G++ F +G +P   RQ+  ++ +FT++  IVQ   S+ P K     AL +   +F  G L
Sbjct: 207 GVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQ---SLSPHK-----ALDEYQ-AFAAGAL 257

Query: 221 AGILCAAVSHPADVMVSKINSERK--ANESMSVASKRIYQKIGFTGLWNGLMVRIVMI 276
           +     A++ P DV+ +++ S+      +S    + RI+ + GF  +W G + R+  +
Sbjct: 258 SSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAYRIFVEEGFRYMWKGWVPRLFKV 315

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 2/69 (2%)

Query: 38  PLDLVKCRLQVNPKLYT--SNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYE 95
           P+D++K R+Q     +T  S+L    +I   EG++ ++ G+       SL G   +G Y+
Sbjct: 268 PIDVIKTRMQSKTAWFTYKSSLNCAYRIFVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQ 327

Query: 96  YFKHLYSSW 104
           Y ++L   W
Sbjct: 328 YVENLVLLW 336

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 52/249 (20%), Positives = 91/249 (36%), Gaps = 31/249 (12%)

Query: 11  QLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWK 70
           ++ T       +L G+ A     + I PLD VK +LQV P  +  N      I+  EG +
Sbjct: 12  EVSTTNSLVAGSLSGLFA----RTCIAPLDTVKIKLQVTP--HNKNANVLINILKREGIR 65

Query: 71  KVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYL----------MASATAE 120
             + G     + Y + G  ++G Y Y        L   ++  L          M S+ A 
Sbjct: 66  GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLAS 125

Query: 121 FLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYT 180
           +  D++   F A     Q  +    + ++  W        G+  F+ G           T
Sbjct: 126 YPFDVLRTRFAA---NSQGQLIKLRDEIMAIWSHE-----GLMGFFSGCGSSMINIGLNT 177

Query: 181 MCKFTSFE--KIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSK 238
              F  +E  KI  +  S L  +++    L +++     G ++G      + P D +  +
Sbjct: 178 AIMFGVYESIKIFTEERSKLSDRRDPFTLLNELA-----GPISGFTSKLATFPLDTVRRR 232

Query: 239 INSERKANE 247
           I      NE
Sbjct: 233 IQIRNSPNE 241

 Score = 35.4 bits (80), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 37/199 (18%), Positives = 77/199 (38%), Gaps = 26/199 (13%)

Query: 20  TCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQG-FRKIIANEGWKKVYTGFGA 78
           +C +G +     + +S  P D+++ R   N +     L+     I ++EG    ++G G+
Sbjct: 110 SCLVGSLAGMTSSLASY-PFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGS 168

Query: 79  TFVGYSLQGAGKYGGYEYFKHL------YSSWLSPGVTVYLMASATAEFLADIMLCPFEA 132
           + +   L  A  +G YE  K         S    P   +  +A   + F + +   P + 
Sbjct: 169 SMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDT 228

Query: 133 IKVKQQTTMPP--------FCNNVVDGWKK---------MYAESGGMKAFYKGIVPLWCR 175
           ++ + Q    P        F  ++   +K          M  + G + + Y+G+     +
Sbjct: 229 VRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPL-SLYRGVTMSLIK 287

Query: 176 QIPYTMCKFTSFEKIVQKI 194
            +P T     S+E  + K+
Sbjct: 288 SVPSTAISLWSYELFMNKL 306

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 56/274 (20%), Positives = 112/274 (40%), Gaps = 28/274 (10%)

Query: 35  SITPLDLVKCRLQVNPKLYTSNLQG-FRKI-IANEGWKKVYTGFGATFVGYSL------- 85
           ++ PLDL+K RLQ   +   S+L+   R++    E W+        T +G +L       
Sbjct: 25  ALQPLDLLKTRLQ---QAQASSLRSVLREVRTTRELWRGTLPSALRTSIGSALYLSLLNY 81

Query: 86  -QGAGKYGGYEYFKHLYSSWLSPGVTVY--LMASATAEFLADIMLCPFEAIKVKQQTTMP 142
            + A   G     +    S L P +  Y  L+  A +     ++  P   IKV+ ++T+ 
Sbjct: 82  SRSALARGSEARTR----SSLLPRLQSYQNLLTGALSRAAVGLVTMPITVIKVRYESTLY 137

Query: 143 PFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLP--- 199
            + N + +  + ++  S G + F+KG      R  PY       +E+  + +   LP   
Sbjct: 138 AY-NGLAEATRHIW-RSEGARGFFKGAAATTLRDAPYAGLYVLLYEQAKEMLPRALPATL 195

Query: 200 ---KKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRI 256
               +  ++ A     V+ V  +L+  L   ++ P D + +++  +      +      +
Sbjct: 196 LGADESGKLTAPASAMVNGVSAFLSASLATTLTAPFDTIKTRMQLQSHPVGFVQTLRHIV 255

Query: 257 YQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSF 290
            ++   T L++GL +R+          W IY+  
Sbjct: 256 CEERART-LFDGLSLRLCRKAMSACIAWGIYEEL 288

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/192 (19%), Positives = 84/192 (43%), Gaps = 10/192 (5%)

Query: 107 PGVTVY--LMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKA 164
           P +++Y  L+  A A      +  P   IKV+ ++T+  +  ++ +  K + A+ G ++ 
Sbjct: 103 PQLSMYENLVTGAFARGTVGYITMPITIIKVRYESTLYNY-KSIAEAAKSIAAQEG-IRG 160

Query: 165 FYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMN------ALQQISVSFVGG 218
           F++G  P   R  PY+      +EK+   + ++LPK   +++      A    +++    
Sbjct: 161 FFRGFGPTCLRDAPYSGLYVLLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSA 220

Query: 219 YLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGT 278
            L+  +   V+ P D + +++  E    ++       I  +     +++GL +R+     
Sbjct: 221 ILSASMATTVTAPFDTIKTRMQLEPTKFKTFWSTLTTIVTQEHPIKIFSGLSMRLTRKAL 280

Query: 279 LTSFQWLIYDSF 290
                W IY+  
Sbjct: 281 SAGIAWGIYEEL 292

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 33/82 (40%), Gaps = 1/82 (1%)

Query: 19  ATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGA 78
           A  +   I++     +   P D +K R+Q+ P  + +       I+  E   K+++G   
Sbjct: 214 AINSTSAILSASMATTVTAPFDTIKTRMQLEPTKFKTFWSTLTTIVTQEHPIKIFSGLSM 273

Query: 79  TFVGYSLQGAGKYGGY-EYFKH 99
                +L     +G Y E  KH
Sbjct: 274 RLTRKALSAGIAWGIYEELIKH 295

 Score = 28.5 bits (62), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 49/121 (40%), Gaps = 25/121 (20%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGG---- 93
           P+ ++K R +     Y S  +  + I A EG +  + GFG T     L+ A  Y G    
Sbjct: 127 PITIIKVRYESTLYNYKSIAEAAKSIAAQEGIRGFFRGFGPT----CLRDA-PYSGLYVL 181

Query: 94  -YEYFKHLYSSWLSPGV---------TVYLMAS--ATAEFL----ADIMLCPFEAIKVKQ 137
            YE  KH   + L   +         T Y   +  +T+  L    A  +  PF+ IK + 
Sbjct: 182 LYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRM 241

Query: 138 Q 138
           Q
Sbjct: 242 Q 242

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 68/324 (20%), Positives = 122/324 (37%), Gaps = 50/324 (15%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQV-NPKL--YTSNLQGFRK----IIANEGWKKVYTG 75
           L G +A     + I PLD +K   Q  NP    Y  + QG       I + +  + V+ G
Sbjct: 58  LAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQG 117

Query: 76  FGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLADIMLC-PFEAIK 134
             AT +      A K+  YE  +++             + S +   L  +    P + I+
Sbjct: 118 HSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYETHFRRLCSGSLAGLCSVFCTYPLDLIR 177

Query: 135 VKQQTTMPPFCNNVVDGWKKMYAESGG----MKA-----------FYKGIVPLWCRQIPY 179
           V+           V    K++Y+E        KA           FY+G +P     IPY
Sbjct: 178 VRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYIPTVIGMIPY 237

Query: 180 TMCKFTS---FEKIVQKI----YSVLPKKKEEMNALQ--------------QISVSFVGG 218
               F +   F  I++      YSVL     + + L+                    + G
Sbjct: 238 AGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDVQTTRTGKRIPLNTWAELLAG 297

Query: 219 YLAGILCAAVSHPADVMVSKI------NSERKANESMSVASKRIYQKIGFTGLWNGLMVR 272
            LAG+     ++P +++  ++      N       SMS  +K I+ + G+ G + GL + 
Sbjct: 298 GLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERGWRGFFVGLSIG 357

Query: 273 IVMIGTLTSFQWLIYDSFKAYVGL 296
            + +  + +  + +Y+  K Y+G+
Sbjct: 358 YIKVTPMVACSFFVYERMKWYMGI 381

 Score = 36.2 bits (82), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 66/162 (40%), Gaps = 32/162 (19%)

Query: 88  AGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFC-- 145
           A  Y   + F ++  S L+ GV         A   A  ++ P + IK+  QT+ P +   
Sbjct: 41  AAAYTSKQNFDYILKSGLAGGV---------AGSCAKTLIAPLDRIKILFQTSNPHYVKY 91

Query: 146 --------NNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSV 197
                   N  V  W +       ++  ++G      R  PY   KF ++E+I   I   
Sbjct: 92  AGSFQGLLNAGVHIWSR-----DRLRGVFQGHSATLLRIFPYAAVKFIAYEQIRNVI--- 143

Query: 198 LPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKI 239
           +P K+ E +  +  S     G LAG+     ++P D++  ++
Sbjct: 144 IPSKEYETHFRRLCS-----GSLAGLCSVFCTYPLDLIRVRL 180

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/255 (20%), Positives = 101/255 (39%), Gaps = 28/255 (10%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYF 97
           P D  K RLQ + K     ++  + ++ NEG    Y G     +G  +  + ++G  E  
Sbjct: 46  PFDTTKVRLQTS-KTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESM 104

Query: 98  KHLYSSW----LSPGVTV------YLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNN 147
           K  ++++    + P   V      Y +   T   +   +  P E ++++ QT        
Sbjct: 105 KRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNER 164

Query: 148 VVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNA 207
              G      +    KA  +G++P   R        F ++E +V K +       E+   
Sbjct: 165 QFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEF-------EKGTP 217

Query: 208 LQQISV----SFVGGYLAGILCAAVSHPADVMVSKINSERKAN----ESMSVASKRIYQK 259
             QI      SF  G L+G +     +P DV+ S + ++   N     S+  A++ +Y++
Sbjct: 218 RNQIPAWKLCSF--GALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQ 275

Query: 260 IGFTGLWNGLMVRIV 274
            G    + G +  ++
Sbjct: 276 HGIPAFFKGFVPTMI 290

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 4/63 (6%)

Query: 129 PFEAIKVKQQTTM---PPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFT 185
           P + +K   QT     P + N+++   + +Y + G + AF+KG VP   R  P     F 
Sbjct: 243 PVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHG-IPAFFKGFVPTMIRAAPANAATFV 301

Query: 186 SFE 188
           SFE
Sbjct: 302 SFE 304

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 75/195 (38%), Gaps = 17/195 (8%)

Query: 3   SNKQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRK 62
           +NKQ    +L   +  A     G I+  PT     P + VK  LQ + K   S +Q  + 
Sbjct: 130 NNKQGGSNELTMGQMAAA----GFISAIPTTLVTAPTERVKVVLQTSSK--GSFIQAAKT 183

Query: 63  IIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSP---------GVTVYL 113
           I+   G   ++ G  AT        A  +  YE  K+  +S              +    
Sbjct: 184 IVKEGGIASLFKGSLATLARDGPGSALYFASYEISKNYLNSRQPRQDAGKDEPVNILNVC 243

Query: 114 MASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLW 173
           +A   A     + + P + IK K Q +      N++   K++Y + GG+K F+ G+ P  
Sbjct: 244 LAGGIAGMSMWLAVFPIDTIKTKLQASST--RQNMLSATKEIYLQRGGIKGFFPGLGPAL 301

Query: 174 CRQIPYTMCKFTSFE 188
            R  P     F   E
Sbjct: 302 LRSFPANAATFLGVE 316

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 113/279 (40%), Gaps = 57/279 (20%)

Query: 23  LGGIIACGPTHSSITPLDLVKCR---------------------LQVNPKLYTSNLQGFR 61
           +GG+ A    H    P DL+K R                      QV   L+T++++GF 
Sbjct: 44  VGGVCAVFTGH----PFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNSVKGF- 98

Query: 62  KIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMAS--ATA 119
                      Y G     +G +   A  + GY+  K L +     G +  L     A A
Sbjct: 99  -----------YKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAA 147

Query: 120 EFLADI----MLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCR 175
            F++ I    +  P E +KV  QT+      + +   K +  E GG+ + +KG +    R
Sbjct: 148 GFISAIPTTLVTAPTERVKVVLQTSSK---GSFIQAAKTIVKE-GGIASLFKGSLATLAR 203

Query: 176 QIPYTMCKFTSFEKIVQKIYSVLPK----KKEEMNALQQISVSFVGGYLAGILCAAVSHP 231
             P +   F S+E     + S  P+    K E +N L   +V   GG +AG+       P
Sbjct: 204 DGPGSALYFASYEISKNYLNSRQPRQDAGKDEPVNIL---NVCLAGG-IAGMSMWLAVFP 259

Query: 232 ADVMVSKINSERKANESMSVASKRIY-QKIGFTGLWNGL 269
            D + +K+ +     ++M  A+K IY Q+ G  G + GL
Sbjct: 260 IDTIKTKLQAS-STRQNMLSATKEIYLQRGGIKGFFPGL 297

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 70/130 (53%), Gaps = 15/130 (11%)

Query: 152 WKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQK-IYSVLPKKK--EEMNAL 208
           +K++Y + G +K   KG+  +  RQ+     +F  F ++V++ I +   K    +++ AL
Sbjct: 157 FKEIYKKDG-IKGINKGVNAVAIRQMTNWGSRF-GFSRLVEEGIRNATGKTNPDDKLTAL 214

Query: 209 QQISVSFVGGYLAGILCAAVSHPADVMVSKINSE-----RKANESMSVASKRIYQKIGFT 263
           ++I+ S +GG L+     A + P +V+  ++ S+     R  N ++S A K IYQ  G  
Sbjct: 215 EKIAASAIGGGLS-----AWNQPIEVIRVEMQSKKEDPNRPKNLTVSSAFKYIYQSSGIK 269

Query: 264 GLWNGLMVRI 273
           GL+ G+  RI
Sbjct: 270 GLYRGVAPRI 279

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 68/282 (24%), Positives = 111/282 (39%), Gaps = 37/282 (13%)

Query: 25  GIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQG----FRKIIANEGWKKVYT-----G 75
           GI+  G  H    P+D +  RL  N     S+ Q     FR+  A    K+V+T     G
Sbjct: 20  GILEIGVFH----PVDTISKRLMSNHTKIGSSSQLNSVIFREHAAEPLSKRVFTLFPGLG 75

Query: 76  FGATFVGYSLQGAGKYGGYEY--------FKHLYSSWLSPGVTVYLMASATAEFLA--DI 125
           + AT+    LQ   KYGG  +        FK  + +         L ++     +   +I
Sbjct: 76  YAATY--KILQRVYKYGGQPFANEFLNRNFKADFDNTFGEKTGKALRSATAGSMIGIGEI 133

Query: 126 MLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFT 185
           +L P + +K+K+QT    F      G+ K+  + G     Y+G      R  P +   F 
Sbjct: 134 VLLPLDVLKIKRQTNPEAFKGR---GFVKILKDEG--LGLYRGWGWTAARNAPGSFALFG 188

Query: 186 SFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKA 245
                  K Y +  K   +    Q    S VG   + I+ A    P DV+ ++I ++   
Sbjct: 189 G--NAFAKEYILGLKDYSQATWSQNFVSSIVGASASLIISA----PLDVIKTRIQNKNFE 242

Query: 246 N-ESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLI 286
           N ES     K   +  GF+  + GL  +++  G    F + +
Sbjct: 243 NPESGFTIVKNTLKNEGFSAFFKGLTPKLLTTGPKLVFSFAL 284

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 65/301 (21%), Positives = 114/301 (37%), Gaps = 56/301 (18%)

Query: 21  CTLGGIIACGPTHSSITPLDLVKCRLQVNPKL---------------------------- 52
             L G +A    ++ + PLDLVK  +Q   K                             
Sbjct: 6   SALSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPI 65

Query: 53  ---------YTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLY-- 101
                    Y S      KI   EG + +Y G   + +    Q    +  Y + +  Y  
Sbjct: 66  KLNENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFR 125

Query: 102 SSWLSPGVTVY-----LMASATAEFLADIMLCPFEAIKVKQQTTMP-PFCNNVVDGWKKM 155
              ++   T +     L+    A   + I   P   I  +QQT       N+ +   K++
Sbjct: 126 VKLINRKNTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDFLTVAKEI 185

Query: 156 YAESGGMKAFYKGI-VPLWCRQIPYTMCKFTSFEKIVQKIYS--VLPKKKEEMNALQQIS 212
           Y E   +K F+KG+ V L     P     +TS+EK+   +++   +  KKE +++  Q+S
Sbjct: 186 YKEQRSIKGFWKGLKVSLMLTINP--SITYTSYEKLKDALFTTDTMNLKKELVDSSSQLS 243

Query: 213 --VSFVGGYLAGILCAAVSHPADVMVSKINSERKANE--SMSVASKRIYQKIGFTGLWNG 268
              +F  G L+ ++ A ++ P  +++SK   +R  +   S       +Y+  G    W G
Sbjct: 244 PYQNFTLGVLSKMISAIITMP--LIISKAWLQRNGSNFSSFQQVLYYLYKNEGLRSWWKG 301

Query: 269 L 269
           L
Sbjct: 302 L 302

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/275 (18%), Positives = 114/275 (41%), Gaps = 23/275 (8%)

Query: 37  TPLDLVKCRLQVNP-KLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYE 95
           TP  L+    + +P K+ +  ++    +    G +  Y G G   +    + A K+G +E
Sbjct: 216 TPEQLLHHNPRADPAKIRSPLVKAATSLYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFE 275

Query: 96  YFKHLYSSWLSPGVTVYL------MASATAEFLADIMLCPFEAIKVKQQ-TTMPPFCNNV 148
             K + +     G T  L      +A      +A   + P + +K + Q   +   C  +
Sbjct: 276 LAKRVLAGLEGCGETGELSRLSTYVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGL 335

Query: 149 ---VDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKI----VQKIYSVLPKK 201
              +   K MY E GG++ FY+G+        PY      +F  +    + +  + L   
Sbjct: 336 PLLIKTAKDMYRE-GGLRLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGIS 394

Query: 202 KEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSE-----RKANESMSVASKRI 256
           + E+  +  + V  +G + +G + A V +P +++ +++ ++         +      ++ 
Sbjct: 395 ENEV-VMSNLVVLPMGAF-SGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKT 452

Query: 257 YQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFK 291
            Q+ G  GL+ GL+  +  +    +  +L Y++ K
Sbjct: 453 VQREGLPGLYKGLVPTLAKVCPAVAISYLCYENLK 487

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/312 (20%), Positives = 125/312 (40%), Gaps = 49/312 (15%)

Query: 2   ESNKQPRKIQLYTKEF---YATCTLGGIIACGPTHSSITPLDLVKCRLQVN-------PK 51
           +++KQ ++I+    +    + +   GG+ AC    +   P++L+K R+Q+         K
Sbjct: 4   DNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAV-TVTNPIELIKIRMQLQGEMSASAAK 62

Query: 52  LYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSP---- 107
           +Y + +QG   I  NEG K +  G  A ++        + G YE  +   +    P    
Sbjct: 63  VYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEP 122

Query: 108 ----GVTVYLMASATAEFLADIMLCPF-----------EAIKVKQQTTMPPFCNNVVDGW 152
                V V + + A +  +  ++  P            E IK+ +QT      N +V  +
Sbjct: 123 HKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIF 182

Query: 153 KKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQIS 212
           K     + G+K  ++GI     R    +  +      I     ++L K     +     +
Sbjct: 183 K-----TEGVKGLFRGIDAAILRTGAGSSVQL----PIYNTAKNILVKNDLMKDGP---A 230

Query: 213 VSFVGGYLAGILCAAVSHPADVMVSKINSER----KANESMSVASKRIYQKIGFTGLWNG 268
           +      ++G+  A V +P DV++++I +++    K      V + RI    G T L+ G
Sbjct: 231 LHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIE---GVTALYKG 287

Query: 269 LMVRIVMIGTLT 280
              ++  I   T
Sbjct: 288 FAAQVFRIAPHT 299

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 82/207 (39%), Gaps = 22/207 (10%)

Query: 4   NKQPRKIQLYTKEFY---ATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKL-------- 52
           +++P K+Q      +   A+  +G +I         +PL LVK RLQ   +         
Sbjct: 119 DQEPHKVQSVGVNVFSGAASGIIGAVIG--------SPLFLVKTRLQSYSEFIKIGEQTH 170

Query: 53  YTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLY--SSWLSPGVT 110
           YT    G   I   EG K ++ G  A  +      + +   Y   K++   +  +  G  
Sbjct: 171 YTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPA 230

Query: 111 VYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIV 170
           ++L AS  +     +++ P++ I  +            +D   K      G+ A YKG  
Sbjct: 231 LHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKT-VRIEGVTALYKGFA 289

Query: 171 PLWCRQIPYTMCKFTSFEKIVQKIYSV 197
               R  P+T+   T  E+ ++ +YS+
Sbjct: 290 AQVFRIAPHTIMCLTFMEQTMKLVYSI 316

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/193 (20%), Positives = 81/193 (41%), Gaps = 16/193 (8%)

Query: 113 LMASATAEFLADIMLCPFEAIKVKQQ------TTMPPFCNNVVDGWKKMYAESGGMKAFY 166
            +A   A  +A  +  P E IK++ Q       +      N + G   ++ ++ G+K   
Sbjct: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIF-KNEGIKGLQ 84

Query: 167 KGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCA 226
           KG+   +  QI     +   +E I   +  +    +E  + +Q + V+   G  +GI+ A
Sbjct: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEP-HKVQSVGVNVFSGAASGIIGA 143

Query: 227 AVSHPADVMVSKINS--------ERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGT 278
            +  P  ++ +++ S        E+     +      I++  G  GL+ G+   I+  G 
Sbjct: 144 VIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGA 203

Query: 279 LTSFQWLIYDSFK 291
            +S Q  IY++ K
Sbjct: 204 GSSVQLPIYNTAK 216

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 60/132 (45%), Gaps = 15/132 (11%)

Query: 114 MASATAEFLADIMLCPFEAIKVKQQTTMPPFCN------NVVDGWKKMYAESGGMKAFYK 167
           +A   A   A  ++ P + IK+  QT+ P F         +V   K + A  G  + F++
Sbjct: 24  LAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGP-RGFFQ 82

Query: 168 GIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAA 227
           G      R  PY   KF ++E+I      V+P  + E +  + +S     G LAG+    
Sbjct: 83  GHSATLLRIFPYAAIKFIAYEQIRS---VVIPTWRHESHWRRLLS-----GSLAGLCSVF 134

Query: 228 VSHPADVMVSKI 239
           V++P D++  ++
Sbjct: 135 VTYPLDLVRVRL 146

 Score = 34.3 bits (77), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 69/196 (35%), Gaps = 49/196 (25%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANE----------------GWKKVYTGFGATFV 81
           PLDLV+ RL    + + + ++     I NE                 W   Y G+  T +
Sbjct: 138 PLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQWFAHWSNFYRGYTPTVI 197

Query: 82  GYSLQGAGKYGGYEYFKHLYS------------SWLSPGVT------------VYLMASA 117
           G        Y G  +F H               S LSPG +              L+A  
Sbjct: 198 GMI-----PYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQLVAGG 252

Query: 118 TAEFLADIMLCPFEAIKVKQQT---TMPPFCNNV-VDGWKKMYAESGGMKAFYKGIVPLW 173
            A   +     PFE I+ + Q    T P   + V ++   K+    GG + F+ G+   +
Sbjct: 253 LAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGWRGFFVGLSIGY 312

Query: 174 CRQIPYTMCKFTSFEK 189
            +  P   C F  +E+
Sbjct: 313 IKVTPMVACSFFIYER 328

>Kwal_55.21106
          Length = 328

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 111/283 (39%), Gaps = 43/283 (15%)

Query: 25  GIIACGPTHSSITPLDLVKCRLQ-------------VNPKLYTSNLQGFR---------K 62
           G +A    +  + PLDLVK  +Q             V P+   S +Q  R         K
Sbjct: 10  GAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDALIK 69

Query: 63  IIANEGWKKVYTGFGATFVGYSLQGAGKYGGY-----EYFKH-LYSSWLSPGVT-VYLMA 115
           I   +G   +Y G   + +   LQ    +  Y      +F++ L    L    T   L+ 
Sbjct: 70  IFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPEELLL 129

Query: 116 SATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGI-VPLWC 174
              A  ++ I   P   I  +QQT+         +   ++Y+E   +  F++G  V L  
Sbjct: 130 GIVAAAVSQIFTSPIGVISTRQQTSTSGSKGGFREVLHQIYSEQNNITGFWRGFKVSLIL 189

Query: 175 RQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQIS------VSFVGGYLAGILCAAV 228
              P     F S+EK+ Q I+    +  +E   L + S       +F+ G  + ++   +
Sbjct: 190 TVNP--SITFASYEKL-QDIFITSKRAVDENGQLLETSGQLSPRQNFLLGVFSKVISTLI 246

Query: 229 SHPADVMVSKINSERKAN--ESMSVASKRIYQKIGFTGLWNGL 269
           + P  ++VSK   +R  +  +S       +Y++ G   LW GL
Sbjct: 247 TQP--LIVSKAYLQRTGSNFQSFQQVLLYLYKQEGLISLWKGL 287

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 57/119 (47%), Gaps = 11/119 (9%)

Query: 161 GMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYL 220
           G++ F +G  P   RQ+  +  +FT++  + Q I    P  +           +FV G++
Sbjct: 282 GLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISPNKPLNE---------YYAFVLGFI 332

Query: 221 AGILCAAVSHPADVMVSKINSERK-ANESMSV-ASKRIYQKIGFTGLWNGLMVRIVMIG 277
           +     AV+ P DV+ +++ S+   AN   S+  + RI+ + G    W G   R++ +G
Sbjct: 333 SSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGIPKFWKGWAPRLMKVG 391

 Score = 34.3 bits (77), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 4/88 (4%)

Query: 15  KEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKL--YTSNLQGFRKIIANEGWKKV 72
            E+YA   LG I +C    +   P+D++K R+Q       Y ++L    +I   EG  K 
Sbjct: 322 NEYYA-FVLGFISSCAVV-AVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGIPKF 379

Query: 73  YTGFGATFVGYSLQGAGKYGGYEYFKHL 100
           + G+    +   L G   +G Y+Y ++L
Sbjct: 380 WKGWAPRLMKVGLSGGVSFGVYQYVENL 407

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 75/185 (40%), Gaps = 20/185 (10%)

Query: 21  CTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQG----FRKIIANEGWKKVYTGF 76
           C + G++A         P++L K +LQV     T+   G     +K+ ++ G + +Y G 
Sbjct: 161 CIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGL 220

Query: 77  GATFVGYSLQGAGKYGGYEYFKHLYSSW--LSPGVTVYLMASATAEFLADIMLCPFEAIK 134
            +T + +       +G YE     +     +S     +     +A F       P + IK
Sbjct: 221 TSTLI-FRTNFVFWWGSYELLTRWFKEHTNMSDTAINFWSGGFSASFGFWTTAYPSDVIK 279

Query: 135 VKQQTTMPPFCNNVVDG----WK---KMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSF 187
              Q  +   CN+  DG    WK   K    + G + F+KG VP + R  P       +F
Sbjct: 280 ---QVVL---CNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPANAAALAAF 333

Query: 188 EKIVQ 192
           E +++
Sbjct: 334 EFVLR 338

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 65/166 (39%), Gaps = 13/166 (7%)

Query: 129 PFEAIKVKQQTTMPPF-CNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSF 187
           PF+ IKV+ QT+         +D   K + + G ++ FY G  P     I          
Sbjct: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQG-IRGFYLGFTPPLVGWILMDSVMLGCL 138

Query: 188 EKIVQKIYSVLPKKKEEMNALQ-QISVSFVGGYLAGILCAAVSHPADVMVSKINSERKAN 246
                  Y +L KK    N  +  +S   + G +AG   + ++ P ++  +K+  +  A 
Sbjct: 139 HN-----YRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAK 193

Query: 247 ESMSVAS----KRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYD 288
            +         K++Y   G  GL+ GL   ++       F W  Y+
Sbjct: 194 TTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFV-FWWGSYE 238

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 79/191 (41%), Gaps = 20/191 (10%)

Query: 113 LMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGG---------MK 163
           L A A     A +   PF+ +KV+ Q+      +  VD  +K+  E+           M+
Sbjct: 51  LAAGAVGGVCAVLTGHPFDLLKVRCQSNQ---ASGTVDAVRKILVEARAQSGLSAVNMMR 107

Query: 164 AFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGI 223
            FYKG++P      P     F  ++  V K          ++   Q  +     G+++ I
Sbjct: 108 GFYKGVIPPLLGVTPIFAVSFWGYD--VGKKLVTWNDNSGKLTTAQLATA----GFISAI 161

Query: 224 LCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQ 283
               V  P + +  K+  + ++N S+  A+K I    G   L+ G +  +   G  ++  
Sbjct: 162 PTTLVMAPTERV--KVVLQTQSNHSLGSAAKHILATGGVRSLFRGSLATLARDGPGSALY 219

Query: 284 WLIYDSFKAYV 294
           +  Y++ KAY+
Sbjct: 220 FASYEATKAYL 230

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 66/173 (38%), Gaps = 7/173 (4%)

Query: 19  ATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGA 78
           A     G I+  PT   + P + VK  LQ        +    + I+A  G + ++ G  A
Sbjct: 150 AQLATAGFISAIPTTLVMAPTERVKVVLQTQSNHSLGSAA--KHILATGGVRSLFRGSLA 207

Query: 79  TFVGYSLQGAGKYGGYEYFK---HLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKV 135
           T        A  +  YE  K   +  S      +    +A   A     + + P + IK 
Sbjct: 208 TLARDGPGSALYFASYEATKAYLNARSGTNELSIKNVCLAGGMAGVSMWVGVFPIDTIKT 267

Query: 136 KQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFE 188
           + Q++       +++  +K+Y   GG+K F+ GI P   R  P     F   E
Sbjct: 268 ELQSSNTR--QTMMEATRKIYNTRGGIKGFFPGIGPALLRSFPANAATFLGVE 318

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 66/165 (40%), Gaps = 14/165 (8%)

Query: 134 KVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQK 193
           KV  ++T       ++   K MY ++ G  AF +G      RQI  T  +FT++      
Sbjct: 129 KVATKSTPVARIEKLLPAVKHMY-QTRGPAAFVQGTTATIFRQIANTSIQFTAYTAF--- 184

Query: 194 IYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVAS 253
                   K  + A    + S + G        A++ P DV+ +++ S+    E  +  +
Sbjct: 185 --------KRLLQARNDKASSVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLN 236

Query: 254 --KRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVGL 296
              RI+ + G    W G + R + +G      + +Y+     +G 
Sbjct: 237 CMYRIFVQEGMATFWKGSIFRFMKVGISGGLTFTVYEQVSLLLGF 281

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/250 (22%), Positives = 109/250 (43%), Gaps = 26/250 (10%)

Query: 68  GWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYL------MASATAEF 121
           G K  Y G G   +    + + K+G +E  K + +       T  L      +A   A  
Sbjct: 300 GIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFSTYIAGGLAGM 359

Query: 122 LADIMLCPFEAIKVKQQ----TTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQI 177
            A   + P + +K + Q     T     N +    K M+ E GG++ FY+G+        
Sbjct: 360 AAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFRE-GGLRLFYRGVTVGIVGIF 418

Query: 178 PYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQ-QISVSFV----GGYLAGILCAAVSHPA 232
           PY      +F  + +K Y  + K+ + +N  Q Q+++S +     G  +G + A+V +P 
Sbjct: 419 PYAALDLGTFSAL-KKWY--IAKQAKTLNLPQDQVTLSNLVVLPMGAFSGTVGASVVYPI 475

Query: 233 DVMVSKINSERKA------NESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLI 286
           +++ +++ ++         N    V  K + ++ G+ GL+ GL+  +  +    S  +L 
Sbjct: 476 NLLRTRLQAQGTYAHPYVYNGFKDVLLKTL-EREGYQGLFKGLVPTLAKVCPAVSISYLC 534

Query: 287 YDSFKAYVGL 296
           Y++ K ++ L
Sbjct: 535 YENLKKFMNL 544

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 56/264 (21%), Positives = 108/264 (40%), Gaps = 28/264 (10%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYF 97
           P D  K RLQ + K+ TS  +  + ++ NEG K  Y G     VG     + ++G  E  
Sbjct: 45  PFDTTKVRLQTS-KVPTSAAEVVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNEAM 103

Query: 98  KHLYSSW-----LSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCN----NV 148
           K  + +       +  ++ Y +   T       +  P E ++++ QT             
Sbjct: 104 KRFFHARNVDHNATLSLSQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEFKGP 163

Query: 149 VDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNAL 208
           +D  KK+ ++ G M    +G++P   R+       F  +E +V K  +   K+ E    +
Sbjct: 164 IDCIKKLRSQKGLM----RGLIPTMLREGHGCGTYFLVYEALVSKQINQGLKRTE----I 215

Query: 209 QQISVSFVGGYLAGILCAAVSHPADVMVSKINSER----KANESMSVASKRIYQKIGFTG 264
               +   G  L+G     + +P DV+ S + ++     +  ++M   ++ +Y + G   
Sbjct: 216 PPWKLCLYGA-LSGTALWLMVYPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKA 274

Query: 265 LWNGL---MVRIVMI--GTLTSFQ 283
            + G    M+R      GT  +F+
Sbjct: 275 FFKGFGPTMLRAAPANGGTFATFE 298

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 36  ITPLDLVKCRLQVN----PKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKY 91
           + P+D+VK  +Q +    P+   + +Q  R + A EG K  + GFG T +  +    G +
Sbjct: 235 VYPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTF 294

Query: 92  GGYEYFKHL 100
             +E    L
Sbjct: 295 ATFELAMRL 303

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 60/283 (21%), Positives = 112/283 (39%), Gaps = 43/283 (15%)

Query: 25  GIIACGPTHSSITPLDLVKCRLQVNPK-----------LYTSNLQGFRKIIANEGWKKVY 73
           G +A     +++ PLDL K  +Q   K            Y + +    KI    G+  +Y
Sbjct: 10  GAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLY 69

Query: 74  TGFGATFVGYSLQGAGKYGGYEYFKHLY-------------SSWLSPGVTVYLMASATAE 120
            G         +Q    +  Y   +  Y             S ++       L    +A 
Sbjct: 70  QGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELALGMSAG 129

Query: 121 FLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGG-MKAFYKGI-VPLWCRQIP 178
            +  ++  P   I  +QQ T      ++    K++Y ES G + AF+KG  V L     P
Sbjct: 130 AMTQVVTNPISVISTRQQLTKDGEDASLKAVIKQIYEESNGDLTAFWKGFKVALVLSTNP 189

Query: 179 YTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISV------SFVGGYLAGILCAAVSHPA 232
                + S++K+   I +      + ++  Q+IS       +F+ G  + ++   V+ P 
Sbjct: 190 --AITYGSYQKLKSMILTA-----KGLSGSQKISTQLSAGENFLLGMFSKMISTFVTQP- 241

Query: 233 DVMVSKINSERKANE--SMSVASKRIYQKIGFTGLWNGLMVRI 273
            ++V+KI  + K ++  +     + IYQ  GF  LW G++ ++
Sbjct: 242 -LIVAKITLQGKGSKFKTFQEVLQHIYQNEGFLSLWKGVIPQV 283

>Scas_687.15*
          Length = 328

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 64/135 (47%), Gaps = 14/135 (10%)

Query: 146 NNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEM 205
           +N+    K++Y  + G++ F +G +P   RQ+  +  +FT++  + Q I    P     +
Sbjct: 178 SNIFSVVKEIYL-TRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLISPTQP-----L 231

Query: 206 NALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKA---NESMSVASKRIYQKIGF 262
           N +    +    G  +     A++ P DV+ +++ S+        S++ A  R++ + G 
Sbjct: 232 NEVYAFGI----GLFSSCAVVALTQPIDVVKTRMQSKTAHYFYKNSLNCAY-RVFVEEGM 286

Query: 263 TGLWNGLMVRIVMIG 277
             LW G + R+  +G
Sbjct: 287 VSLWKGWLPRLFKVG 301

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 38  PLDLVKCRLQVNPK--LYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYE 95
           P+D+VK R+Q       Y ++L    ++   EG   ++ G+        L G   +G Y+
Sbjct: 253 PIDVVKTRMQSKTAHYFYKNSLNCAYRVFVEEGMVSLWKGWLPRLFKVGLSGGISFGVYQ 312

Query: 96  YFKHL 100
           Y ++L
Sbjct: 313 YVENL 317

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/249 (20%), Positives = 102/249 (40%), Gaps = 24/249 (9%)

Query: 68  GWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYL------MASATAEF 121
           G +  Y G G   V    + A K+G +E  K + +   +   T  L      +A      
Sbjct: 272 GLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLSTYIAGGLGGV 331

Query: 122 LADIMLCPFEAIKVKQQTTMPPFCNNV------VDGWKKMYAESGGMKAFYKGIVPLWCR 175
            A   + P + +K + Q    P   N+      +   K+MY + GG++ FY+G+      
Sbjct: 332 AAQFSVYPIDTLKYRIQCA--PLNTNLKKSSILLQTAKEMY-QQGGIRLFYRGVHIGVMG 388

Query: 176 QIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFV---GGYLAGILCAAVSHPA 232
             PY      +F  + +K Y     KK  +   + I  + +    G  +G + A + +P 
Sbjct: 389 IFPYAALDLGTFSAL-KKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVGATLVYPI 447

Query: 233 DVMVSKINSE-----RKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIY 287
           +++ +++ ++            S   K+  Q+ G+ GL+ GL+  +  +    S  +L Y
Sbjct: 448 NLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCPAVSISYLCY 507

Query: 288 DSFKAYVGL 296
           ++ K  + L
Sbjct: 508 ENLKRLMKL 516

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/252 (21%), Positives = 108/252 (42%), Gaps = 36/252 (14%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYF 97
           P+D +K RLQ     +            N G++ +Y G G+  V  +   +  +  Y+  
Sbjct: 25  PIDTLKTRLQAKGGFF-----------HNGGYRGIYRGLGSAVVASAPGASLFFVTYDSM 73

Query: 98  KH----LYSSWLS----PGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVV 149
           K     +   W +      V  ++++S+  E  A ++  P E IK + QT      N+ +
Sbjct: 74  KQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVRVPAEVIKQRTQTH---HTNSSL 130

Query: 150 DGWKKMYAESGG---MKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMN 206
              + +  +  G   ++  Y+G      R+IP+T  +F         +Y  L KK     
Sbjct: 131 QTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQF--------PLYEYLKKKWAAYA 182

Query: 207 ALQQISV--SFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTG 264
            ++++S     V G LAG + AA + P DV+ +++    +    + +A + ++++ G   
Sbjct: 183 EIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRVPMLHLA-RTLFREEGARV 241

Query: 265 LWNGLMVRIVMI 276
            + G+  R + I
Sbjct: 242 FFRGIGPRTMWI 253

>Scas_714.18
          Length = 305

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 71/183 (38%), Gaps = 33/183 (18%)

Query: 36  ITPLDLVKCRLQVNPKLY--------------------------TSNLQGFRKIIANEGW 69
           +TP++L+KC+LQ++   Y                          T  +   + II  +G 
Sbjct: 124 LTPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGL 183

Query: 70  KKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVY--LMASATAEFLADIML 127
             ++ G  +TF+  S+     +  YE  K       S   T +  L++ ATA    +  +
Sbjct: 184 FGLWQGQSSTFIRESIGSVVWFATYELMKQTLRDPKSEVNTTWQLLISGATAGLAFNGSV 243

Query: 128 CPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSF 187
            P + +K   QT        V     +   E  G+  FY+G+     R +P     F ++
Sbjct: 244 FPADTVKSIMQTEHLALMETV-----RSILERDGVAGFYRGLGITLLRAVPSNAAVFYTY 298

Query: 188 EKI 190
           EK+
Sbjct: 299 EKL 301

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 83/191 (43%), Gaps = 23/191 (12%)

Query: 20  TCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGAT 79
           + T G +I  G     + PLD++K + Q NP+ +    +GF +I+ +EG   +Y G+G T
Sbjct: 121 SATAGSLIGIGEI--VLLPLDVLKIKRQTNPESFRG--RGFLRILRDEGMG-LYRGWGWT 175

Query: 80  FVGYSLQGAGKYGGYEYFK--------HLYSSWLSPGVTVYLMASATAEFLADIMLCPFE 131
               +      +GG  + K        +  ++W    V+    ASA+      I+  P +
Sbjct: 176 AARNAPGSFALFGGNAFAKEYILGLKDYSQATWGQNFVSSIFGASASL-----IVSAPLD 230

Query: 132 AIKVKQQTTMPPFCNNVVDGWK--KMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEK 189
            IK + Q+       +   G+   K   ++ G  AF+KG+ P      P  +  F   + 
Sbjct: 231 VIKTRIQSRN---FESAESGFTIVKNTLKNEGATAFFKGLTPKLLTTGPKLVFSFAIAQT 287

Query: 190 IVQKIYSVLPK 200
           ++    ++L K
Sbjct: 288 LIPMFDNMLRK 298

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 105/281 (37%), Gaps = 35/281 (12%)

Query: 25  GIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKK--------VYTGF 76
           GI+  G  H    P+D +  RL  N    T N Q    ++  E   K        ++ G 
Sbjct: 20  GILEIGVFH----PVDTISKRLMSNHTKIT-NAQQLNDVVFREHASKPFGQRLFTLFPGL 74

Query: 77  GATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGV-------TVYLMASATAEFL---ADIM 126
           G        Q   KYGG  +     +              T   + SATA  L    +I+
Sbjct: 75  GYAATYKIFQRVYKYGGQPFANEFLNKHFKADFDGAFGEKTGKALRSATAGSLIGIGEIV 134

Query: 127 LCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTS 186
           L P + +K+K+QT    F      G+ ++  + G     Y+G      R  P +   F  
Sbjct: 135 LLPLDVLKIKRQTNPESFRGR---GFLRILRDEG--MGLYRGWGWTAARNAPGSFALFGG 189

Query: 187 FEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSER-KA 245
                 K Y +L  K        Q  VS + G  A ++   VS P DV+ ++I S   ++
Sbjct: 190 --NAFAKEY-ILGLKDYSQATWGQNFVSSIFGASASLI---VSAPLDVIKTRIQSRNFES 243

Query: 246 NESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLI 286
            ES     K   +  G T  + GL  +++  G    F + I
Sbjct: 244 AESGFTIVKNTLKNEGATAFFKGLTPKLLTTGPKLVFSFAI 284

>Scas_671.1*
          Length = 123

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 1/70 (1%)

Query: 27  IACGPTHSSIT-PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSL 85
           IA     ++IT P D +K R+Q+ PK++T+       I  NE   ++++G        +L
Sbjct: 47  IASASLATAITAPFDTIKTRMQLKPKVFTNFFTTLVLITKNESIFQLFSGLSMRLTRKAL 106

Query: 86  QGAGKYGGYE 95
                +G YE
Sbjct: 107 SAGIAWGIYE 116

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/285 (22%), Positives = 112/285 (39%), Gaps = 38/285 (13%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYF 97
           P D  K RLQ      T+ L+  R ++ NEG    Y G     +G  +  + ++G  E  
Sbjct: 54  PFDTTKVRLQTA-TTRTTTLEVLRNLVKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAM 112

Query: 98  KHLYSSW--------------LSPGVTV----YLMASATAEFLADIMLCPFEAIKVKQQT 139
           K  + ++              LS   T+    Y +   T   +   +  P E I+++ QT
Sbjct: 113 KRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQT 172

Query: 140 TMPPFCNNVVDG-W---KKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIV-QKI 194
                 +    G W   KK+ A+ G M    +G+ P   R        F  +E +V ++I
Sbjct: 173 QTSNGGDREFKGPWDCIKKLKAQGGLM----RGLFPTMIRAGHGLGTYFLVYEALVAREI 228

Query: 195 YSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSER----KANESMS 250
            + L +     N +    +   G +   +L   V +P DV+ S I ++     K   S+S
Sbjct: 229 GTGLTR-----NEIPPWKLCLFGAFSGTMLWLTV-YPLDVVKSIIQNDDLRKPKYKNSIS 282

Query: 251 VASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVG 295
             +K IY K G    + G    +V    +    +L ++    ++G
Sbjct: 283 YVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMRFLG 327

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 71/150 (47%), Gaps = 12/150 (8%)

Query: 152 WKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEE-MNALQQ 210
           +K+++A  G ++   KG+  +  RQ+     +F     +   I  V  K+ +E ++A+++
Sbjct: 157 FKQIFAAEG-LRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLSAMEK 215

Query: 211 ISVSFVGGYLAGILCAAVSHPADV----MVSKINS-ERKANESMSVASKRIYQKIGFTGL 265
           I  S +GG L+     A + P +V    M S+ N   R  N ++    + IY+  G  GL
Sbjct: 216 IVASALGGGLS-----AWNQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRYIYENNGLRGL 270

Query: 266 WNGLMVRIVMIGTLTSFQWLIYDSFKAYVG 295
           + G+  RI +    T F     D  + +VG
Sbjct: 271 YRGVTPRIGLGVWQTIFMVGFGDIARDFVG 300

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 79/198 (39%), Gaps = 31/198 (15%)

Query: 18  YATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKL-----YTSNLQGFRKIIANEGWKKV 72
           Y TC   G ++        TP++ V+ RLQ+  K      Y  +L   +K++  +   + 
Sbjct: 121 YYTC---GFVSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQKALMRG 177

Query: 73  YT--------GFGATFVGYS--LQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFL 122
           +T        GFG  F+ Y   +    K G       +    + P       A + A F 
Sbjct: 178 FTATLMRTSHGFGVYFLTYEALIMNQNKNG-------VLRKDIPPWKVCVFGAFSGAFFW 230

Query: 123 ADIMLCPFEAIKVKQQTTM---PPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPY 179
           A  M  PF+ +K   Q      P    NV    K ++A + G  AF KG VP   R +P 
Sbjct: 231 A--MTYPFDVVKSIMQADRLVSPVHGKNVFQVAKSIHA-TRGWGAFVKGFVPTMLRSLPV 287

Query: 180 TMCKFTSFEKIVQKIYSV 197
               F +FE  ++ + S+
Sbjct: 288 NGATFATFEVTMRLLESL 305

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/195 (18%), Positives = 83/195 (42%), Gaps = 11/195 (5%)

Query: 102 SSWLSPGVTVY--LMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAES 159
           SS+L P + +Y  + + A    L  ++  P   IKV+ ++T+  + +           E 
Sbjct: 96  SSYL-PQLNMYENMFSGAVTRALTGLITMPITVIKVRYESTLYQYTSLRYATSHIFRTE- 153

Query: 160 GGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISV---SFV 216
            G++ F++G      R  PY       ++++   + ++LP    ++N+  + S    + +
Sbjct: 154 -GLRGFFRGFGATALRDAPYAGLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLI 212

Query: 217 GG---YLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRI 273
            G   + A ++  +++ P D + +++  E     S +     I  K     L+ G+ +R+
Sbjct: 213 NGSSAFSAAVIATSITAPFDTVKTRMQLEPAKFHSFTSTFWHIATKESVRNLFAGISLRL 272

Query: 274 VMIGTLTSFQWLIYD 288
                     W IY+
Sbjct: 273 TRKAFSAGIAWGIYE 287

 Score = 32.3 bits (72), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 70/176 (39%), Gaps = 27/176 (15%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGG---- 93
           P+ ++K R +     YTS       I   EG +  + GFGAT    +L+ A  Y G    
Sbjct: 124 PITVIKVRYESTLYQYTSLRYATSHIFRTEGLRGFFRGFGAT----ALRDA-PYAGLYML 178

Query: 94  -YEYFKHLYSSWLSPGV--------------TVYLMASA-TAEFLADIMLCPFEAIKVKQ 137
            Y+  K L  + L   V              T+   +SA +A  +A  +  PF+ +K + 
Sbjct: 179 FYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAPFDTVKTRM 238

Query: 138 QTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQK 193
           Q     F +     W     ES  ++  + GI     R+       +  +E+IV+K
Sbjct: 239 QLEPAKFHSFTSTFWHIATKES--VRNLFAGISLRLTRKAFSAGIAWGIYEEIVKK 292

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 27/63 (42%), Gaps = 1/63 (1%)

Query: 34  SSIT-PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYG 92
           +SIT P D VK R+Q+ P  + S    F  I   E  + ++ G        +      +G
Sbjct: 225 TSITAPFDTVKTRMQLEPAKFHSFTSTFWHIATKESVRNLFAGISLRLTRKAFSAGIAWG 284

Query: 93  GYE 95
            YE
Sbjct: 285 IYE 287

>Kwal_33.12988
          Length = 303

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 126 MLCPFEAIKVKQQTT---MPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMC 182
           M+ PF+ IK   Q+     P +  NV    K +Y E G  KAF KG  P   R +P    
Sbjct: 232 MVYPFDVIKSVMQSDKLRTPVYGTNVFQVAKNIYNERGP-KAFVKGFGPTMLRSLPVNGA 290

Query: 183 KFTSFE 188
            FT+FE
Sbjct: 291 TFTAFE 296

 Score = 34.3 bits (77), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 91/224 (40%), Gaps = 37/224 (16%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYF 97
           P D+ K RLQ +    T+ L+  + ++ NEG +  Y G     +G  L  + ++G  E  
Sbjct: 43  PFDITKVRLQTS-STPTTALRVVQDLVKNEGLRGFYKGTTLPLIGVGLCVSSQFGTNEAM 101

Query: 98  K---HLYSSWLSPGVTV-------YLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCN- 146
           K   H  +++ S  + +       ++   A A FLA     P E +++  Q       + 
Sbjct: 102 KRYFHKRNNFQSTSLRLPEYYACGFVSGCANA-FLA----TPIEHVRILLQVQTKSRADA 156

Query: 147 ---NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKE 203
                +D  KK+  E   M+ F     P   R        FTS+E ++           E
Sbjct: 157 EYQGAMDCIKKLLKEGKLMRGF----TPTILRTSHGFGVYFTSYEAMIC---------SE 203

Query: 204 EMNALQQISVSF----VGGYLAGILCAAVSHPADVMVSKINSER 243
           +   + +  +      + G  +G L  A+ +P DV+ S + S++
Sbjct: 204 QRKGIARKDIPAWKLCLYGAFSGSLLWAMVYPFDVIKSVMQSDK 247

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/287 (20%), Positives = 114/287 (39%), Gaps = 27/287 (9%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVG 82
           +GG +    +   + P DL+K RLQ N     + L G  K I +   K+++ G   + + 
Sbjct: 12  IGGFVGGLTSAIVLQPFDLLKTRLQQNKD---TTLWGTLKEIRSP--KQLWRGALPSSLR 66

Query: 83  YSLQGAGKYGGYEYFKHLY-----------SSWLSPGVTVY--LMASATAEFLADIMLCP 129
            S+  A        F+              SS+L P +T+Y  L + A    +   +  P
Sbjct: 67  TSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFL-PQLTMYENLASGAFTRGVVGFITMP 125

Query: 130 FEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEK 189
              IKV+ ++TM  +  ++ +  + +Y+ + G++ F+ G      R  PY       +EK
Sbjct: 126 ITIIKVRYESTMYSY-KSLGEATRHIYS-TEGIRGFFNGCGATVMRDAPYAGLYVLLYEK 183

Query: 190 IVQKIYSVLPKKKEEMNALQQIS------VSFVGGYLAGILCAAVSHPADVMVSKINSER 243
               +  +LP      +     +      V+ +  +++  L   ++ P D + +++  + 
Sbjct: 184 AKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIKTRMQLDP 243

Query: 244 KANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSF 290
                       I  K  F  L++GL +R+          W IY+  
Sbjct: 244 TKFSGFYKTLVLIVSKEKFKNLFDGLTLRLTRKAFSAGIAWGIYEEL 290

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 72/169 (42%), Gaps = 24/169 (14%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYF 97
           P D  K RLQ +  + T+ L   +K++ NEG++  Y G     VG     + ++G  E  
Sbjct: 43  PFDTTKVRLQTS-SVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAM 101

Query: 98  KHLYSSW---LSPGVTVYLM-------ASATAE-FLADIMLCPFEAIKVKQQTTMPPFC- 145
           K  + S      P  T+ L+       A  TA  FLA     P E ++++ QT       
Sbjct: 102 KRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS----PIEHVRIRLQTQTGTGAA 157

Query: 146 ---NNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIV 191
              +  +D  KK+ A +    +  +G+ P   R+       F ++E ++
Sbjct: 158 AQFHGPLDCIKKLTANN----SLMRGLTPTMLRESHGCGVYFLTYEALI 202

 Score = 35.4 bits (80), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 70/167 (41%), Gaps = 22/167 (13%)

Query: 37  TPLDLVKCRLQVNPKL-----YTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKY 91
           +P++ V+ RLQ          +   L   +K+ AN    +   G   T +  S  G G Y
Sbjct: 139 SPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMR---GLTPTMLRES-HGCGVY 194

Query: 92  GGYEYFKHLYSSWLSPGVTVYLMAS-------ATAEFLADIMLCPFEAIKVKQQTT---M 141
             +  ++ L ++ L  GV+   + +       AT+     +M+ P + IK   QT     
Sbjct: 195 --FLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQ 252

Query: 142 PPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFE 188
           P    N++   K +Y+  G + +F+KG  P   R  P     F +FE
Sbjct: 253 PKQGKNMLQVAKTIYSTRG-LSSFFKGFGPTMLRAAPANGATFATFE 298

>Kwal_34.15907
          Length = 312

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 71/151 (47%), Gaps = 13/151 (8%)

Query: 152 WKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKK--EEMNALQ 209
           +K++Y++ G +K   KG+  +  RQ+     +F     + Q I     K    +++ AL+
Sbjct: 157 FKEIYSKEG-IKGINKGVNAVAIRQMTNWGSRFGLSRLVEQGIRDFTGKTNPDDKLTALE 215

Query: 210 QISVSFVGGYLAGILCAAVSHPADVMVSKINSE-----RKANESMSVASKRIYQKIGFTG 264
           +I  S +GG L+     A + P +V+  ++ S+     R    ++  A K IYQ  G  G
Sbjct: 216 KIFASALGGGLS-----AWNQPIEVIRVEMQSKKEDPNRPKKLTVGSAFKYIYQSSGIKG 270

Query: 265 LWNGLMVRIVMIGTLTSFQWLIYDSFKAYVG 295
           L+ G+  RI +    T F     D  K +VG
Sbjct: 271 LYRGVAPRIGLGVWQTVFMVGFGDIAKEFVG 301

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 32/72 (44%)

Query: 24  GGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGY 83
             +++     +   P D +K R+Q+ P  +T++   F  I+ NE   K+++G        
Sbjct: 229 SAVLSASLATTVTAPFDTIKTRMQLEPSKFTNSFNTFTSIVKNENVLKLFSGLSMRLARK 288

Query: 84  SLQGAGKYGGYE 95
           +      +G YE
Sbjct: 289 AFSAGIAWGIYE 300

>Kwal_56.23011
          Length = 303

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 73/174 (41%), Gaps = 24/174 (13%)

Query: 37  TPLDLVKCRLQV-----NPKLYTSNLQGFRKIIANEGWKKVYT--------GFGATFVGY 83
           TP++ V+ RLQ+     +   Y  +L   RK++      + +T        GFG  F+ Y
Sbjct: 137 TPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLKQGALMRGFTATTLRTSHGFGIYFLTY 196

Query: 84  SLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTM-- 141
               A +   +   +    +W    V VY  A + A F A  M  PF+ +K   Q     
Sbjct: 197 ETLIANQ-AHHGVLRENIPAW---KVCVY-GAFSGAFFWA--MTYPFDVVKSVMQADKLK 249

Query: 142 -PPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKI 194
            P +  N +   K +Y E G  +AF KG  P   R +P     F +FE  ++ I
Sbjct: 250 NPVYGRNPLAVAKAIYRERGP-RAFTKGFTPTMLRSLPVNGATFAAFEITMRLI 302

 Score = 31.6 bits (70), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 59/267 (22%), Positives = 114/267 (42%), Gaps = 34/267 (12%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYE-- 95
           P D+ K RLQ +P + T+  Q  + ++ NEG    Y G  A   G     + ++G  E  
Sbjct: 43  PFDITKVRLQTSP-VPTTAAQVIKSLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEAL 101

Query: 96  --YFKHLYSSWLSPGVTVYLMASATAEFLADIMLC-PFEAIKVKQQ----TTMPPFCNNV 148
             +F+    ++  P       A       A+  L  P E ++++ Q    ++     +  
Sbjct: 102 KKWFRKKDGNFDQPLALRQYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGS 161

Query: 149 VDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIV--QKIYSVLPKKKEEMN 206
           +D  +K+  +   M+ F    +    R        F ++E ++  Q  + VL   +E + 
Sbjct: 162 LDCARKLLKQGALMRGFTATTL----RTSHGFGIYFLTYETLIANQAHHGVL---RENIP 214

Query: 207 ALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKAN-----ESMSVASKRIYQKIG 261
           A +      V G  +G    A+++P DV+ S + +++  N       ++VA K IY++ G
Sbjct: 215 AWKVC----VYGAFSGAFFWAMTYPFDVVKSVMQADKLKNPVYGRNPLAVA-KAIYRERG 269

Query: 262 ---FTGLWNGLMVRIVMI--GTLTSFQ 283
              FT  +   M+R + +   T  +F+
Sbjct: 270 PRAFTKGFTPTMLRSLPVNGATFAAFE 296

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 66/130 (50%), Gaps = 15/130 (11%)

Query: 152 WKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQ---KIYSVLPKKKEEMNAL 208
           +K++Y + G ++   KG+  +  RQ+     +F  F ++V+   + ++      +++ AL
Sbjct: 153 FKEIYNKEG-IRGINKGVNAVAIRQMTNWGSRF-GFSRLVEEGLRKFTGKTNPDDKLTAL 210

Query: 209 QQISVSFVGGYLAGILCAAVSHPADV----MVSKINS-ERKANESMSVASKRIYQKIGFT 263
           ++I  S +GG L+     A + P +V    M SK N   R  + ++  A + IYQ  G  
Sbjct: 211 EKIFASAIGGGLS-----AWNQPIEVIRVEMQSKTNDPNRPKDLTVGKAFRYIYQSNGVK 265

Query: 264 GLWNGLMVRI 273
           GL+ G+  RI
Sbjct: 266 GLYRGVTPRI 275

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 61/129 (47%), Gaps = 13/129 (10%)

Query: 152 WKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPK--KKEEMNALQ 209
           +K +Y + G ++   KG+  +  RQ+     +F     +   I  +  K  K +++N  +
Sbjct: 159 FKNIYKKEG-IRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKITGKTNKDDKLNPFE 217

Query: 210 QISVSFVGGYLAGILCAAVSHPADVMVSKINSE-----RKANESMSVASKRIYQKIGFTG 264
           +I  S +GG L+     A + P +V+  ++ S+     R  N ++    K IYQ  G  G
Sbjct: 218 KIGASALGGGLS-----AWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKG 272

Query: 265 LWNGLMVRI 273
           L+ G+  RI
Sbjct: 273 LYRGVTPRI 281

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 56/263 (21%), Positives = 104/263 (39%), Gaps = 44/263 (16%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQGFR-------KIIANEGWKKVYTGFGATFVGYSLQGAGK 90
           P D VK RLQ +     + +Q F+       K + N+G + +Y GF     G+ +  +  
Sbjct: 29  PFDTVKVRLQTSQVGSGAGIQ-FKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDSAL 87

Query: 91  YGGYEYFKHLYSSWLSPG---------VTVYLMASATAEFLADIMLCPFEAIKVKQQTTM 141
            G    ++ L   ++ P          +   +MA  T  F+A     P E  K K Q   
Sbjct: 88  LGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIA----APVELAKAKLQVQY 143

Query: 142 PPFCNNV---VDGWKKMYAES-------GGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIV 191
                     +D  +K++ +        GG+++ YKG++     +  +    + S+E I 
Sbjct: 144 DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSNFVFW-WGSYELIT 202

Query: 192 QKIYSVLPKKKEEMNALQQISVSF-VGGYLAGILCAAVSHPADVMVSKINSERKAN---E 247
           Q          ++   L   +++F  GG  A       ++P+DV+   +    K +   +
Sbjct: 203 QWF--------QKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFK 254

Query: 248 SMSVASKRIYQKIGFTGLWNGLM 270
           S   A   IY++ G  G + G +
Sbjct: 255 SWRTAVSDIYRQRGIHGFFKGFL 277

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 77/193 (39%), Gaps = 28/193 (14%)

Query: 21  CTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQG--------FRKIIANEGW--- 69
           C + G++A         P++L K +LQV     T+   G        F++ +A  G    
Sbjct: 114 CIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGG 173

Query: 70  -KKVYTGFGATFVGYSLQGAGKYGGYEYFKHLY--SSWLSPGVTVYLMASATAEFLADIM 126
            + +Y G  +T + +       +G YE     +  ++ LS     +     +A F     
Sbjct: 174 VRSLYKGLISTLI-FRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTS 232

Query: 127 LCPFEAIKVKQQTTMPPFCNNVVDG----WKKMYAE---SGGMKAFYKGIVPLWCRQIPY 179
             P + +K   Q  +   CN+  DG    W+   ++     G+  F+KG +P + R  P 
Sbjct: 233 AYPSDVVK---QVVL---CNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPA 286

Query: 180 TMCKFTSFEKIVQ 192
                 +FE +++
Sbjct: 287 NAAALAAFEFVLR 299

>Kwal_27.11419
          Length = 298

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%)

Query: 37  TPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYE 95
           +P D +K R+Q+NP  Y   +Q F+ II  E  + ++ G        +L     +G YE
Sbjct: 233 SPFDTIKTRMQLNPSQYYGFIQTFKSIIRYERPRNLFDGLSLRLSRKALSAGIAWGIYE 291

 Score = 36.6 bits (83), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 62/296 (20%), Positives = 110/296 (37%), Gaps = 42/296 (14%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEG--WKKVYTGFGATF 80
           +GG +    +   + P DL+K RLQ N    +SNL    + I   G  WK        T 
Sbjct: 12  IGGFVGGLTSAVILQPFDLLKTRLQQNK---SSNLLDVVRSIETPGQLWKGTLPSALRTS 68

Query: 81  VGYSL-----------------QG-AGKYGGYEYFKHL--YSSWLSPGVTVYLMASATAE 120
           VG +L                 +G AGK G   +   L  Y + +S  +T   +  AT  
Sbjct: 69  VGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVGVAT-- 126

Query: 121 FLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYT 180
                   P   +KV+ ++TM  +  ++ +    +Y  S G++  + G      R  PY 
Sbjct: 127 -------MPITVLKVRFESTMYNY-KSLGEAATHIY-RSEGIRGLFSGCGATVMRDAPYA 177

Query: 181 MCKFTSFEKIVQKIYSVLPKKKEEMNALQQIS------VSFVGGYLAGILCAAVSHPADV 234
                 +E+   ++  +LP    E N     S      ++ +  + +  L   ++ P D 
Sbjct: 178 GLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLATTITSPFDT 237

Query: 235 MVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSF 290
           + +++              K I +      L++GL +R+          W IY+  
Sbjct: 238 IKTRMQLNPSQYYGFIQTFKSIIRYERPRNLFDGLSLRLSRKALSAGIAWGIYEEL 293

 Score = 28.9 bits (63), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 8/32 (25%), Positives = 20/32 (62%)

Query: 215 FVGGYLAGILCAAVSHPADVMVSKINSERKAN 246
           F+GG++ G+  A +  P D++ +++   + +N
Sbjct: 11  FIGGFVGGLTSAVILQPFDLLKTRLQQNKSSN 42

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 81/195 (41%), Gaps = 38/195 (19%)

Query: 27  IACGPTHSSIT-PLDLVKCRLQVNP-------KLYTSNLQGFRKIIANEGWKKVYTGFGA 78
           +  G   +++T P+ +VK RL +           Y + L  F KI   EG K  Y+G   
Sbjct: 223 LTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSGLIP 282

Query: 79  TFVGYSLQGAGKYGGYEYFK---HLY---------------SSWLSPGVTVY-----LMA 115
           +  G  L  A  +  YE  K   H Y               S+  + G T +     ++A
Sbjct: 283 SLFGL-LHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRLIVA 341

Query: 116 SATAEFLADIMLCPFEAIKVKQQ--TTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLW 173
           S  ++ +A  +  P E ++ + Q  + M P   +++   +  YA+ G ++ FY G +   
Sbjct: 342 SCGSKMIASTLTYPHEILRTRLQLKSDMKPSIKSII---RTTYAKEG-IRGFYSGFLTNM 397

Query: 174 CRQIPYTMCKFTSFE 188
            R +P +     SFE
Sbjct: 398 FRTVPASAITLVSFE 412

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 36/94 (38%), Gaps = 18/94 (19%)

Query: 114 MASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGG------------ 161
           ++ A A FLA +++CP +  K + Q         V      +    GG            
Sbjct: 108 LSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTT 167

Query: 162 ------MKAFYKGIVPLWCRQIPYTMCKFTSFEK 189
                 ++  YKGIVP+     P  M  F+ +E+
Sbjct: 168 IVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYER 201

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 36/82 (43%), Gaps = 3/82 (3%)

Query: 26  IIACGP--THSSIT-PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVG 82
           + +CG     S++T P ++++ RLQ+   +  S     R   A EG +  Y+GF      
Sbjct: 340 VASCGSKMIASTLTYPHEILRTRLQLKSDMKPSIKSIIRTTYAKEGIRGFYSGFLTNMFR 399

Query: 83  YSLQGAGKYGGYEYFKHLYSSW 104
                A     +EYF+  +  W
Sbjct: 400 TVPASAITLVSFEYFRKHFKLW 421

>Scas_696.9
          Length = 312

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 66/129 (51%), Gaps = 15/129 (11%)

Query: 153 KKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQ---KIYSVLPKKKEEMNALQ 209
           + +YA+ G ++  YKG+  +  RQ+     +F  F ++V+   +  +   K ++ +NA +
Sbjct: 158 RSIYAKEG-LRGIYKGVNAVAIRQMTNWGSRF-GFSRLVEDWVRKATGKTKPEDRLNAWE 215

Query: 210 QISVSFVGGYLAGILCAAVSHPADVMVSKINSE-----RKANESMSVASKRIYQKIGFTG 264
           +I  + VGG L     +A + P +V+  ++ S+     R  N +++   K I +  G  G
Sbjct: 216 KIGATAVGGGL-----SAWNQPIEVIRVEMQSKKEDPNRPKNLTVAKTFKYIMKTNGVKG 270

Query: 265 LWNGLMVRI 273
           L+ G+  RI
Sbjct: 271 LYRGVTPRI 279

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 17  FYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKL---YTSNLQGFRKIIANEGWKKVY 73
           F A+  LG  +  G + +S  PLD V+ R+ +       Y      FRKI+A EG K ++
Sbjct: 214 FLASFLLGWAVTTGASTASY-PLDTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGIKSLF 272

Query: 74  TGFGATFVGYSLQGAG 89
            G GA  +   + GAG
Sbjct: 273 KGCGANIL-RGVAGAG 287

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 76/196 (38%), Gaps = 23/196 (11%)

Query: 112 YLMASATAEFLADIMLCPFEAIKVK--------QQTTMPPFCNNVVDGWKKMYAESGGMK 163
           +LM   +A  ++     P E +K+         +Q ++      +V+ +K+  A+ G + 
Sbjct: 14  FLMGGVSAA-VSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTAADEG-VA 71

Query: 164 AFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNA--------LQQISVSF 215
           +F++G      R  P     F        KI ++   KKEE  A           ++   
Sbjct: 72  SFWRGNTANVIRYFPTQALNFA----FKDKIKAMFGFKKEEGYAKWFAGNLASGGLAGGL 127

Query: 216 VGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVM 275
              ++  +  A     AD   +K   ER+ N  + V  K +    G  GL+ G +  +V 
Sbjct: 128 SLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASD-GVAGLYRGFLPSVVG 186

Query: 276 IGTLTSFQWLIYDSFK 291
           I       + +YDS K
Sbjct: 187 IVVYRGLYFGLYDSLK 202

>Kwal_27.12481
          Length = 304

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 16  EFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKL---YTSNLQGFRKIIANEGWKKV 72
            F A+  LG  +  G + +S  PLD V+ R+ +       Y      FRKI+A EG K +
Sbjct: 213 SFLASFLLGWAVTTGASTASY-PLDTVRRRMMMTSGQAVKYNGAFDAFRKIVAAEGIKSL 271

Query: 73  YTGFGATFVGYSLQGAG 89
           + G GA  +   + GAG
Sbjct: 272 FKGCGANIL-RGVAGAG 287

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 71/183 (38%), Gaps = 35/183 (19%)

Query: 8   RKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPK--------LYTSNLQG 59
           +K + Y K F      GG  A G +   +  LD  + RL  + K         +   +  
Sbjct: 105 KKEEGYAKWFAGNLASGGA-AGGLSLMFVYSLDYARTRLAADSKGAKKGGERQFNGLVDV 163

Query: 60  FRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATA 119
           ++K +A++G   +Y GF  + VG  +     +GGY+  K L            L  S   
Sbjct: 164 YKKTLASDGIAGLYRGFLPSVVGIVVYRGLYFGGYDSLKPL-----------LLTGSLEG 212

Query: 120 EFLADIMLC------------PFEAIKVKQQTTMPPFC--NNVVDGWKKMYAESGGMKAF 165
            FLA  +L             P + ++ +   T       N   D ++K+ A   G+K+ 
Sbjct: 213 SFLASFLLGWAVTTGASTASYPLDTVRRRMMMTSGQAVKYNGAFDAFRKIVAAE-GIKSL 271

Query: 166 YKG 168
           +KG
Sbjct: 272 FKG 274

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 57/120 (47%), Gaps = 12/120 (10%)

Query: 161 GMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPK--KKEEMNALQQISVSFVGG 218
           G++   KG+  +  RQ+     +F     +   I  +  K  K +++ AL++I  S +GG
Sbjct: 160 GIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEKIMASAIGG 219

Query: 219 YLAGILCAAVSHPADVMVSKINSE-----RKANESMSVASKRIYQKIGFTGLWNGLMVRI 273
            L+     A + P +V+  ++ S+     R  N ++    K IYQ  G  GL+ G+  R+
Sbjct: 220 GLS-----AWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVTPRV 274

>Kwal_27.12599
          Length = 304

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 68/164 (41%), Gaps = 16/164 (9%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYF 97
           P D  K RLQ +    T+ ++  +K++ NEG +  Y G     VG     + ++G  E  
Sbjct: 44  PFDTTKVRLQTS-TTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAM 102

Query: 98  KHLY-SSWLSPGVTVYLMASATAEFLADI----MLCPFEAIKVKQQT-----TMPPFCNN 147
           K  +  S   P  T+ L       F+  +    +  P E ++++ QT     T+  F   
Sbjct: 103 KRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEF-KG 161

Query: 148 VVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIV 191
            +D   K+ A      A  +G+ P   R+       F ++E +V
Sbjct: 162 PLDCINKLRANG----ALMRGLSPTILREAQGCATYFLTYEALV 201

 Score = 32.3 bits (72), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 4/65 (6%)

Query: 35  SITPLDLVKCRLQV----NPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGK 90
           ++ PLD++K  +Q     NP    + +Q  R + A  GWK  + GFG T +  +      
Sbjct: 233 TVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGAT 292

Query: 91  YGGYE 95
           +  +E
Sbjct: 293 FATFE 297

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 72/196 (36%), Gaps = 22/196 (11%)

Query: 112 YLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVP 171
           +LM   +A  +A     P E +K+  Q          +D   K   +     A ++GIV 
Sbjct: 17  FLMGGVSAA-IAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGIVS 75

Query: 172 LW-------CRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGIL 224
            W        R  P     F        KI S+L   +E     +  + +   G  AG L
Sbjct: 76  FWRGNTANVLRYFPTQALNFA----FKDKIKSLLSYDRERDGYAKWFAGNLFSGGAAGGL 131

Query: 225 C---------AAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVM 275
                     A     AD   SK  S+R+ N  + V  K+  +  G  GL+ G +  ++ 
Sbjct: 132 SLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDV-YKKTLKTDGLLGLYRGFVPSVLG 190

Query: 276 IGTLTSFQWLIYDSFK 291
           I       + +YDSFK
Sbjct: 191 IIVYRGLYFGLYDSFK 206

 Score = 32.0 bits (71), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 4/67 (5%)

Query: 16  EFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKL---YTSNLQGFRKIIANEGWKKV 72
            F A+  LG +I  G + +S  PLD V+ R+ +       Y   L   RKI+  EG   +
Sbjct: 217 SFVASFLLGWVITMGASTASY-PLDTVRRRMMMTSGQTIKYDGALDCLRKIVQKEGAYSL 275

Query: 73  YTGFGAT 79
           + G GA 
Sbjct: 276 FKGCGAN 282

>Scas_721.27
          Length = 374

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 65/165 (39%), Gaps = 33/165 (20%)

Query: 38  PLDLVKCRLQV------------------NPKLYTSNLQG---FRK---IIAN----EGW 69
           P DLVK RLQ                   N K+  S +Q    F++   I+ N    EG+
Sbjct: 72  PFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYKREGF 131

Query: 70  KKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT---VYLMASATAEFLADIM 126
           + ++ G G   VG     +  +  Y   K +YS   + G     ++LM++ATA +     
Sbjct: 132 RSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQETPLIHLMSAATAGWATSTA 191

Query: 127 LCPFEAIKVKQQTTMPPFCNNVVDGWK--KMYAESGGMKAFYKGI 169
             P   IK + Q           + W   K   +S G+   Y+G+
Sbjct: 192 TNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRGL 236

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 16  EFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKL---YTSNLQGFRKIIANEGWKKV 72
            F A+  LG  +  G + +S  PLD V+ R+ +       Y      FRKI+A EG K +
Sbjct: 213 SFIASFLLGWAVTTGASTASY-PLDTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGVKSL 271

Query: 73  YTGFGATFVGYSLQGAG 89
           + G GA  +   + GAG
Sbjct: 272 FKGCGANIL-RGVAGAG 287

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 65/164 (39%), Gaps = 15/164 (9%)

Query: 137 QQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYS 196
           +Q ++    N +VD +K+  A S G+ +F++G      R  P     F        KI +
Sbjct: 45  KQGSLDRRYNGIVDCFKRT-AASEGVISFWRGNTANVIRYFPTQALNFA----FKDKIKA 99

Query: 197 VLPKKKEEMNALQQISVSFVGGYLAGILC---------AAVSHPADVMVSKINSERKANE 247
           +   +KE     +  + +   G  AG L          A     AD   +K   ER+ N 
Sbjct: 100 MFGFRKEVDGYAKWFAGNLASGGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNG 159

Query: 248 SMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFK 291
            + V  K +    G  GL+ G +  +V I       + +YDS K
Sbjct: 160 LVDVYKKTLASD-GIAGLYRGFLPSVVGIVVYRGLYFGMYDSLK 202

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 57/269 (21%), Positives = 115/269 (42%), Gaps = 26/269 (9%)

Query: 38  PLDLVKCRLQVNPKLYTSN---LQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGY 94
           P +  K RLQ+  +    +   L    +    +G   +Y G  A  VG + +   ++ G+
Sbjct: 30  PFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQGAGALYVGCPAFVVGNTCKAGVRFLGF 89

Query: 95  EYFKH-LYSSWLSPGVTVYLMASATAEFLADIM-LCPFEAIKV----KQQTTMPPFCNNV 148
           +  +  L     +      ++A   A  L  ++ + PFEA+K      +Q   P + +N 
Sbjct: 90  DALRRALQDERGALSGPRGMLAGLGAGLLESVLAVTPFEAVKTALIDDRQAARPRYQHNG 149

Query: 149 VDGWKKMYAESGGMKAFY---KGIVPLWCRQIPYTMCKFTSFEKIVQKI--YSVLPKKKE 203
             G  + YA             G+VP+  RQ      +F  + ++ Q +  Y+  P   +
Sbjct: 150 -RGAARNYALLLRELGLRGLYGGLVPVALRQASNQAVRFGCYTQLKQAVQRYAGTP-ADQ 207

Query: 204 EMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASKR-IYQKIGF 262
            + + Q    +F+ G L+GI+    + P D + +++ +   A    +V   R + ++ G 
Sbjct: 208 PLGSGQ----TFLVGALSGIVTVYATMPVDTVKTRMQALDAARYGSTVGCFRAVVREEGV 263

Query: 263 TGLWNGL---MVRIVMIGTL--TSFQWLI 286
             LW G    + R+V+ G +  T+++ L+
Sbjct: 264 RALWRGATPRLGRLVLSGGIVFTAYEKLL 292

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 35/181 (19%), Positives = 83/181 (45%), Gaps = 15/181 (8%)

Query: 113 LMASATAEFLADIMLCPFEAIKVKQQTTMPPFC--NNVVDGWKKMYAESGGMKAFYKGIV 170
           ++A + +  +A  +  P + +K+++Q  +      + ++  ++ +  E G ++A +KG V
Sbjct: 28  VVAGSVSGLVARSVTAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEG-VRALWKGNV 86

Query: 171 PLWCRQIPYTMCKFTSFEKIVQKIYSV-LPKKKEEMNALQQISVSFVGGYLAGILCAAVS 229
           P     + Y   +F ++  +     S  LP +            S   G LAG++ + ++
Sbjct: 87  PASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAH----------SLAVGALAGLVSSLLT 136

Query: 230 HPADVMVSKINSERKAN-ESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYD 288
           +P D++ +++ + R A+  S+   ++ I+   G  G + G    I      T   + IY+
Sbjct: 137 YPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRGGAWAIAATTLTTGLIFGIYE 196

Query: 289 S 289
           +
Sbjct: 197 T 197

 Score = 35.0 bits (79), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 51/118 (43%), Gaps = 7/118 (5%)

Query: 22  TLGGIIACGPTHSSITPLDLVKCRLQV---NPKLYTSNLQGFRKIIANEGWKKVYTGFGA 78
           ++ G++A     S   P+D VK R Q+   +   Y   L  FR +   EG + ++ G   
Sbjct: 32  SVSGLVA----RSVTAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVP 87

Query: 79  TFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVK 136
               Y L G+ ++G Y +     +S   P     L   A A  ++ ++  P + ++ +
Sbjct: 88  ASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTR 145

 Score = 31.2 bits (69), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 35/185 (18%), Positives = 74/185 (40%), Gaps = 20/185 (10%)

Query: 38  PLDLVKCRLQVNPKLYTSNLQGFRKII-ANEGWKKVYTGFGATFVGYSLQGAGKYGGYEY 96
           PLDL++ RL  N   +  +L+   ++I   EG    + G        +L     +G YE 
Sbjct: 138 PLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRGGAWAIAATTLTTGLIFGIYET 197

Query: 97  FKHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQT---------TMPPFCNN 147
                 ++  P +     AS TA  ++   + P + ++ + Q          T  P   +
Sbjct: 198 CTIAADTYGLPWLAA--AASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYS 255

Query: 148 VVDGWKKM-----YAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKK 202
            + G + +        + G+ + YKG+    C+  P T+     +++ ++ +    P + 
Sbjct: 256 ALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLE---PTRA 312

Query: 203 EEMNA 207
            ++ A
Sbjct: 313 PQLPA 317

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 72/177 (40%), Gaps = 24/177 (13%)

Query: 37  TPLDLVKCRLQVNPKL-----YTSNLQGFRKIIANEGWKKVYT--------GFGATFVGY 83
           TP++ V+ RLQ+  K      Y  +L   RK++      + +T        GFG  F  Y
Sbjct: 137 TPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLKQGALMRGFTATLMRTCHGFGIYFSTY 196

Query: 84  SLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTM-- 141
               A ++      K +    ++P       A + A + A  M  P + +K   Q+    
Sbjct: 197 EALIANQHK-----KGIPRKDIAPWKVCIFGAFSGACYWA--MAYPIDVVKSIMQSDRLV 249

Query: 142 -PPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSV 197
            P    NV    K +Y  + G +AF KG +P   R +P     F +FE  ++ +  V
Sbjct: 250 SPVHGTNVWQVAKSIYT-TRGKRAFIKGFMPAMLRSLPVNGATFATFEMTMRLLERV 305

>Scas_489.4
          Length = 297

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 75/174 (43%), Gaps = 21/174 (12%)

Query: 35  SITPLDLVKCRL-----QVNPKLYTSN----LQGFRKIIANEGWKKVYTGFGATFVGYSL 85
           ++TP + +K  L      + PK Y +N    L+ +  ++ ++G   +Y G     +  + 
Sbjct: 124 AVTPFEAIKTALIDDKQALKPK-YQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQAA 182

Query: 86  QGAGKYGGYEYFKHLYSSW--------LSPGVTVYLMASATAEFLADIMLCPFEAIKVKQ 137
             A + G Y   K +   +        LS G+T  + A +    +   M  P + +K + 
Sbjct: 183 NQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTM--PIDTVKTRM 240

Query: 138 QTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIV 191
           Q+       + V+ + K++ E G +K F+KG  P   R I      FT +E ++
Sbjct: 241 QSLDATKYTSTVNCFAKIFKEEG-LKTFWKGATPRLGRLILSGGIVFTIYENVL 293

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 35.4 bits (80), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 60/134 (44%), Gaps = 14/134 (10%)

Query: 147 NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMN 206
           N+    ++M  ++ G   F++G +P   RQ+  +  +FT++  + Q I    P  +    
Sbjct: 192 NIFTTVREM-VQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQMISPNKPLSE---- 246

Query: 207 ALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERK---ANESMSVASKRIYQKIGFT 263
                  +F  G  +     A++ P DV+ +++ S+        S++    R + + G T
Sbjct: 247 -----YYAFGIGVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCVY-RTFIEEGLT 300

Query: 264 GLWNGLMVRIVMIG 277
            LW G + R+  +G
Sbjct: 301 SLWKGWVPRLFKVG 314

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 2/65 (3%)

Query: 38  PLDLVKCRLQVNP--KLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYE 95
           P+D+VK R+Q      LY ++L    +    EG   ++ G+        L G   +G Y+
Sbjct: 266 PIDVVKTRMQSKYTWSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFKVGLSGGVSFGVYQ 325

Query: 96  YFKHL 100
           Y  +L
Sbjct: 326 YVDNL 330

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 33.9 bits (76), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 48/91 (52%), Gaps = 3/91 (3%)

Query: 207 ALQQISVSFVGGYLAGILCAAVSHPAD---VMVSKINSERKANESMSVASKRIYQKIGFT 263
           A Q+ S++F+ G +AG +   V  P +   +++   +S    N  +  A  ++Y++ G  
Sbjct: 7   AKQESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVA 66

Query: 264 GLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294
           GL+ G  +  V I   ++ Q+++Y+  K ++
Sbjct: 67  GLFRGNGLNCVRIFPYSAVQFVVYEWCKKHI 97

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 82/200 (41%), Gaps = 25/200 (12%)

Query: 112 YLMASATAEFLADIMLCPFEAIKVK--------QQTTMPPFCNNVVDGWKKMYAESGGMK 163
           +LM   +A  +A     P E +K+         +Q T+    + +VD +K+  A+  G+ 
Sbjct: 16  FLMGGVSAA-IAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRT-AKQEGLI 73

Query: 164 AFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGI 223
           +F++G      R  P     F +F+  ++ ++     KKEE    +  + +   G  AG 
Sbjct: 74  SFWRGNTANVIRYFPTQALNF-AFKDKIKLMFGF---KKEEGYG-KWFAGNLASGGAAGA 128

Query: 224 LC---------AAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIV 274
           L          A     AD   SK    R+ N  ++   K+  +  G  GL+ G M  +V
Sbjct: 129 LSLLFVYSLDFARTRLAADAKSSKKGGARQFN-GLTDVYKKTLKSDGIAGLYRGFMPSVV 187

Query: 275 MIGTLTSFQWLIYDSFKAYV 294
            I       + ++DS K  V
Sbjct: 188 GIVVYRGLYFGMFDSLKPLV 207

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 5/88 (5%)

Query: 16  EFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKL---YTSNLQGFRKIIANEGWKKV 72
            F A+  LG ++  G +  S  PLD V+ R+ +       Y   +   +KI+A+EG   +
Sbjct: 215 SFLASFLLGWVVTTGASTCSY-PLDTVRRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSL 273

Query: 73  YTGFGATFVGYSLQGAGKYGGYEYFKHL 100
           + G GA  +  S+ GAG    Y+  + +
Sbjct: 274 FKGCGANIL-RSVAGAGVISMYDQLQMI 300

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 33.5 bits (75), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 60/287 (20%), Positives = 127/287 (44%), Gaps = 27/287 (9%)

Query: 23  LGGIIACGPTHSSITPLDLVKCRLQVNP--KLYTSNLQGFRKIIANEGW-KKVYTGFGAT 79
           + G+ A   T  +  PLDL+K RLQ++   +  T+     R I   + W +++Y G G  
Sbjct: 13  ISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGLIRDIFERQQWGRELYRGLGVN 72

Query: 80  FVGYSLQGAGKYGGYEYFKHLYSSWL----SPGVT-------VYLMASATAEFLADIMLC 128
            +G S+  A  +G Y   K +    L    + G+         Y++A+ ++     ++  
Sbjct: 73  LLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGSSGIATAVLTN 132

Query: 129 PFEAIKVKQQTT--MPPFCNNVVDGWKKMYAESGGMKAFYKGIVP--LWCRQIPYTMCKF 184
           P   IK +   T    P+  +  DG  K+Y ++ G+ AF++G+VP  L   Q       +
Sbjct: 133 PIWVIKTRIMATSRAGPY-KSTFDGVYKLY-QTEGVLAFWRGVVPSLLGVSQGAIYFALY 190

Query: 185 TSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERK 244
            + +     ++S   K +  ++  + I ++ +    + ++     +P  ++ SK+  +  
Sbjct: 191 DTLK--FHYLHSSTDKAERRLSVSEIIGITCI----SKMISVTSVYPFQLLKSKLQ-DFG 243

Query: 245 ANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFK 291
           A   ++   + +Y + G  G + GL   ++     T   + +Y++ K
Sbjct: 244 APSGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYENIK 290

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 81/197 (41%), Gaps = 25/197 (12%)

Query: 112 YLMASATAEFLADIMLCPFEAIKVK--------QQTTMPPFCNNVVDGWKKMYAESGGMK 163
           +LM   +A  +A     P E +K+         +Q ++      +VD +++  A   G+ 
Sbjct: 15  FLMGGVSAA-VAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRT-ARQEGII 72

Query: 164 AFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGI 223
           +F++G      R  P     F +F+  ++ ++     KKEE  A +  + +   G +AG 
Sbjct: 73  SFWRGNTANVIRYFPTQALNF-AFKDQIKAMFGF---KKEEGYA-KWFAGNLASGGIAGG 127

Query: 224 LC---------AAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIV 274
           L          A     AD   SK   ER+ N  + V  K I    G  GL+ G +  ++
Sbjct: 128 LSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASD-GVAGLYRGFLPSVI 186

Query: 275 MIGTLTSFQWLIYDSFK 291
            I       + +YDS K
Sbjct: 187 GIVVYRGLYFGLYDSCK 203

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 31.6 bits (70), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 77/197 (39%), Gaps = 25/197 (12%)

Query: 112 YLMASATAEFLADIMLCPFEAIKVK--------QQTTMPPFCNNVVDGWKKMYAESGGMK 163
           +LM   +A  +A     P E +K+         +Q T+      ++D +K+  A   G+ 
Sbjct: 27  FLMGGVSAA-VAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRT-ATQEGVI 84

Query: 164 AFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGI 223
           +F++G      R  P     F        KI ++   KKEE  A +  + +   G  AG 
Sbjct: 85  SFWRGNTANVIRYFPTQALNFA----FKDKIKAMFGFKKEEGYA-KWFAGNLASGGAAGA 139

Query: 224 LC---------AAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIV 274
           L          A     AD   SK    R+ N  + V  K+  +  G  GL+ G +  +V
Sbjct: 140 LSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDV-YKKTLKSDGVAGLYRGFLPSVV 198

Query: 275 MIGTLTSFQWLIYDSFK 291
            I       + +YDS K
Sbjct: 199 GIVVYRGLYFGMYDSLK 215

>Scas_718.24
          Length = 337

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 5/88 (5%)

Query: 16  EFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKL---YTSNLQGFRKIIANEGWKKV 72
            F A+  LG ++  G +  S  PLD V+ ++ +       Y      F+KI+A EG   +
Sbjct: 245 SFLASFLLGWVVTTGASTCSY-PLDTVRRKMMMTSGQAVKYKGAFDCFKKIVAAEGVASL 303

Query: 73  YTGFGATFVGYSLQGAGKYGGYEYFKHL 100
           + G GA  +   + GAG    Y+  + +
Sbjct: 304 FKGCGANIL-RGVAGAGVISMYDQLQMI 330

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 77/197 (39%), Gaps = 25/197 (12%)

Query: 112 YLMASATAEFLADIMLCPFEAIKVK--------QQTTMPPFCNNVVDGWKKMYAESGGMK 163
           +LM   +A  +A     P E +K+         +Q T+      +VD +++  A+  G+ 
Sbjct: 46  FLMGGVSAA-VAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDCFRRT-AQQEGII 103

Query: 164 AFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGI 223
           +F++G      R  P     F   +KI      ++   K+E    +  + +   G  AG 
Sbjct: 104 SFWRGNTANVIRYFPTQALNFAFKDKI-----KLMFGFKKEDGYGKWFAGNLASGGAAGG 158

Query: 224 LC---------AAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIV 274
           L          A     AD   SK    R+ N  + V  K+  +  G  GL+ G +  +V
Sbjct: 159 LSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDV-YKKTLKSDGVAGLYRGFLPSVV 217

Query: 275 MIGTLTSFQWLIYDSFK 291
            I       + +YDS K
Sbjct: 218 GIIVYRGLYFGLYDSIK 234

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 28.1 bits (61), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query: 38  PLDLVKCRLQVN----PKLYTSNLQGFRKIIANEGWKKVYTGFGATFV 81
           PLD++K  +Q +    PK   + L   R IIA +G   ++ GF  T +
Sbjct: 235 PLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTML 282

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.136    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,364,743
Number of extensions: 375065
Number of successful extensions: 1689
Number of sequences better than 10.0: 200
Number of HSP's gapped: 1294
Number of HSP's successfully gapped: 377
Length of query: 296
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 195
Effective length of database: 13,099,691
Effective search space: 2554439745
Effective search space used: 2554439745
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)