Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER052C (HOM3)52751827710.0
Scas_715.4452851723140.0
CAGL0J02882g53051723030.0
Sklu_2260.352351320330.0
Kwal_47.1816352249920070.0
KLLA0F27599g52251319550.0
ADL086C55250419130.0
Scas_34.1*2392408171e-107
YDL010W23150800.072
Kwal_55.2020111752750.12
CAGL0H01441g42740790.15
Sklu_2395.979585750.49
CAGL0D03894g485101740.52
YHR033W42340740.62
YML112W (CTK3)29652730.67
AAL061C42046720.96
ADL237C75685721.1
Scas_588.1442340711.2
Scas_670.1058351673.9
KLLA0C10296g41840664.5
YBL086C46690665.7
Kwal_23.494373673666.3
Kwal_55.2197345549649.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER052C
         (518 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate ...  1071   0.0  
Scas_715.44                                                           895   0.0  
CAGL0J02882g complement(277395..278987) highly similar to sp|P10...   891   0.0  
Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement        787   0.0  
Kwal_47.18163                                                         777   0.0  
KLLA0F27599g 2558178..2559746 highly similar to sp|P10869 Saccha...   757   0.0  
ADL086C [1655] [Homologous to ScYER052C (HOM3) - SH] (533181..53...   741   0.0  
Scas_34.1*                                                            319   e-107
YDL010W (YDL010W) [848] chr4 (432327..433022) Protein predicted ...    35   0.072
Kwal_55.20201                                                          33   0.12 
CAGL0H01441g complement(140740..142023) highly similar to sp|P32...    35   0.15 
Sklu_2395.9 YIL107C, Contig c2395 14041-16428                          33   0.49 
CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces c...    33   0.52 
YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with simi...    33   0.62 
YML112W (CTK3) [3859] chr13 (45063..45953) C-terminal domain (RN...    33   0.67 
AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - ...    32   0.96 
ADL237C [1504] [Homologous to ScYIL107C (PFK26) - SH] (287076..2...    32   1.1  
Scas_588.14                                                            32   1.2  
Scas_670.10                                                            30   3.9  
KLLA0C10296g 883644..884900 highly similar to sp|P32264 Saccharo...    30   4.5  
YBL086C (YBL086C) [115] chr2 complement(61199..62599) Protein of...    30   5.7  
Kwal_23.4943                                                           30   6.3  
Kwal_55.21973                                                          29   9.8  

>YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate
           kinase (L-aspartate 4-P-transferase), catalyzes the
           first step in the common pathway for methionine and
           threonine biosynthesis [1584 bp, 527 aa]
          Length = 527

 Score = 1071 bits (2771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/518 (100%), Positives = 518/518 (100%)

Query: 1   MPMDFQPTSSHSNWVVQKFGGTSVGKFPVQIVDDIVKHYSKPDGPNNNVAVVCSARSSYT 60
           MPMDFQPTSSHSNWVVQKFGGTSVGKFPVQIVDDIVKHYSKPDGPNNNVAVVCSARSSYT
Sbjct: 1   MPMDFQPTSSHSNWVVQKFGGTSVGKFPVQIVDDIVKHYSKPDGPNNNVAVVCSARSSYT 60

Query: 61  KAEGTTSRLLKCCDLASQESEFQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELEL 120
           KAEGTTSRLLKCCDLASQESEFQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELEL
Sbjct: 61  KAEGTTSRLLKCCDLASQESEFQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELEL 120

Query: 121 VKKYLNASKVLGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSA 180
           VKKYLNASKVLGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSA
Sbjct: 121 VKKYLNASKVLGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSA 180

Query: 181 SALDNSFYTFLVQALKEKLAPFVSAKERIVPVFTGFFGLVPTGLLNGVGRGYTDLCAALI 240
           SALDNSFYTFLVQALKEKLAPFVSAKERIVPVFTGFFGLVPTGLLNGVGRGYTDLCAALI
Sbjct: 181 SALDNSFYTFLVQALKEKLAPFVSAKERIVPVFTGFFGLVPTGLLNGVGRGYTDLCAALI 240

Query: 241 AVAVNADELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQVI 300
           AVAVNADELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQVI
Sbjct: 241 AVAVNADELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQVI 300

Query: 301 RAKIPIRIKNVQNPLGNGTIIYPDNVAKKGESTPPHPPENLSSSFYEKRKRGATAITTKN 360
           RAKIPIRIKNVQNPLGNGTIIYPDNVAKKGESTPPHPPENLSSSFYEKRKRGATAITTKN
Sbjct: 301 RAKIPIRIKNVQNPLGNGTIIYPDNVAKKGESTPPHPPENLSSSFYEKRKRGATAITTKN 360

Query: 361 DIFVINIHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSEVHVSMALPIPDADSLKSLRQ 420
           DIFVINIHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSEVHVSMALPIPDADSLKSLRQ
Sbjct: 361 DIFVINIHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSEVHVSMALPIPDADSLKSLRQ 420

Query: 421 AEEKLRILGSVDITKKLSIVSLVGKHMKQYIGIAGTMFTTLAEEGINIEMISQGANEINI 480
           AEEKLRILGSVDITKKLSIVSLVGKHMKQYIGIAGTMFTTLAEEGINIEMISQGANEINI
Sbjct: 421 AEEKLRILGSVDITKKLSIVSLVGKHMKQYIGIAGTMFTTLAEEGINIEMISQGANEINI 480

Query: 481 SCVINESDSIKALQCIHAKLLSERTNTSNQFEHAIDER 518
           SCVINESDSIKALQCIHAKLLSERTNTSNQFEHAIDER
Sbjct: 481 SCVINESDSIKALQCIHAKLLSERTNTSNQFEHAIDER 518

>Scas_715.44
          Length = 528

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/517 (83%), Positives = 470/517 (90%), Gaps = 7/517 (1%)

Query: 9   SSHSNWVVQKFGGTSVGKFPVQIVDDIVKHYSKPDGP--NNNVAVVCSARSSYTKAEGTT 66
           S  SNWVVQKFGGTSVGKFPVQIVDDI+K YS P     NNNVAVVCSARSSYTKAEGTT
Sbjct: 3   SPPSNWVVQKFGGTSVGKFPVQIVDDIIKFYSDPSNKTYNNNVAVVCSARSSYTKAEGTT 62

Query: 67  SRLLKCCDLASQESEFQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELELVKKYLN 126
           SRLL+CCDLASQE EF DIIEVI+ DHIDNA+R++ +P LQ KL+ DT KEL LVKKYL+
Sbjct: 63  SRLLRCCDLASQEMEFNDIIEVIKADHIDNAERYVQDPVLQTKLIADTTKELTLVKKYLD 122

Query: 127 ASKVLGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSASALDNS 186
           ASK+LGEVS+RT+DLVMS GEKLSCLFMTAL NDRGCKAKYVDL+HIVPSD++A+ LDNS
Sbjct: 123 ASKILGEVSTRTIDLVMSVGEKLSCLFMTALLNDRGCKAKYVDLTHIVPSDYNATVLDNS 182

Query: 187 FYTFLVQALKEKLAPFVSAKERIVPVFTGFFGLVPTGLLNGVGRGYTDLCAALIAVAVNA 246
           FYTFL QA KEKL PF+ +KER++PVFTGFFGLVP GLLNGVGRGYTDLCAALIAVAVNA
Sbjct: 183 FYTFLFQAFKEKLQPFIESKERVIPVFTGFFGLVPMGLLNGVGRGYTDLCAALIAVAVNA 242

Query: 247 DELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRAKIPI 306
           DELQVWKEVDGIFTADPRKVP+ARLL SVTPEEASELTYYGSEVIHPFTMEQVI+AKIPI
Sbjct: 243 DELQVWKEVDGIFTADPRKVPQARLLASVTPEEASELTYYGSEVIHPFTMEQVIQAKIPI 302

Query: 307 RIKNVQNPLGNGTIIYPDNVAKKGESTPPHPPENLSSSFYEKRKRGATAITTKNDIFVIN 366
           RIKNVQNP G GTIIYPDN+AKKGESTPPHPPE LSSSF+E+RKRGATAITTKNDI VIN
Sbjct: 303 RIKNVQNPRGEGTIIYPDNIAKKGESTPPHPPETLSSSFFERRKRGATAITTKNDIVVIN 362

Query: 367 IHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSEVHVSMALPIPDADSLKSLRQAEEKLR 426
           IHSNKKTLSHGFLAQIFTILDK+KLVVDLISTSEVHVSMALPIPD++S KSLRQA EKLR
Sbjct: 363 IHSNKKTLSHGFLAQIFTILDKFKLVVDLISTSEVHVSMALPIPDSESHKSLRQAVEKLR 422

Query: 427 ILGSVDITKKLSIVSLVGKHMKQYIGIAGTMFTTLAEEGINIEMISQGANEINISCVINE 486
           +LG VD+TKK++IVSLVGK MKQ+IGIAGTMFTTLAE+GINIEMISQGANEINISCVI+E
Sbjct: 423 VLGHVDVTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCVIDE 482

Query: 487 SDSIKALQCIHAKLL-----SERTNTSNQFEHAIDER 518
           +DS+KALQ IHAKLL     S    T+  FEHAI+ER
Sbjct: 483 TDSLKALQSIHAKLLDAHEASLEEMTTGNFEHAINER 519

>CAGL0J02882g complement(277395..278987) highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3, hypothetical
           start
          Length = 530

 Score =  891 bits (2303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/517 (83%), Positives = 473/517 (91%), Gaps = 6/517 (1%)

Query: 8   TSSHSNWVVQKFGGTSVGKFPVQIVDDIVKHYS--KPDGP-NNNVAVVCSARSSYTKAEG 64
           TS+ SNWVVQKFGGTSVGKFPVQIVD+IVK+YS  K DG  +N+VAVVCSARSSYTK EG
Sbjct: 5   TSATSNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGGFDNDVAVVCSARSSYTKQEG 64

Query: 65  TTSRLLKCCDLASQESEFQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELELVKKY 124
           TTSRLLKCCDLASQ+ E+ DIIE IRQDH+ NA+RF+ +  L AKL+DDTNKEL LV KY
Sbjct: 65  TTSRLLKCCDLASQDQEYSDIIETIRQDHVSNAERFLEDSPLVAKLIDDTNKELALVDKY 124

Query: 125 LNASKVLGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSASALD 184
           L+ASKVLGEVS+RT+DLVMSCGEKLSCLF+TALCNDRGCKAKYVDLS++VPSD+  + LD
Sbjct: 125 LSASKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSDYQTTTLD 184

Query: 185 NSFYTFLVQALKEKLAPFVSAKERIVPVFTGFFGLVPTGLLNGVGRGYTDLCAALIAVAV 244
            SFYTFLVQALKEKL PFV++KERIVPVFTGFFG +P GLLNGVGRGYTDLCAALIAVA+
Sbjct: 185 TSFYTFLVQALKEKLEPFVNSKERIVPVFTGFFGFIPMGLLNGVGRGYTDLCAALIAVAL 244

Query: 245 NADELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRAKI 304
           NADELQVWKEVDGIFTADPRKVP+ARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRAKI
Sbjct: 245 NADELQVWKEVDGIFTADPRKVPQARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRAKI 304

Query: 305 PIRIKNVQNPLGNGTIIYPDNVAKKGESTPPHPPENLSSSFYEKRKRGATAITTKNDIFV 364
           PIRIKNVQNP GNGTIIYPDNVAKKGESTPPHPPE LSS+F+EK++RGATAITTKNDI V
Sbjct: 305 PIRIKNVQNPKGNGTIIYPDNVAKKGESTPPHPPEALSSTFFEKKRRGATAITTKNDIVV 364

Query: 365 INIHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSEVHVSMALPIPDADSLKSLRQAEEK 424
           +N+HSNKKTLSHGFLAQIFT+LDKYKLVVDLISTSEVHVSMALPIPD+DS+K+LR A EK
Sbjct: 365 LNVHSNKKTLSHGFLAQIFTVLDKYKLVVDLISTSEVHVSMALPIPDSDSMKALRSAVEK 424

Query: 425 LRILGSVDITKKLSIVSLVGKHMKQYIGIAGTMFTTLAEEGINIEMISQGANEINISCVI 484
           L+ LGSVDI KK+SIVSLVGK MKQ+IGIAGTMFTTLAE+GINIEMISQGANEINISCVI
Sbjct: 425 LKPLGSVDIIKKMSIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCVI 484

Query: 485 NESDSIKALQCIHAKLLS---ERTNTSNQFEHAIDER 518
           +E DSIKALQ IH KLL    E  + S QFE A+DER
Sbjct: 485 DEMDSIKALQSIHKKLLDELPENGSGSEQFEKAVDER 521

>Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement
          Length = 523

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/513 (75%), Positives = 440/513 (85%), Gaps = 9/513 (1%)

Query: 12  SNWVVQKFGGTSVGKFPVQIVDDIVKHYSKPDGPNNNVAVVCSARSSYTKAEGTTSRLLK 71
           SNW+VQKFGGTSVGKFP QIV+ IVK Y+      NNVAVVCSARSSYTKAEGTTSRLL 
Sbjct: 5   SNWIVQKFGGTSVGKFPEQIVEQIVKVYTTQ--YENNVAVVCSARSSYTKAEGTTSRLLN 62

Query: 72  CCDLASQ-ESEFQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELELVKKYLNASKV 130
            C+LA+  +  F D+++++R DH+ NA   I +  LQ KLV DTN EL+LV+KYL+AS++
Sbjct: 63  ACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKYLSASQI 122

Query: 131 LGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSA--SALDNSFY 188
           LGEVSSRT+DLVMSCGEKLSCLFM ALCND G  A+YVDLS +VP+D+     +LDN+FY
Sbjct: 123 LGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGSLDNNFY 182

Query: 189 TFLVQALKEKLAPFV---SAKERIVPVFTGFFGLVPTGLLNGVGRGYTDLCAALIAVAVN 245
           TFLV A KE L P +   S  + +VPV TGFFGLVP GLLNGVGRGYTDLCAALIAV +N
Sbjct: 183 TFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVGLN 242

Query: 246 ADELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRAKIP 305
           ADELQVWKEVDGIFTADPRKVP+ARLL SVTPEEASELTYYGSEVIHPFTMEQVIRAKIP
Sbjct: 243 ADELQVWKEVDGIFTADPRKVPQARLLSSVTPEEASELTYYGSEVIHPFTMEQVIRAKIP 302

Query: 306 IRIKNVQNPLGNGTIIYPDNVAKKGESTPPHPPENLSSSFYEKRKRGATAITTKNDIFVI 365
           IRIKNVQNP G GT+IYPDN+AKKGESTPPHPP  L+SSF+E ++RGATAITTKNDI V+
Sbjct: 303 IRIKNVQNPTGEGTVIYPDNIAKKGESTPPHPPVTLTSSFFETKRRGATAITTKNDIVVL 362

Query: 366 NIHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSEVHVSMALPIPDADSLKSLRQAEEKL 425
           NIHSNKKTLSHGFLAQIF++LDKYKLVVDLISTSEVHVSMALP+PDA+S ++L+ A E+L
Sbjct: 363 NIHSNKKTLSHGFLAQIFSVLDKYKLVVDLISTSEVHVSMALPVPDAESSRALKSAVEEL 422

Query: 426 RILGSVDITKKLSIVSLVGKHMKQYIGIAGTMFTTLAEEGINIEMISQGANEINISCVIN 485
             LGS+D+TKK++IVSLVGK MKQ+IGIAGTMFTTLAE+ INIEMISQGANEINISCVI+
Sbjct: 423 NRLGSIDLTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQNINIEMISQGANEINISCVID 482

Query: 486 ESDSIKALQCIHAKLLSERTNTSNQFEHAIDER 518
           E DSIKALQ IHAKLL E +  S  FEHA++ER
Sbjct: 483 EQDSIKALQSIHAKLLDENSG-SLDFEHAVNER 514

>Kwal_47.18163
          Length = 522

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/499 (75%), Positives = 435/499 (87%), Gaps = 8/499 (1%)

Query: 9   SSHSNWVVQKFGGTSVGKFPVQIVDDIVKHYSKPDGPNNNVAVVCSARSSYTKAEGTTSR 68
           SS +NW+VQKFGGTSVGKFP QIV++IVK Y+      NNVAVVCSARSS TKAEGTTSR
Sbjct: 2   SSQTNWIVQKFGGTSVGKFPEQIVNEIVKVYTTK--YKNNVAVVCSARSSDTKAEGTTSR 59

Query: 69  LLKCCDLA-SQESEFQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELELVKKYLNA 127
           LL+ CDL  + +  F D+++ +R DHI NA + I +P LQ KL+ DTN EL+LV+KYLNA
Sbjct: 60  LLRACDLVCNSDPAFADVLQKVRDDHISNAKQRITSPDLQQKLIHDTNAELDLVEKYLNA 119

Query: 128 SKVLGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSA--SALDN 185
           S+VLGEVS RT+DLVMSCGEKLSCLFM ALCN+ G +A+YVDLS ++P D+      LD 
Sbjct: 120 SQVLGEVSLRTMDLVMSCGEKLSCLFMAALCNEYGVRAQYVDLSSVIPHDYECRQGTLDT 179

Query: 186 SFYTFLVQALKEKLAPFVSAKER---IVPVFTGFFGLVPTGLLNGVGRGYTDLCAALIAV 242
           SFYTFLV+A KEKLAP + A  +   +VPV TGFFGLVP GLLNGVGRGYTDLCAALIAV
Sbjct: 180 SFYTFLVRAFKEKLAPVLEAHSQGTPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAV 239

Query: 243 AVNADELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRA 302
            +NADELQVWKEVDGIFTADPRKVP+ARLL SVTPEEASELTYYGSEVIHPFTMEQVIRA
Sbjct: 240 GLNADELQVWKEVDGIFTADPRKVPQARLLGSVTPEEASELTYYGSEVIHPFTMEQVIRA 299

Query: 303 KIPIRIKNVQNPLGNGTIIYPDNVAKKGESTPPHPPENLSSSFYEKRKRGATAITTKNDI 362
           KIPIRIKNVQNP G+GT+IYPDN+AKKGESTPPHPP  LS+SF+E++KRGATAIT+K+DI
Sbjct: 300 KIPIRIKNVQNPTGDGTVIYPDNIAKKGESTPPHPPVTLSNSFFEQKKRGATAITSKSDI 359

Query: 363 FVINIHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSEVHVSMALPIPDADSLKSLRQAE 422
            V++IHSNKKTLSHGFLAQIFT LDKYKLVVDLISTSEVHVSMALP+PD DS K+L++A 
Sbjct: 360 VVVSIHSNKKTLSHGFLAQIFTTLDKYKLVVDLISTSEVHVSMALPVPDVDSSKALKKAV 419

Query: 423 EKLRILGSVDITKKLSIVSLVGKHMKQYIGIAGTMFTTLAEEGINIEMISQGANEINISC 482
           E+L++LG+V++TKKL IVSLVGK MKQ+IGIAGTMFTTLAE+GINIEMISQGANEINISC
Sbjct: 420 EELKVLGAVELTKKLVIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISC 479

Query: 483 VINESDSIKALQCIHAKLL 501
           VI+E D++KALQ IH+KLL
Sbjct: 480 VIDEEDALKALQSIHSKLL 498

>KLLA0F27599g 2558178..2559746 highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3 L-aspartate
           4-P-transferase singleton, start by similarity
          Length = 522

 Score =  757 bits (1955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/513 (70%), Positives = 440/513 (85%), Gaps = 10/513 (1%)

Query: 12  SNWVVQKFGGTSVGKFPVQIVDDIVKHYSKPDGPNNNVAVVCSARSSYTKAEGTTSRLLK 71
           SNWVVQKFGGTS+GKF  QIV++I+K YS+    +NNVAVVCSARSSYTKAEGTTSRLL 
Sbjct: 5   SNWVVQKFGGTSIGKFSKQIVNEIIKVYSQE--YDNNVAVVCSARSSYTKAEGTTSRLLL 62

Query: 72  CCDLASQES-EFQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELELVKKYLNASKV 130
            CDLAS  + E++++++++ +DH+ NA+  + +  +Q  L++DT +E+ +V++YL+AS+V
Sbjct: 63  ACDLASNNNYEYKNVLDLVERDHVANAEESVKDITIQETLIEDTKREINIVRRYLDASQV 122

Query: 131 LGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSA--SALDNSFY 188
           LGEVS+RT+DLVMS GEKLSCL++TALC D G  A+YVDLS IVPSD+      LDNSFY
Sbjct: 123 LGEVSTRTLDLVMSLGEKLSCLYVTALCQDNGVNARYVDLSFIVPSDYECKEGTLDNSFY 182

Query: 189 TFLVQALKEKLAPFVSAKE---RIVPVFTGFFGLVPTGLLNGVGRGYTDLCAALIAVAVN 245
           TFLV A +EKL+P +   E   +I+PV TGFFG+VP GLLNGVGRGYTDLCAALIAVA+N
Sbjct: 183 TFLVTAFREKLSPILKETENGTKIIPVITGFFGVVPMGLLNGVGRGYTDLCAALIAVALN 242

Query: 246 ADELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRAKIP 305
           ADELQVWKEVDGIFTADPRKVP+ARLLD+VTP+EA+ELTYYGSEVIHPFTMEQVIR  IP
Sbjct: 243 ADELQVWKEVDGIFTADPRKVPQARLLDTVTPDEAAELTYYGSEVIHPFTMEQVIRTHIP 302

Query: 306 IRIKNVQNPLGNGTIIYPDNVAKKGESTPPHPPENLSSSFYEKRKRGATAITTKNDIFVI 365
           IRIKNVQNP GNGTIIYP + AKKGESTPPHPP  L+SS +E +K+GATAITTK+DI V+
Sbjct: 303 IRIKNVQNPKGNGTIIYPSDQAKKGESTPPHPPVALTSSIFESKKKGATAITTKSDIVVV 362

Query: 366 NIHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSEVHVSMALPIPDADSLKSLRQAEEKL 425
           NIHSNKKTLSHGFLA++F+ LDKYKLVVDLISTSEVHVSMALP+PD+DSLK+LR A E+L
Sbjct: 363 NIHSNKKTLSHGFLAEMFSTLDKYKLVVDLISTSEVHVSMALPVPDSDSLKALRCAVEEL 422

Query: 426 RILGSVDITKKLSIVSLVGKHMKQYIGIAGTMFTTLAEEGINIEMISQGANEINISCVIN 485
           + LG+VD+ KK++IVSLVGK MKQ++GIAGTMFTTLAE+ INIEMISQGANEINISCVI+
Sbjct: 423 KRLGTVDVIKKMAIVSLVGKQMKQFVGIAGTMFTTLAEQHINIEMISQGANEINISCVID 482

Query: 486 ESDSIKALQCIHAKLLSERTNTSNQFEHAIDER 518
           ES++++ALQ IHAKLL    N    FE A++ER
Sbjct: 483 ESNAVRALQSIHAKLLDSPQN--ENFESAVNER 513

>ADL086C [1655] [Homologous to ScYER052C (HOM3) - SH]
           (533181..534839) [1659 bp, 552 aa]
          Length = 552

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/504 (73%), Positives = 431/504 (85%), Gaps = 8/504 (1%)

Query: 12  SNWVVQKFGGTSVGKFPVQIVDDIVKHYSKPDGPNNNVAVVCSARSSYTKAEGTTSRLLK 71
           +NWVVQKFGGTS+GKFP  IV+DIVK +S   G   NVAVVCSARSSYTK+EGTTSRLL 
Sbjct: 34  TNWVVQKFGGTSIGKFPTNIVNDIVKVFSHDYG--KNVAVVCSARSSYTKSEGTTSRLLM 91

Query: 72  CCDLASQESE-FQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELELVKKYLNASKV 130
            CD A+   E FQDI+ VIR+DH++NA   I +  ++ +LV+ TN EL+ V++YL AS++
Sbjct: 92  ACDAAASYDETFQDIVRVIREDHVENASHHIKDAEIRVRLVEQTNDELDQVERYLQASQI 151

Query: 131 LGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSAS--ALDNSFY 188
           LGEVS+RT+DLVMS GEKLSCLF+TALC D G  A+YVD S IVP+DF  +  +LDNSFY
Sbjct: 152 LGEVSNRTMDLVMSVGEKLSCLFLTALCEDCGVTAEYVDFSSIVPTDFRCAEGSLDNSFY 211

Query: 189 TFLVQALKEKLAPFVSAKE---RIVPVFTGFFGLVPTGLLNGVGRGYTDLCAALIAVAVN 245
             LV A KE+LA  V A +   RIVPV TGFFGL+P GLLNGVGRGYTDLCAAL+AVA+N
Sbjct: 212 ALLVVAFKERLAQIVQANKEGKRIVPVITGFFGLLPMGLLNGVGRGYTDLCAALVAVALN 271

Query: 246 ADELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRAKIP 305
           ADELQVWKEVDGIFTADPRKVP+ARLL++VTPEEA+ELTYYGSEVIHPFTMEQVIRAKIP
Sbjct: 272 ADELQVWKEVDGIFTADPRKVPQARLLETVTPEEAAELTYYGSEVIHPFTMEQVIRAKIP 331

Query: 306 IRIKNVQNPLGNGTIIYPDNVAKKGESTPPHPPENLSSSFYEKRKRGATAITTKNDIFVI 365
           IRIKNVQNP G+GT+IY DN+AKKGESTPPHPP ++SSSF+E+RKRGATAITTKNDI V+
Sbjct: 332 IRIKNVQNPTGDGTVIYADNIAKKGESTPPHPPISVSSSFFEQRKRGATAITTKNDIVVL 391

Query: 366 NIHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSEVHVSMALPIPDADSLKSLRQAEEKL 425
           NIHSNKKTLSHGFLAQIFTILD YKL+VDLISTSEVHVSMALP+PD+DS +SLR A E+L
Sbjct: 392 NIHSNKKTLSHGFLAQIFTILDNYKLIVDLISTSEVHVSMALPVPDSDSQRSLRNAVEEL 451

Query: 426 RILGSVDITKKLSIVSLVGKHMKQYIGIAGTMFTTLAEEGINIEMISQGANEINISCVIN 485
           + LG+VD+ KK++IVSLVGK MK +IGIAG MFTTL+E+ INIEMISQGANEINISCVI+
Sbjct: 452 KKLGTVDLIKKMAIVSLVGKQMKHFIGIAGAMFTTLSEQNINIEMISQGANEINISCVID 511

Query: 486 ESDSIKALQCIHAKLLSERTNTSN 509
           E +S++ALQ IHAKLL     TS+
Sbjct: 512 EKNSVRALQSIHAKLLEPLAPTSS 535

>Scas_34.1*
          Length = 239

 Score =  319 bits (817), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 160/240 (66%), Positives = 188/240 (78%), Gaps = 7/240 (2%)

Query: 66  TSRLLKCCDLASQ-ESEFQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELELVKKY 124
           TSRLL  C+LA+  +  F D+++++R DH+ NA   I +  LQ KLV DTN EL+LV+KY
Sbjct: 1   TSRLLNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKY 60

Query: 125 LNASKVLGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSA--SA 182
           L+AS++LGEVSSRT+DLVMSCGEKLSCLFM ALCND G  A+YVDLS +VP+D+     +
Sbjct: 61  LSASQILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGS 120

Query: 183 LDNSFYTFLVQALKEKLAPFV---SAKERIVPVFTGFFGLVPTGLLNGVGRGYTDLCAAL 239
           LDN+FYTFLV A KE L P +   S  + +VPV TGFFGLVP GLLNGVGRGYTDLCAAL
Sbjct: 121 LDNNFYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAAL 180

Query: 240 IAVAVNADELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQV 299
           IAV +NADELQVWKEVDGIFTADPR+  +   L SVTPE A  LTYYGS VIHPFTMEQV
Sbjct: 181 IAVGLNADELQVWKEVDGIFTADPRRFLKQDCLSSVTPERAL-LTYYGSGVIHPFTMEQV 239

>YDL010W (YDL010W) [848] chr4 (432327..433022) Protein predicted to
           have structural similarity to disulfide oxidoreductases
           [696 bp, 231 aa]
          Length = 231

 Score = 35.4 bits (80), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 218 GLVPTGLLNGVGRGYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVP 267
           G VP  L+NGV RG  +    L       + LQVW   DG F+ + R+ P
Sbjct: 181 GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--DGKFSVEQREKP 228

>Kwal_55.20201
          Length = 117

 Score = 33.5 bits (75), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%)

Query: 106 LQAKLVDDTNKELELVKKYLNASKVLGEVSSRTVDLVMSCGEKLSCLFMTAL 157
           L  K ++   +EL+ VKKY+N +K LG+   +  D+     E+   L  +AL
Sbjct: 4   LNVKDLEPVKQELDRVKKYMNLAKQLGQKDEKKTDIEKEEQERAKKLIHSAL 55

>CAGL0H01441g complement(140740..142023) highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, hypothetical start
          Length = 427

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 26/40 (65%)

Query: 231 GYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPEAR 270
           G  D  +A+ A  ++AD L +  +VD ++TADPR  P+A+
Sbjct: 154 GDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRSDPDAK 193

>Sklu_2395.9 YIL107C, Contig c2395 14041-16428
          Length = 795

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 6/85 (7%)

Query: 125 LNASKVLGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSASALD 184
            +A+    +   R +D + S   ++  LF+ ++C+DR    K + L    P D+      
Sbjct: 280 FDATNSTRQRRKRVLDKIHSRNSQIKILFLESICSDRATVEKNIQLKLFGP-DYKGKDPS 338

Query: 185 NSFYTFLVQALKEKLAPFVSAKERI 209
            S     +Q  KE+LA +++A E I
Sbjct: 339 VS-----LQDFKERLANYLTAYEPI 358

>CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces
           cerevisiae YDR300c PRO1 or sp|P38690 Saccharomyces
           cerevisiae YHR033w, hypothetical start
          Length = 485

 Score = 33.1 bits (74), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 48/101 (47%), Gaps = 19/101 (18%)

Query: 188 YTFLVQALKEKLAPFVSAKERIVPVFTGF------------FGLVP------TGLLNGVG 229
           ++ L Q   EK+A  +  +  I+  +T +             G+VP      T  ++ + 
Sbjct: 86  WSMLFQQYGEKIAQILITRNDILG-WTQYKNAQNTILQLLEMGVVPIVNENDTLSISEIK 144

Query: 230 RGYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPEAR 270
            G  D  +A+ A  V+AD L +  +VD ++T +PR  P+A+
Sbjct: 145 FGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTNPDAK 185

>YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with
           similarity to Pro1p [1272 bp, 423 aa]
          Length = 423

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%)

Query: 231 GYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPEAR 270
           G  D  +A+ A  V AD L +  +VD ++T +PR  P+AR
Sbjct: 148 GDNDTLSAITAALVGADFLFLLTDVDCLYTDNPRTNPDAR 187

>YML112W (CTK3) [3859] chr13 (45063..45953) C-terminal domain (RNA
           polymerase II CTD) kinase gamma subunit, associates with
           Ctk1p and Ctk2p [891 bp, 296 aa]
          Length = 296

 Score = 32.7 bits (73), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 126 NASKVLGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSD 177
           N +KVL EV    +DLV      L C    +L N   CK  ++DLS ++  D
Sbjct: 101 NVTKVLNEVLLMDIDLVFELC--LPCQDWKSLTNQATCKELFLDLSKLIHYD 150

>AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - SH]
           (239518..240780) [1263 bp, 420 aa]
          Length = 420

 Score = 32.3 bits (72), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 28/46 (60%)

Query: 225 LNGVGRGYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPEAR 270
           ++GV  G  D  +A+ A  + AD L +  +VD ++T +PR  P+A+
Sbjct: 145 ISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRTNPDAK 190

>ADL237C [1504] [Homologous to ScYIL107C (PFK26) - SH]
           (287076..289346) [2271 bp, 756 aa]
          Length = 756

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 6/85 (7%)

Query: 125 LNASKVLGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSASALD 184
            +A+    E   +  D + S   +L+ LF+ ++C+DR    K + L  + P D+     +
Sbjct: 255 FDATNSTQERRRKIYDKIKSRNSQLNVLFLESICSDRQTVEKNIRLKLLGP-DYKGKDPE 313

Query: 185 NSFYTFLVQALKEKLAPFVSAKERI 209
            S   F     K++LA +V A E +
Sbjct: 314 LSLRDF-----KDRLANYVRAYEAV 333

>Scas_588.14
          Length = 423

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%)

Query: 231 GYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPEAR 270
           G  D  +A+ +  V AD L +  +VD ++T +PR  PEA+
Sbjct: 150 GDNDTLSAITSALVGADYLFLLTDVDCLYTDNPRTNPEAK 189

>Scas_670.10
          Length = 583

 Score = 30.4 bits (67), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 32/51 (62%), Gaps = 3/51 (5%)

Query: 383 FTILDKYKLVVDLISTSEVHVSMA---LPIPDADSLKSLRQAEEKLRILGS 430
           F  L   KL + + S+ ++HVSMA   +P+P+  +L S R+  E+ +I+G+
Sbjct: 423 FEDLYNNKLKLSIQSSHKLHVSMAFFHIPLPEYLNLDSKRRPNEQNQIVGT 473

>KLLA0C10296g 883644..884900 highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, start by similarity
          Length = 418

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 231 GYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPEAR 270
           G  D  +A+ A    AD L +  +VD ++T +PR  P+A+
Sbjct: 148 GDNDTLSAITAALTGADYLFLLTDVDCLYTDNPRANPDAK 187

>YBL086C (YBL086C) [115] chr2 complement(61199..62599) Protein of
           unknown function, has weak similarity to uncharacterized
           C. albicans Orf6.6002p [1401 bp, 466 aa]
          Length = 466

 Score = 30.0 bits (66), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 18/90 (20%)

Query: 47  NNVAVVCSARSSYTKAEGTTSRLLKCCDLASQESEFQDIIEVIRQDHIDNADRFIL---- 102
           N  A+  +  +SY++ + T   LL   D+        DI E +++D     +RF+L    
Sbjct: 136 NATALTATGNNSYSQ-KITGKLLLGTVDI--------DITEYVKEDETPTTNRFLLKHSK 186

Query: 103 -----NPALQAKLVDDTNKELELVKKYLNA 127
                N +LQ KLV  + ++  + K + N 
Sbjct: 187 VNSIINVSLQLKLVRGSYEDFNISKSFTNG 216

>Kwal_23.4943
          Length = 736

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 36/73 (49%), Gaps = 6/73 (8%)

Query: 137 RTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSASALDNSFYTFLVQALK 196
           + +D + S   ++  LF+ ++C+D+    K + L    P D+     + S     +Q  K
Sbjct: 260 KVLDKIYSRNNQIKVLFLESVCSDKATVEKNIKLKLFGP-DYKGKDPETS-----LQDFK 313

Query: 197 EKLAPFVSAKERI 209
           E+L+ ++ A E +
Sbjct: 314 ERLSNYMKAYEPV 326

>Kwal_55.21973
          Length = 455

 Score = 29.3 bits (64), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%)

Query: 329 KGESTPPHPPENLSSSFYEKRKRGATAITTKNDIFVINIHSNKKTLSHG 377
           K +   PHPP  L   FY ++K+    +T K D+   + H N    S G
Sbjct: 6   KRQHLDPHPPR-LQCEFYLEKKKRRCGMTRKQDVAYCSEHFNLLQQSSG 53

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,818,311
Number of extensions: 723780
Number of successful extensions: 2338
Number of sequences better than 10.0: 34
Number of HSP's gapped: 2358
Number of HSP's successfully gapped: 35
Length of query: 518
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 412
Effective length of database: 12,926,601
Effective search space: 5325759612
Effective search space used: 5325759612
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)