Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER051W49248426100.0
Sklu_2260.147748812421e-168
Kwal_47.1815546547911991e-162
KLLA0F27643g47848811341e-152
ADL088W48647010181e-134
CAGL0J02860g4034089931e-131
AAR003W580118790.13
KLLA0F12804g580117711.2
AFR480C855114711.3
KLLA0D04488g29638682.4
Kwal_14.85457063682.5
ACR115W34837682.6
AER133C99766682.8
CAGL0J02970g44878683.0
YBR094W75388683.2
YGL237C (HAP2)26555663.4
Kwal_0.289578117656.5
YKR029C (SET3)75132657.2
CAGL0M02585g36046638.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER051W
         (484 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER051W (YER051W) [1479] chr5 (254655..256133) Protein containin...  1009   0.0  
Sklu_2260.1 YER051W, Contig c2260 321-1754                            483   e-168
Kwal_47.18155                                                         466   e-162
KLLA0F27643g complement(2561213..2562649) similar to sp|P40034 S...   441   e-152
ADL088W [1653] [Homologous to ScYER051W - SH] complement(530548....   396   e-134
CAGL0J02860g 276002..277213 similar to sp|P40034 Saccharomyces c...   387   e-131
AAR003W [189] [Homologous to NOHBY] complement(342591..344333) [...    35   0.13 
KLLA0F12804g complement(1180909..1182651) similar to ca|CA0795|I...    32   1.2  
AFR480C [3672] [Homologous to ScYGR150C - SH] (1299430..1301997)...    32   1.3  
KLLA0D04488g complement(381861..382751) similar to sp|P36060 Sac...    31   2.4  
Kwal_14.854                                                            31   2.5  
ACR115W [1162] [Homologous to ScYPL138C (SPP1) - SH] complement(...    31   2.6  
AER133C [2637] [Homologous to ScYML065W (ORC1) - SH; ScYLR442C (...    31   2.8  
CAGL0J02970g complement(284370..285716) similar to sp|P39525 Sac...    31   3.0  
YBR094W (YBR094W) [285] chr2 (431993..434254) Member of the tubu...    31   3.2  
YGL237C (HAP2) [1762] chr7 complement(52731..53528) Component (w...    30   3.4  
Kwal_0.289                                                             30   6.5  
YKR029C (SET3) [3284] chr11 complement(497220..499475) Component...    30   7.2  
CAGL0M02585g complement(297048..298130) similar to tr|Q03012 Sac...    29   8.8  

>YER051W (YER051W) [1479] chr5 (254655..256133) Protein containing a
           PHD-finger, which may be involved in chromatin-mediated
           transcriptional regulation, and a Jumonji (jmjC) domain,
           has low similarity to uncharacterized C. albicans
           Orf6.8281p [1479 bp, 492 aa]
          Length = 492

 Score = 1009 bits (2610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/484 (100%), Positives = 484/484 (100%)

Query: 1   MQDPNICQHCQLKDNPGALIWVKCDSCPQWVHVKCVPLKRIHYSNLTSSEVLSYPNSAKQ 60
           MQDPNICQHCQLKDNPGALIWVKCDSCPQWVHVKCVPLKRIHYSNLTSSEVLSYPNSAKQ
Sbjct: 1   MQDPNICQHCQLKDNPGALIWVKCDSCPQWVHVKCVPLKRIHYSNLTSSEVLSYPNSAKQ 60

Query: 61  IKSYRCPNHKEGEYLTAYALITQKGKRQRNKENPEDSHINKRYNFRKKKLLDYIALNEGE 120
           IKSYRCPNHKEGEYLTAYALITQKGKRQRNKENPEDSHINKRYNFRKKKLLDYIALNEGE
Sbjct: 61  IKSYRCPNHKEGEYLTAYALITQKGKRQRNKENPEDSHINKRYNFRKKKLLDYIALNEGE 120

Query: 121 SKRDKMNHPHKESFMKSFEKWKNGSNIINAADFAEKFDNIDVPYKIIDPLNSGVYVPNVG 180
           SKRDKMNHPHKESFMKSFEKWKNGSNIINAADFAEKFDNIDVPYKIIDPLNSGVYVPNVG
Sbjct: 121 SKRDKMNHPHKESFMKSFEKWKNGSNIINAADFAEKFDNIDVPYKIIDPLNSGVYVPNVG 180

Query: 181 TDNGCLTVNYITEMIGEDYHVDVMDVQSQMNENWNLGSWNEYFTNTEPDRRDRIRNVISL 240
           TDNGCLTVNYITEMIGEDYHVDVMDVQSQMNENWNLGSWNEYFTNTEPDRRDRIRNVISL
Sbjct: 181 TDNGCLTVNYITEMIGEDYHVDVMDVQSQMNENWNLGSWNEYFTNTEPDRRDRIRNVISL 240

Query: 241 EVSNIEGLELERPTAVRQNDLVDKIWSFNGHLEKVNGEKAEENDPKPKVTKYILMSVKDA 300
           EVSNIEGLELERPTAVRQNDLVDKIWSFNGHLEKVNGEKAEENDPKPKVTKYILMSVKDA
Sbjct: 241 EVSNIEGLELERPTAVRQNDLVDKIWSFNGHLEKVNGEKAEENDPKPKVTKYILMSVKDA 300

Query: 301 YTDFHLDFAGTSVYYNVISGQKKFLLFPPTQSNIDKYIEWSLKEDQNSVFLGDILEDGIA 360
           YTDFHLDFAGTSVYYNVISGQKKFLLFPPTQSNIDKYIEWSLKEDQNSVFLGDILEDGIA
Sbjct: 301 YTDFHLDFAGTSVYYNVISGQKKFLLFPPTQSNIDKYIEWSLKEDQNSVFLGDILEDGIA 360

Query: 361 MELDAGDLFMIPAGYIHAVYTPVDSLVFGGNFLTIRDLETHLKIVEIEKLTKVPRRFTFP 420
           MELDAGDLFMIPAGYIHAVYTPVDSLVFGGNFLTIRDLETHLKIVEIEKLTKVPRRFTFP
Sbjct: 361 MELDAGDLFMIPAGYIHAVYTPVDSLVFGGNFLTIRDLETHLKIVEIEKLTKVPRRFTFP 420

Query: 421 KFDQVMGKLCEYLALDKNKITSDVSDGDLLSRTTNCAIQSLHAYVIKPEVKYKPLNFTSK 480
           KFDQVMGKLCEYLALDKNKITSDVSDGDLLSRTTNCAIQSLHAYVIKPEVKYKPLNFTSK
Sbjct: 421 KFDQVMGKLCEYLALDKNKITSDVSDGDLLSRTTNCAIQSLHAYVIKPEVKYKPLNFTSK 480

Query: 481 KHLA 484
           KHLA
Sbjct: 481 KHLA 484

>Sklu_2260.1 YER051W, Contig c2260 321-1754
          Length = 477

 Score =  483 bits (1242), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 253/488 (51%), Positives = 336/488 (68%), Gaps = 40/488 (8%)

Query: 6   ICQHCQLKDNPGALIWVKCDSCPQWVHVKCVPLKRIHYSNLTSSEVLSYPNSAKQIKSYR 65
           IC +C   D+P   +WV+C+ CPQWVHV+CVPLK  H  N +   V ++P SA QI  + 
Sbjct: 5   ICSYCS-NDDPSKSLWVQCELCPQWVHVECVPLK--HLRNDSDDSVTTHPTSASQIVKFS 61

Query: 66  CPNHKEGEYLTAYALITQKGKRQRNKENPEDSHINKRYNFRKKKLLDYIALNEGESKRDK 125
           C NH  GE L    L  ++  R+R +++P  +  +K+Y  RKKK +DYIALNEGE +R K
Sbjct: 62  CENH--GEVL----LQVKQQARKRKQKDPPPTGNDKKYGLRKKKKIDYIALNEGEDRRLK 115

Query: 126 MNHPHKESFMKSFEKWKNGSNIINAADFAEKFDNIDVPYKIIDPLNSGVYVP-------- 177
             HPH  +F+K F+KW N +NII++      FD+I VP K+ DP NSG+ +P        
Sbjct: 116 DEHPHIPAFLKCFDKWSNTTNIISSESLEATFDSITVPLKVKDPENSGMKIPTVQELGRE 175

Query: 178 NVGTDNGCLTVNYITEMIGEDYHVDVMDVQSQMNENWNLGSWNEYFTNTEPDRRDRIRNV 237
           N+  ++  +TVN I  ++G+DY +DVMDVQ+Q N +W +  WN+YF+ T  ++RDRIRNV
Sbjct: 176 NMENESSKITVNDIARVLGDDYPLDVMDVQTQQNSDWTISQWNDYFSKTPTEQRDRIRNV 235

Query: 238 ISLEVSNIEGLE--LERPTAVRQNDLVDKIWSFNGHLEKVNGEKAEENDPKPKVTKYILM 295
           ISLEVS+++     + RPTAV  NDL D +W      E V  +K++   P+PKVTKYILM
Sbjct: 236 ISLEVSHVQQFRDGIRRPTAVEVNDLADLVW------EDVVDKKSDV--PRPKVTKYILM 287

Query: 296 SVKDAYTDFHLDFAGTSVYYNVISGQKKFLLFPPTQSNIDKYIEWSLKEDQNSVFLGDIL 355
           SV +AYTDFHLDFAGTSVYYNVISG+KKF+LFPPT  N+ +Y  W   + QN VFLGD+L
Sbjct: 288 SVGNAYTDFHLDFAGTSVYYNVISGKKKFILFPPTIHNLGQYKRWCDSDHQNLVFLGDML 347

Query: 356 EDGIAMELDAGDLFMIPAGYIHAVYTPVDSLVFGGNFLTIRDLETHLKIVEIEKLTKVPR 415
           EDG+AMEL++GDLFMIP GYIHAVYTP+DSLV GGNFLT+RD+ T LKIVEIE+LTKVP+
Sbjct: 348 EDGVAMELNSGDLFMIPCGYIHAVYTPIDSLVVGGNFLTLRDITTQLKIVEIERLTKVPK 407

Query: 416 RFTFPKFDQVMGKLCEYLALDKNKITSDVSDGDLLSRTTNCAIQSLHAYVIKPEVKYKPL 475
           RFTFP FD VMGK CE++   +  I  +              I++L +++  P+VKYKP+
Sbjct: 408 RFTFPHFDIVMGKTCEWVLKHRKAIPDE-------------HIKTLISHMSDPKVKYKPV 454

Query: 476 NFTSKKHL 483
           N+ +KK L
Sbjct: 455 NYRNKKEL 462

>Kwal_47.18155
          Length = 465

 Score =  466 bits (1199), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 238/479 (49%), Positives = 310/479 (64%), Gaps = 31/479 (6%)

Query: 7   CQHCQLKDNPGALIWVKCDSCPQWVHVKCVPLKRIHYSNLTSSEVLSYPNSAKQIKSYRC 66
           C +C   D P  L+WV+C+ C  WVHV CVP+K I   N       +YP  A QIK + C
Sbjct: 6   CAYCSSSD-PDKLLWVQCEVCDSWVHVTCVPIKDI--VNEMGEASKTYPQDADQIKRFSC 62

Query: 67  PNHKEGEYLTAYALITQKGKRQRNKENPEDSHINKRYNFRKKKLLDYIALNEGESKRDKM 126
             H         AL    G ++R   +       KR   RKKK +DYI+LNEG  +R K 
Sbjct: 63  AEHPYP------ALEINMGLKKRKLNSTMADLSAKRQGLRKKKQVDYISLNEGADRRLKN 116

Query: 127 NHPHKESFMKSFEKWKNGSNIINAADFAEKFDNIDVPYKIIDPLNSGVYVPNVGTDNGCL 186
            HPH  +F+  F +W+N +N+++  +  +KF++I VP KI DP NSG+ +P    D G  
Sbjct: 117 EHPHMHAFLACFSRWENKTNVMDCLELEDKFNSIKVPLKIKDPENSGMQIPK-DVDGGNF 175

Query: 187 TVNYITEMIGEDYHVDVMDVQSQMNENWNLGSWNEYFTNTEPDRRDRIRNVISLEVSNIE 246
           TV+ +T  +GEDY VDVMDVQSQ N  W +  WN+YF  T  + RDRIRNVISLEVS++E
Sbjct: 176 TVDTVTRFLGEDYRVDVMDVQSQQNSTWTMAEWNKYFMQTPIESRDRIRNVISLEVSHVE 235

Query: 247 GLE--LERPTAVRQNDLVDKIWSFNGHLEKVNGEKAEENDPKPKVTKYILMSVKDAYTDF 304
             +  L RP  V  ND+VD +W+              +N  +PKVTKYILMSV++AYTDF
Sbjct: 236 QFKSGLRRPRVVESNDVVDLLWN-----------AIPDNTVRPKVTKYILMSVQNAYTDF 284

Query: 305 HLDFAGTSVYYNVISGQKKFLLFPPTQSNIDKYIEWSLKEDQNSVFLGDILEDGIAMELD 364
           HLDFAGTSVYY VISG KKF+LFPPT  N+  Y +W   +DQN +FLGD LE+GIAM+L 
Sbjct: 285 HLDFAGTSVYYKVISGSKKFILFPPTPRNLAAYTQWCGNDDQNLIFLGDQLEEGIAMDLS 344

Query: 365 AGDLFMIPAGYIHAVYTPVDSLVFGGNFLTIRDLETHLKIVEIEKLTKVPRRFTFPKFDQ 424
           AGDLFMIP GYIHAVYTPVD+LV GGNFLT+RDL+T L IV+IEK+TKVP++FTFP+F+ 
Sbjct: 345 AGDLFMIPCGYIHAVYTPVDTLVIGGNFLTLRDLKTQLMIVDIEKVTKVPKKFTFPQFES 404

Query: 425 VMGKLCEYLALDKNKITSDVSDGDLLSRTTNCAIQSLHAYVIKPEVKYKPLNFTSKKHL 483
           VMGK CEY+      +  + +  DL     N   ++L  Y+  P+ KY+P+NF++K+ L
Sbjct: 405 VMGKTCEYI------VKKEANGIDL--GIKNEQKEALLHYIQDPKFKYRPVNFSTKRQL 455

>KLLA0F27643g complement(2561213..2562649) similar to sp|P40034
           Saccharomyces cerevisiae YER051w singleton, start by
           similarity
          Length = 478

 Score =  441 bits (1134), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 235/488 (48%), Positives = 312/488 (63%), Gaps = 42/488 (8%)

Query: 7   CQHCQLKD--NPGALIWVKCDSCPQWVHVKCVPLKRIHYSNLTSSEVLSYPNSAKQIKSY 64
           C  C+  D  + G  IWV C+ C  W H+ CVP++ +       S++L++    K ++S+
Sbjct: 8   CHFCKKDDSEDKGQPIWVGCEFCDGWCHLTCVPIQFVVPKLENPSQLLAF--KEKHVESF 65

Query: 65  RCPNHKEGEYLTAYALITQKGKRQRNKENPEDSHINKRYNFRKKKLLDYIALNEGESKRD 124
           +C  H E    +  AL+   G         ED    KR   R K+ +DYIALNEG  KR 
Sbjct: 66  KCTLHDE----SKCALLKLNGVSV----GTEDIAFTKRNRLRNKRPIDYIALNEGNDKRL 117

Query: 125 KMNHPHKESFMKSFEKWKNGSNIINAADFAEKFDNIDVPYKIIDPLNSGVYVPNV----- 179
           K  HPH ++F+  FEKWK+    I++++    F  I VP ++ DP +SG+YV +      
Sbjct: 118 KHEHPHTQAFLACFEKWKD-PKAISSSELESDFQIIKVPLRVSDPADSGMYVISANELGL 176

Query: 180 --GTDNGCLTVNYITEMIGEDYHVDVMDVQSQMNENWNLGSWNEYFTNTEPDRRDRIRNV 237
               D+  L V Y+T+++G+DY +DVMDVQ+QMNE W L  WNEY+++T P  RDRIRNV
Sbjct: 177 VDSKDHVKLNVEYLTKIMGDDYPLDVMDVQTQMNEKWTLSQWNEYYSHTSPSDRDRIRNV 236

Query: 238 ISLEVSNIEGLE--LERPTAVRQNDLVDKIWSFNGHLEKVNGEKAEENDPKPKVTKYILM 295
           ISLEVS++E  +  + RP AV  NDLVD +W+F          + E +  +PKVTKYILM
Sbjct: 237 ISLEVSHVESFKDGIRRPNAVNNNDLVDIVWNFG---------RTETDIERPKVTKYILM 287

Query: 296 SVKDAYTDFHLDFAGTSVYYNVISGQKKFLLFPPTQSNIDKYIEWSLKEDQNSVFLGDIL 355
           SV +AYTDFHLDFAGTSVYYNVISG KKF+LFPPT  N+ KY EW   ++QN +FLGD L
Sbjct: 288 SVGNAYTDFHLDFAGTSVYYNVISGSKKFILFPPTDYNLKKYREWCDNDNQNDIFLGDQL 347

Query: 356 EDGIAMELDAGDLFMIPAGYIHAVYTPVDSLVFGGNFLTIRDLETHLKIVEIEKLTKVPR 415
           E GIAMEL  G+LFMIP GYIHAVYTP DS + GGNFLT+RD+ T L +VEIE  TKVP+
Sbjct: 348 EAGIAMELTEGNLFMIPCGYIHAVYTPEDSFIVGGNFLTLRDITTQLNVVEIEHQTKVPK 407

Query: 416 RFTFPKFDQVMGKLCEYLALDKNKITSDVSDGDLLSRTTNCAIQSLHAYVIKPEVKYKPL 475
           +FTFP+F+ VMGK CE+L L+ + I S  S+           I++L  Y+    +KYKP+
Sbjct: 408 KFTFPQFESVMGKTCEWL-LNSDHIQSISSED----------IENLVKYLSSSNIKYKPI 456

Query: 476 NFTSKKHL 483
           N+ SKK L
Sbjct: 457 NYQSKKEL 464

>ADL088W [1653] [Homologous to ScYER051W - SH]
           complement(530548..532008) [1461 bp, 486 aa]
          Length = 486

 Score =  396 bits (1018), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 206/470 (43%), Positives = 284/470 (60%), Gaps = 48/470 (10%)

Query: 20  IWVKCDSCPQWVHVKCVPLKRIHYSNLTSSEVLSYPNSAKQIKSYRCPNHKEGEYLTAYA 79
           +WV+C++CPQWVHV+C+P +      L+  E   YP+ +  I ++ C  H      TA A
Sbjct: 42  MWVQCEACPQWVHVQCIPEE-----CLSGGE---YPSRSSDIAAFECSAHG-----TARA 88

Query: 80  LITQKGKRQR--NKENPEDSHINKRYNFRKKKLLDYIALNEGESKRDKMNHPHKESFMKS 137
            +  KGKR+R   KE PE +   +RY  RK+  LDYIALNEG+  R +  HPH+ +F   
Sbjct: 89  RLALKGKRRRVEAKEEPERAG-TRRYRLRKRGPLDYIALNEGQDVRLRHEHPHRAAFQGC 147

Query: 138 FEKWKNGSNIINAADFAEKFDNIDVPYKIIDPLNSGVYVPNVGTDNGCLTVNYITEMIGE 197
           F KW      + +A+  + F  +  P  + DP +SG+  P        +    + +++G 
Sbjct: 148 FTKWSGLGRTVTSAELQQSFAELREPVLVADPEHSGMQTP-------AMDEQVLADVLGA 200

Query: 198 DYHVDVMDVQSQMNENWNLGSWNEYFTNTEPDRRDRIRNVISLEVSNIE--GLELERPTA 255
           DY +DVMDVQSQ NE W +G W EY  +T    RDRIRNVISLEVS++   G  + RP A
Sbjct: 201 DYSLDVMDVQSQQNERWTMGQWKEYM-HTARGVRDRIRNVISLEVSHVPEFGQRIRRPRA 259

Query: 256 VRQNDLVDKIWSFNGHLEKVNGEKAEENDPKPKVTKYILMSVKDAYTDFHLDFAGTSVYY 315
           V  NDLVD +W           + A E   KPKV KY+LMS  +AYTDFHLDFAGTSVYY
Sbjct: 260 VEDNDLVDLVWPV---------QPAPEIGAKPKVQKYVLMSAANAYTDFHLDFAGTSVYY 310

Query: 316 NVISGQKKFLLFPPTQSNIDKYIEWSLKEDQNSVFLGDILEDGIAMELDAGDLFMIPAGY 375
           +++ G K+FLLFPPT +N+  Y  W   ++Q  +FLGD L+DG+   L  GDLFMIP+G+
Sbjct: 311 SLLRGAKQFLLFPPTPANLGAYKAWCADDNQGLIFLGDRLQDGVLFSLRPGDLFMIPSGF 370

Query: 376 IHAVYTPVDSLVFGGNFLTIRDLETHLKIVEIEKLTKVPRRFTFPKFDQVMGKLCEYLAL 435
           IHAVYTP DS V GGN+L +RDL TH++IV IE+ T+VP++FTFPKF++VMG   E+L  
Sbjct: 371 IHAVYTPEDSFVVGGNYLCLRDLSTHIRIVRIEQETQVPKKFTFPKFERVMGLTAEWLL- 429

Query: 436 DKNKITSDVSDG--DLLSRTTNCAIQSLHAYVIKPEVKYKPLNFTSKKHL 483
                     +G  + L   T+    +L  Y+    +KYKP ++ +K  +
Sbjct: 430 ----------EGLPERLQLITHEHAVALLDYLRDTRLKYKPAHYHTKSTM 469

>CAGL0J02860g 276002..277213 similar to sp|P40034 Saccharomyces
           cerevisiae YER051w, hypothetical start
          Length = 403

 Score =  387 bits (993), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 206/408 (50%), Positives = 271/408 (66%), Gaps = 23/408 (5%)

Query: 81  ITQKGKRQRNKENPEDSHINKRYNFRKKKLLDYIALNEGESKRDKMNHPHKESFMKSFEK 140
           I Q    +R+  + ++    KRYNFRKK  LDY ALNEGE K+ K  HPH   F K FEK
Sbjct: 5   IEQALGEKRSLNDNDEVPRKKRYNFRKKVELDYSALNEGEDKKSKFFHPHIALFEKEFEK 64

Query: 141 WKNGSNI-----INAADFAEKFDNIDVPYKIIDPLNSGVYVPNVGTDNGCLTVNYITEMI 195
               SN+     +  +++ ++FD+ID P KI DP NSG+ V         LTV+ IT+ +
Sbjct: 65  CL--SNVTEDMSMTCSEYCKRFDDIDFPLKISDPENSGMVVSTNNKTTRDLTVDDITQAV 122

Query: 196 GEDYHVDVMDVQSQMNENWNLGSWNEYFTNTEPDRRDRIRNVISLEVSNIEGLELERPTA 255
           G+DY V+VMDVQSQ NE W+L  W  YF N   + +DRIRNVISLEVS++E L+ +RP  
Sbjct: 123 GDDYFVNVMDVQSQENERWSLREWCNYF-NKPAEEKDRIRNVISLEVSHVEDLQYDRPDI 181

Query: 256 VRQNDLVDKIWSFNGHLEKVNGEKAEENDPKPKVTKYILMSVKDAYTDFHLDFAGTSVYY 315
           V   DLVD +W+   +L+        ENDP+PKVTKY LMSVK+A+TD+HLDFAGTSVYY
Sbjct: 182 VDDKDLVDIVWNNVENLDT-------ENDPRPKVTKYCLMSVKNAFTDYHLDFAGTSVYY 234

Query: 316 NVISGQKKFLLFPPTQSNIDKYIEWSLKEDQNSVFLGDILEDGIAMELDAGDLFMIPAGY 375
           N+  G+KKF+L+PPT  NI+ YIEWS    QN +FLG+ L  G+AMEL+ GDLFMIP+GY
Sbjct: 235 NLAFGKKKFILYPPTPENIENYIEWSTSTYQNMLFLGEKLTGGVAMELNGGDLFMIPSGY 294

Query: 376 IHAVYTPVDSLVFGGNFLTIRDLETHLKIVEIEKLTKVPRRFTFPKFDQVMGKLCEYLAL 435
           IH VYTP DSL+FGGN+LT RD+   LKIV++EK T V +R+TFP FD+VMG+ CE+L  
Sbjct: 295 IHVVYTPEDSLIFGGNYLTFRDISQQLKIVDVEKQTGVTKRYTFPMFDEVMGRTCEWLCQ 354

Query: 436 DKNKITSDVSDGDLLSRTTNCAIQSLHAYVIKPEVKYKPLNFTSKKHL 483
           ++ K       G  + +     +  L +Y+   + KYKP NF +KK +
Sbjct: 355 NQKK-------GKQM-QVKKETVNDLISYMKSGKTKYKPTNFINKKQM 394

>AAR003W [189] [Homologous to NOHBY] complement(342591..344333)
           [1743 bp, 580 aa]
          Length = 580

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 52/118 (44%), Gaps = 16/118 (13%)

Query: 291 KYILMSVKDAYTDFHLDFAGTSVYYNVISGQKKFLLFPPTQS----NIDK---------- 336
           ++++     + + FH D   TS +  V+SG K +++ PP  +    + DK          
Sbjct: 315 RWLIAGPARSGSTFHKDPNQTSAWNAVLSGMKLWVMLPPDVAPPGVSTDKEEEEVTSPVG 374

Query: 337 YIEWSLKEDQN-SVFLGDILEDGIAMELDAGDLFMIPAGYIHAVYTPVDSLVFGGNFL 393
             EW L    N +V L    +  I ++  A +   +PAG+ H V    DS+    NF+
Sbjct: 375 ITEWVLSGYYNDAVNLAQQGKCRIGVQF-ASECIYVPAGWWHTVINITDSVALTENFV 431

>KLLA0F12804g complement(1180909..1182651) similar to
           ca|CA0795|IPF15641 Candida albicans unknown function,
           start by similarity
          Length = 580

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 52/117 (44%), Gaps = 14/117 (11%)

Query: 291 KYILMSVKDAYTDFHLDFAGTSVYYNVISGQKKFLLFPPTQSNIDKYIEWSLKEDQNSVF 350
           ++++     + + FH D   TS +   +SG K +++ PP ++      +   +E  + V 
Sbjct: 317 RWLIAGPARSGSTFHKDPNHTSAWNTGLSGMKLWVMLPPGENPPGVMTDKEEEEVTSPVG 376

Query: 351 LGDILEDGI---AMELD-----------AGDLFMIPAGYIHAVYTPVDSLVFGGNFL 393
           + + +  G    A++L             G+   +P+G+ H+V    DS+    NF+
Sbjct: 377 IAEWIISGYYNDAVKLAQEGRCQICVTFPGECIYVPSGWWHSVINLTDSVALTENFV 433

>AFR480C [3672] [Homologous to ScYGR150C - SH] (1299430..1301997)
           [2568 bp, 855 aa]
          Length = 855

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 42/114 (36%), Gaps = 22/114 (19%)

Query: 232 DRIRNVISLEVSN-----IEGLELERPTAVRQNDLVDKIWSFNGHLEKVNGEKAEENDPK 286
           DRI  + S    N     +  L ++  T  R N L  ++W   G   K  G         
Sbjct: 713 DRILQIYSFAYKNRVYNDVFELAMKAATKFRDNSLATRVWKERGEFRKTEG--------- 763

Query: 287 PKVTKYILMSVKDAYTDFHLDFAGTSVYYNVISGQKKFLLFPPTQSNIDKYIEW 340
                Y  MSVKD        FA  +V + V   +K+F        +  KYI+W
Sbjct: 764 -----YTSMSVKDRIAG-DTSFACATVKFFV--AEKRFSEAMAVIMSSQKYIDW 809

>KLLA0D04488g complement(381861..382751) similar to sp|P36060
           Saccharomyces cerevisiae YKL150w MCR1 cytochrome-b5
           reductase, start by similarity
          Length = 296

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 2/38 (5%)

Query: 402 LKIVEIEKLTKVPRRFTF--PKFDQVMGKLCEYLALDK 437
           L I++IEKL+   +RFTF  PK DQV G +     L K
Sbjct: 52  LPIIKIEKLSHDTKRFTFALPKKDQVSGLITASCILAK 89

>Kwal_14.854
          Length = 570

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 141 WKNG--SNIINAADFAEKFDNIDVPYK--IIDPLNSGVYVP--NVGTDNGCLTVNYITEM 194
           W  G  S  +N  DF  +F N DV  +  ++  + +G+ V   N+G   G LT+  + +M
Sbjct: 83  WDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDM 142

Query: 195 IGE 197
            G 
Sbjct: 143 YGR 145

>ACR115W [1162] [Homologous to ScYPL138C (SPP1) - SH]
          complement(554695..555741) [1047 bp, 348 aa]
          Length = 348

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 2/37 (5%)

Query: 2  QDPNICQ--HCQLKDNPGALIWVKCDSCPQWVHVKCV 36
          QDP+  +  +C  K   G  + V+CD C  W H  C+
Sbjct: 36 QDPSTGEDVYCICKKPDGGELMVQCDGCGDWFHFTCI 72

>AER133C [2637] [Homologous to ScYML065W (ORC1) - SH; ScYLR442C
           (SIR3) - SH] (888958..891951) [2994 bp, 997 aa]
          Length = 997

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 6/66 (9%)

Query: 85  GKRQRNKENPEDSHINKRYNFRKKKLLDYIALNEGESKRDKMNHPHKESFMKSFEKWKNG 144
           GKR RNKEN E++   +R + R +K         G  KR     P KES + + ++    
Sbjct: 416 GKRGRNKENEEEADGAERRSSRARK------GTSGPQKRKASRSPTKESRLATPKRAITK 469

Query: 145 SNIINA 150
            N+  A
Sbjct: 470 KNVSRA 475

>CAGL0J02970g complement(284370..285716) similar to sp|P39525
           Saccharomyces cerevisiae YER061c CEM1, start by
           similarity
          Length = 448

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 4/78 (5%)

Query: 404 IVEIEKLTKVPRRFTFPKFDQVMGKLCEYLALDKNKITSDVSDGDLLSRTTNCAIQSLHA 463
           IV +E L    RR   P   +++G     L+ D + ITS  +DG+  SR    A+   H 
Sbjct: 263 IVVLESLESAERRGA-PILAEIVGY---GLSCDAHHITSPPNDGEGASRAIKMALDLSHG 318

Query: 464 YVIKPEVKYKPLNFTSKK 481
            V   +++Y   + TS K
Sbjct: 319 NVNARDIEYVNAHATSTK 336

>YBR094W (YBR094W) [285] chr2 (431993..434254) Member of the
           tubulin-tyrosine ligase family and the survival protein
           SurE family, which may be involved in stress response,
           has moderate similarity to uncharacterized C. albicans
           Orf6.7920p [2262 bp, 753 aa]
          Length = 753

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 16/88 (18%)

Query: 396 RDLETHLKIVEIEKLTKVPRRFTFPKFDQVMGKLCEYLALDKNKITSDVSDGDLLSRTTN 455
           R + T  +++E E ++  P + TF   + ++G+L         K+T + ++   LS+T N
Sbjct: 287 RTVLTDAEVIESEMISVTPMKATFKGVNHLLGEL---------KLTEEENN---LSKTNN 334

Query: 456 CAIQSLHAYVIKPEVKYKPLNFTSKKHL 483
             + S+       E  YKPL    KK+L
Sbjct: 335 LIVVSIDPM----EYIYKPLTHALKKYL 358

>YGL237C (HAP2) [1762] chr7 complement(52731..53528) Component (with
           Hap3p, Hap4p, and Hap5p) of heterotrimeric CCAAT-binding
           factor, has a highly conserved core region of 60 amino
           acids that possess all the essential functions [798 bp,
           265 aa]
          Length = 265

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 29/55 (52%)

Query: 48  SSEVLSYPNSAKQIKSYRCPNHKEGEYLTAYALITQKGKRQRNKENPEDSHINKR 102
           S E   Y + ++   + R P  + G +LTA  +   K K+    ++P+DSH +K+
Sbjct: 188 SRERKPYLHESRHKHAMRRPRGEGGRFLTAAEIKAMKSKKSGASDDPDDSHEDKK 242

>Kwal_0.289
          Length = 578

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 23/117 (19%), Positives = 48/117 (41%), Gaps = 14/117 (11%)

Query: 291 KYILMSVKDAYTDFHLDFAGTSVYYNVISGQKKFLLFPPTQSNIDKYIEWSLKEDQNSV- 349
           +++++    + + FH D   TS +   ++G+K +++ PP         +   +E  + V 
Sbjct: 311 RWLIVGPAGSGSTFHKDPNQTSAWNAGLTGKKLWIMLPPGVKPPGVSTDKDEEEVTSPVG 370

Query: 350 ----FLGDILEDGIAMELDA---------GDLFMIPAGYIHAVYTPVDSLVFGGNFL 393
                L     D + M  +          G+   +P+G+ H V    DS+    NF+
Sbjct: 371 VAEWILSGYYNDAVKMAQEGKCFITVTFPGECIYVPSGWWHTVINLTDSVALTENFV 427

>YKR029C (SET3) [3284] chr11 complement(497220..499475) Component of
           the Set3p complex with histone deacetylase activity that
           represses meiotic-specific sporulation gene expression,
           has similarity to E(z) Enhancer of zeste in the
           C-terminal domain, contains a PHD finger and a SET
           domain [2256 bp, 751 aa]
          Length = 751

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 2/32 (6%)

Query: 10  CQLKDNPGALIWVKCDSCPQWVHVKCVPLKRI 41
           C L D+ G  I  +CD C +W H  C  +K I
Sbjct: 122 CDLNDDDGFTI--QCDHCNRWQHAICYGIKDI 151

>CAGL0M02585g complement(297048..298130) similar to tr|Q03012
          Saccharomyces cerevisiae YPL138c, hypothetical start
          Length = 360

 Score = 28.9 bits (63), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 1/46 (2%)

Query: 9  HCQLKDNPGALIWVKCDSCPQWVHVKCVPLKRIHYSNLTSSEVLSY 54
          +C  K      + V CD C  W H +C+ +    Y NL  S +  Y
Sbjct: 26 YCICKKPDYGELMVGCDGCDDWFHFECMKIPET-YRNLVESFICPY 70

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,004,351
Number of extensions: 859781
Number of successful extensions: 2509
Number of sequences better than 10.0: 40
Number of HSP's gapped: 2528
Number of HSP's successfully gapped: 40
Length of query: 484
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 378
Effective length of database: 12,926,601
Effective search space: 4886255178
Effective search space used: 4886255178
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)