Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER050C (RSM18)2022009831e-137
Kwal_47.181531711173463e-41
CAGL0J02838g1601523183e-37
KLLA0E04477g155982941e-33
ADL117W1731042933e-33
Scas_715.27d1741312821e-31
Scas_720.5239142633.3
CAGL0D06446g190290624.3
Kwal_56.24217289105606.3
YPL045W (VPS16)79882599.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER050C
         (200 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER050C (RSM18) [1478] chr5 complement(253970..254578) Component...   383   e-137
Kwal_47.18153                                                         137   3e-41
CAGL0J02838g complement(275124..275606) similar to sp|P40033 Sac...   127   3e-37
KLLA0E04477g complement(409814..410281) some similarities with s...   117   1e-33
ADL117W [1624] [Homologous to ScYER050C (RSM18) - SH] complement...   117   3e-33
Scas_715.27d                                                          113   1e-31
Scas_720.52                                                            29   3.3  
CAGL0D06446g complement(608505..614213) similar to sp|P37297 Sac...    28   4.3  
Kwal_56.24217                                                          28   6.3  
YPL045W (VPS16) [5395] chr16 (467255..469651) Vacuolar sorting p...    27   9.7  

>YER050C (RSM18) [1478] chr5 complement(253970..254578) Component of
           the mitochondrial ribosomal small subunit [609 bp, 202
           aa]
          Length = 202

 Score =  383 bits (983), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 187/200 (93%), Positives = 187/200 (93%)

Query: 1   MFYYAFKLHCRVTCWXXXXXXXXXXXXXESIINSVTVLTKKARFYTKLRMFKMNATTGIK 60
           MFYYAFKLHCRVTCW             ESIINSVTVLTKKARFYTKLRMFKMNATTGIK
Sbjct: 1   MFYYAFKLHCRVTCWGKKYLGLLYILKYESIINSVTVLTKKARFYTKLRMFKMNATTGIK 60

Query: 61  IQNGMQPIIKGAVSSTFKRALYNFGIKEKKSVNIEMGRTQQTKKIDQSLSKKLPKGTIYD 120
           IQNGMQPIIKGAVSSTFKRALYNFGIKEKKSVNIEMGRTQQTKKIDQSLSKKLPKGTIYD
Sbjct: 61  IQNGMQPIIKGAVSSTFKRALYNFGIKEKKSVNIEMGRTQQTKKIDQSLSKKLPKGTIYD 120

Query: 121 PFDFSMGRIHLDRKYQANKNSNRNDIMKSGANPLEFYARPRILSRYVTSTGRIQHRDITG 180
           PFDFSMGRIHLDRKYQANKNSNRNDIMKSGANPLEFYARPRILSRYVTSTGRIQHRDITG
Sbjct: 121 PFDFSMGRIHLDRKYQANKNSNRNDIMKSGANPLEFYARPRILSRYVTSTGRIQHRDITG 180

Query: 181 LSAKNQRRLSKAIRRCQAIG 200
           LSAKNQRRLSKAIRRCQAIG
Sbjct: 181 LSAKNQRRLSKAIRRCQAIG 200

>Kwal_47.18153
          Length = 171

 Score =  137 bits (346), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 87/117 (74%), Gaps = 5/117 (4%)

Query: 88  EKKSVNI---EMGRT-QQTKKIDQSLSKKLPKGTIYDPFDFSMGRIHLDRKYQANKNSNR 143
           EK  +N+   E G +  Q KKID  L KK   GT YDPFDFS+ R+HLD+K+ ++KNS+ 
Sbjct: 36  EKSQINVKAKESGSSASQNKKIDPRLVKKFQSGTTYDPFDFSLARLHLDKKF-SSKNSSN 94

Query: 144 NDIMKSGANPLEFYARPRILSRYVTSTGRIQHRDITGLSAKNQRRLSKAIRRCQAIG 200
           +   K+G +PL+ Y  P  LS++VTS+G+I HRD+TGLSAKNQRRLSKAIRRCQAIG
Sbjct: 95  DLFEKNGVDPLDLYTNPEFLSQFVTSSGKILHRDVTGLSAKNQRRLSKAIRRCQAIG 151

>CAGL0J02838g complement(275124..275606) similar to sp|P40033
           Saccharomyces cerevisiae YER050c RSM18, hypothetical
           start
          Length = 160

 Score =  127 bits (318), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 93/152 (61%), Gaps = 6/152 (3%)

Query: 50  MFKMNATTGIKIQNGMQPIIKGAVSSTFKRALYNFGIKEKKSVNIEM-GRTQQTKKIDQS 108
           MF +    GI+  N     +   +    KR + +   K+K  ++++  G  +  K I+ +
Sbjct: 1   MFMVGRICGIESAN-----VAMGLRMVQKRGIVDMRPKKKSVIDVDFEGSRENIKTINAN 55

Query: 109 LSKKLPKGTIYDPFDFSMGRIHLDRKYQANKNSNRNDIMKSGANPLEFYARPRILSRYVT 168
              +  +  +YDPFDFS+ R++LDRK    K  + +   K G NPL FYARP ILS YV 
Sbjct: 56  FVPQFQRSAVYDPFDFSLSRLNLDRKMNRPKIQHHDLFEKYGLNPLNFYARPEILSYYVG 115

Query: 169 STGRIQHRDITGLSAKNQRRLSKAIRRCQAIG 200
           STG+I HRD+TGLSAKNQRR++KAIRRCQAIG
Sbjct: 116 STGKILHRDVTGLSAKNQRRMAKAIRRCQAIG 147

>KLLA0E04477g complement(409814..410281) some similarities with
           sp|P40033 Saccharomyces cerevisiae YER050c RSM18
           component of the mitochondrial ribosomal small subunit
           singleton, hypothetical start
          Length = 155

 Score =  117 bits (294), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 71/98 (72%), Gaps = 1/98 (1%)

Query: 103 KKIDQSLSKKLPKGTIYDPFDFSMGRIHLDRKYQANKNSNRNDIMKSGANPLEFYARPRI 162
           KK++  L K    G++Y+PFDFS+ RIHLD+K+     S  +   K   NPL+ Y  P  
Sbjct: 39  KKLESKLIKNFQPGSVYNPFDFSLERIHLDKKFGVRPGS-FDPFNKLKINPLDLYTNPEF 97

Query: 163 LSRYVTSTGRIQHRDITGLSAKNQRRLSKAIRRCQAIG 200
           LSR+VTSTG+I HRD+TGLSAKNQRRL+KAI+RCQAIG
Sbjct: 98  LSRFVTSTGKILHRDVTGLSAKNQRRLTKAIKRCQAIG 135

>ADL117W [1624] [Homologous to ScYER050C (RSM18) - SH]
           complement(480459..480980) [522 bp, 173 aa]
          Length = 173

 Score =  117 bits (293), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 77/104 (74%), Gaps = 3/104 (2%)

Query: 98  RTQQTKKIDQSLSKKLPKGTIYDPFDFSMGRIHLDRKYQANKNSNRNDIMKS-GANPLEF 156
           +  Q KK+   + KK   G++YDPFDFSM R+HL++K++  KN+ + DI +    +PL+ 
Sbjct: 52  KNDQVKKVPPEMMKKFATGSLYDPFDFSMARLHLEKKHR--KNARKVDIFEELNLDPLDL 109

Query: 157 YARPRILSRYVTSTGRIQHRDITGLSAKNQRRLSKAIRRCQAIG 200
           Y  P ILSR+V +TG+I HRD+TGLS ++Q+R+S+A+RRCQAIG
Sbjct: 110 YTSPAILSRFVGNTGKILHRDVTGLSVRSQKRMSRAVRRCQAIG 153

>Scas_715.27d
          Length = 174

 Score =  113 bits (282), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 57/131 (43%), Positives = 87/131 (66%), Gaps = 6/131 (4%)

Query: 70  KGAVSSTFKRALYNFGIKEKKSVNIEMGRTQQTKKIDQSLSKKLPKGTIYDPFDFSMGRI 129
           KG +  T K+   N  ++E ++   +       K ID+   KK  +G+IYDPFDFSM ++
Sbjct: 33  KGLLQPTIKK---NINLRESQA---KSKTNSSVKAIDEVFVKKFQQGSIYDPFDFSMAKV 86

Query: 130 HLDRKYQANKNSNRNDIMKSGANPLEFYARPRILSRYVTSTGRIQHRDITGLSAKNQRRL 189
           +LDRK ++   +++   +    NPL+ Y+ P  L+++++STG+I HRD+TGLSAKNQRRL
Sbjct: 87  NLDRKTKSLIGTSKTYNISYNINPLDLYSSPSELNKFISSTGKILHRDVTGLSAKNQRRL 146

Query: 190 SKAIRRCQAIG 200
           SKAI+R Q+IG
Sbjct: 147 SKAIKRAQSIG 157

>Scas_720.52
          Length = 391

 Score = 28.9 bits (63), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 137 ANKNSNRNDIMKSGANPLEFYARPRILSRYVTSTGRIQHRDI 178
            N+NS +N+  +    PL  Y   R LS Y++ T R++ R +
Sbjct: 13  GNRNSTKNERDEYTMKPLSLYKCRRYLSDYLSDTTRLRKRRV 54

>CAGL0D06446g complement(608505..614213) similar to sp|P37297
            Saccharomyces cerevisiae YLR305c STT4
            phosphatidylinositol-4-kinase, hypothetical start
          Length = 1902

 Score = 28.5 bits (62), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 44/90 (48%), Gaps = 3/90 (3%)

Query: 60   KIQNGMQPI--IKGAVSSTFKRALYNFGIKEKKSVNIEMGRTQQTKKIDQSLSKKLPKGT 117
            +IQ  + P+  I+GA S+     +          + + + +  Q+KK+DQ+L   + K  
Sbjct: 1337 QIQVWLTPLDKIQGANSNDLPLNMLQTAFDINPDLALNIAQRYQSKKLDQALVDMIIKEP 1396

Query: 118  IYDPFDFSMGRIHLDRKYQANKNSNRNDIM 147
            +      S   ++LD + + NKNS+ + I+
Sbjct: 1397 LKSVTTASALSLYLDER-RLNKNSDLHHIL 1425

>Kwal_56.24217
          Length = 289

 Score = 27.7 bits (60), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 45/105 (42%), Gaps = 9/105 (8%)

Query: 38  LTKKARFYTKLRMFKMNATT-GIKIQNGMQPIIKGAVSSTFKRALYNFGIKEKKSVNIEM 96
           L+ KARF  K+   K      G ++ NG    IK   S  F    YN GI+ ++ V +  
Sbjct: 6   LSNKARFRAKMPTVKAACVIIGDEVLNGK---IKDTNSGFFANYCYNLGIQLREIVTVGD 62

Query: 97  GRTQQTKKIDQSLSKKLPKGTIYDPFDFSMGRIHLDRKYQANKNS 141
            + Q  K I     K+L +   +      +G  H D  Y++  +S
Sbjct: 63  EKDQIAKTI-----KRLSQENDFIVTSGGIGPTHDDITYESVSSS 102

>YPL045W (VPS16) [5395] chr16 (467255..469651) Vacuolar sorting
           protein, mutant form exhibits pleiotropic defects in
           vacuolar morphology and vacuolar protein targeting [2397
           bp, 798 aa]
          Length = 798

 Score = 27.3 bits (59), Expect = 9.7,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 7/82 (8%)

Query: 57  TGIKIQNGMQPIIKGAVSSTFKRALYNFGIKEKKSVNIEMGRTQQTKKIDQSL----SKK 112
           T + +   +  +I+       K  +  F I EKK  +++     + KK D+ L    S+K
Sbjct: 652 TNMTLDQTLSKLIETGQDKQVKEIVKKFKISEKKLYHLKCKTLVEAKKFDELLQFAQSRK 711

Query: 113 LPKGTIYDPF-DFSMGRIHLDR 133
            P G  Y PF  +   R H+D+
Sbjct: 712 SPIG--YMPFYTYLKSRGHMDK 731

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,519,121
Number of extensions: 218348
Number of successful extensions: 615
Number of sequences better than 10.0: 17
Number of HSP's gapped: 612
Number of HSP's successfully gapped: 18
Length of query: 200
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 104
Effective length of database: 13,272,781
Effective search space: 1380369224
Effective search space used: 1380369224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)