Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER049W64463333800.0
CAGL0J02816g62563423980.0
Sklu_2174.463261823140.0
Kwal_47.1814562463321610.0
Scas_715.28*63263720460.0
ADL114C61461920440.0
KLLA0E04411g60061319790.0
KLLA0A07733g106464731.1
Kwal_34.15857471111711.8
Scas_638.2805143667.8
Scas_680.2978651668.1
Scas_716.1146472658.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER049W
         (633 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER049W (YER049W) [1477] chr5 (251727..253661) Component of NuA3...  1306   0.0  
CAGL0J02816g 272944..274821 highly similar to sp|P40032 Saccharo...   928   0.0  
Sklu_2174.4 YER049W, Contig c2174 3142-5040 reverse complement        895   0.0  
Kwal_47.18145                                                         837   0.0  
Scas_715.28*                                                          792   0.0  
ADL114C [1627] [Homologous to ScYER049W - SH] (484310..486154) [...   791   0.0  
KLLA0E04411g 404611..406413 similar to sp|P40032 Saccharomyces c...   766   0.0  
KLLA0A07733g complement(688856..692050) similar to sp|P15938 Sac...    33   1.1  
Kwal_34.15857                                                          32   1.8  
Scas_638.2                                                             30   7.8  
Scas_680.29                                                            30   8.1  
Scas_716.11                                                            30   8.2  

>YER049W (YER049W) [1477] chr5 (251727..253661) Component of NuA3
           histone acetyltransferase complex [1935 bp, 644 aa]
          Length = 644

 Score = 1306 bits (3380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 633/633 (100%), Positives = 633/633 (100%)

Query: 1   MKRKTAEVKGEKERNSKQISLEEDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHE 60
           MKRKTAEVKGEKERNSKQISLEEDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHE
Sbjct: 1   MKRKTAEVKGEKERNSKQISLEEDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHE 60

Query: 61  LVNDDLLRAVRKEIETEIHFTKKETDIYRVNQSGDLANLSGLDWDDLSRLPNLFKLRQIL 120
           LVNDDLLRAVRKEIETEIHFTKKETDIYRVNQSGDLANLSGLDWDDLSRLPNLFKLRQIL
Sbjct: 61  LVNDDLLRAVRKEIETEIHFTKKETDIYRVNQSGDLANLSGLDWDDLSRLPNLFKLRQIL 120

Query: 121 YSKQYRDFFGYVTKAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRK 180
           YSKQYRDFFGYVTKAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRK
Sbjct: 121 YSKQYRDFFGYVTKAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRK 180

Query: 181 WKSHYGGGLRLFPSILPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLS 240
           WKSHYGGGLRLFPSILPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLS
Sbjct: 181 WKSHYGGGLRLFPSILPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLS 240

Query: 241 IQGWYHIPQVGEEGYIPGEEEAWVRNNTSTLAQIESNVLEDFEFPKDERNILSFHEVKHF 300
           IQGWYHIPQVGEEGYIPGEEEAWVRNNTSTLAQIESNVLEDFEFPKDERNILSFHEVKHF
Sbjct: 241 IQGWYHIPQVGEEGYIPGEEEAWVRNNTSTLAQIESNVLEDFEFPKDERNILSFHEVKHF 300

Query: 301 EKMLKGDAGAKTDNTPKESMTSVISDSVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFV 360
           EKMLKGDAGAKTDNTPKESMTSVISDSVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFV
Sbjct: 301 EKMLKGDAGAKTDNTPKESMTSVISDSVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFV 360

Query: 361 ENSSLQIESFLNDDKSELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGK 420
           ENSSLQIESFLNDDKSELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGK
Sbjct: 361 ENSSLQIESFLNDDKSELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGK 420

Query: 421 EYRNFQTEADILEALNNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKS 480
           EYRNFQTEADILEALNNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKS
Sbjct: 421 EYRNFQTEADILEALNNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKS 480

Query: 481 TIFKKYLALLTSLCPVSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCL 540
           TIFKKYLALLTSLCPVSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCL
Sbjct: 481 TIFKKYLALLTSLCPVSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCL 540

Query: 541 TPSAGWESGELGGYELYMMDDDEDNKQYLKEDVEDASVYRADDSGDSVLINDPPAWNTFN 600
           TPSAGWESGELGGYELYMMDDDEDNKQYLKEDVEDASVYRADDSGDSVLINDPPAWNTFN
Sbjct: 541 TPSAGWESGELGGYELYMMDDDEDNKQYLKEDVEDASVYRADDSGDSVLINDPPAWNTFN 600

Query: 601 LVLRDESVLEFVKYVSWSAKSSRWDVKMKWDVK 633
           LVLRDESVLEFVKYVSWSAKSSRWDVKMKWDVK
Sbjct: 601 LVLRDESVLEFVKYVSWSAKSSRWDVKMKWDVK 633

>CAGL0J02816g 272944..274821 highly similar to sp|P40032
           Saccharomyces cerevisiae YER049w, start by similarity
          Length = 625

 Score =  928 bits (2398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/634 (70%), Positives = 529/634 (83%), Gaps = 17/634 (2%)

Query: 1   MKRKTAEVKGEKERNSKQISLEEDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHE 60
           MKRK AE +   E  +KQ+ LEEDK+KG+FN K+W   F++GLK +I+ S PYNWG I  
Sbjct: 1   MKRK-AEAQ---ENGNKQLDLEEDKVKGLFNQKLWTPEFREGLKNQIDSSAPYNWGNISG 56

Query: 61  LVNDDLLRAVRKEIETEIHFTKKETDIYRVNQSGDLANLSGLDWDDLSRLPNLFKLRQIL 120
           LVNDDLLRAVRKEIETEIHFTKKETDIY+VNQSGDLANLSGL+WDDLSRLPN++KLRQIL
Sbjct: 57  LVNDDLLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLSGLNWDDLSRLPNMYKLRQIL 116

Query: 121 YSKQYRDFFGYVTKAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRK 180
           YS  YRD  GYVT AGKLSGSK DMS+NTYTKGCHLLTHDDVIGSRRISFILYLPDPDRK
Sbjct: 117 YSDVYRDLIGYVTGAGKLSGSKMDMSVNTYTKGCHLLTHDDVIGSRRISFILYLPDPDRK 176

Query: 181 WKSHYGGGLRLFPSILPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLS 240
           WK  YGGGLRLF SILPN+P +DP AK VPQFN+IAFFKVLPGFSFHDVEEVKVDKHRLS
Sbjct: 177 WKPQYGGGLRLFSSILPNIPETDPCAKFVPQFNEIAFFKVLPGFSFHDVEEVKVDKHRLS 236

Query: 241 IQGWYHIPQVGEEGYIPGEEEAWVRNNTSTLAQIESNVLEDFEFPKDERNILSFHEVKHF 300
           IQGWYH PQ GE GY PG+EEAWV+NNTSTL Q+E+NVL+DFE+PK ER+IL +H+VKHF
Sbjct: 237 IQGWYHFPQPGEPGYTPGQEEAWVKNNTSTLTQLETNVLQDFEYPKQERDILPYHQVKHF 296

Query: 301 EKMLKGDAGAKTDNTPKESMTSVISDSVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFV 360
           EK+L    G K D   ++ + SV+ D+  LSE E+ YLSQYIS EHL+ +GI+KLQ+QF+
Sbjct: 297 EKVLYAADGKKID---EDEVKSVVQDTDSLSEKEYKYLSQYISAEHLTKEGIKKLQEQFL 353

Query: 361 ENSSLQIESFLNDDKSELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGK 420
           ENS+LQI+ FLN++ SELLKK+IK +ELE+ CPY +KDV+ PW+TA+P HK RY+YIDGK
Sbjct: 354 ENSTLQIKDFLNEEVSELLKKMIKTEELEKACPYMAKDVETPWQTAMPSHKWRYMYIDGK 413

Query: 421 EYRNFQTEADILEALNNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKS 480
             R     +DI+EALNN +LPNF+  ++ +          ++ + D EL LIDLA+F+KS
Sbjct: 414 NPRKLLKASDIMEALNNEELPNFELLRETL---------PKDGSVDVELKLIDLAIFYKS 464

Query: 481 TIFKKYLALLTSLCPVSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCL 540
           TIFKKYLALLT+LCP+SEQILIRRFRPG DFTLAT+CR NE L+    I+ ++L G LCL
Sbjct: 465 TIFKKYLALLTALCPLSEQILIRRFRPGNDFTLATQCRLNEFLQDVEGILPSILVGNLCL 524

Query: 541 TPSAGWESGELGGYELYMMDDDE-DNKQYLKEDVEDASVYRADDSGDSVLINDPPAWNTF 599
           TPS+GWESGE+GGYELYMMDD+  + ++ + +DVEDASVYR DD+GDSVL+N+PP+WNTF
Sbjct: 525 TPSSGWESGEVGGYELYMMDDENTEEEERMHKDVEDASVYRTDDNGDSVLVNNPPSWNTF 584

Query: 600 NLVLRDESVLEFVKYVSWSAKSSRWDVKMKWDVK 633
           NLVLRD+SVLEFVKYVS +AKSSRWDVKM+WDVK
Sbjct: 585 NLVLRDQSVLEFVKYVSCAAKSSRWDVKMEWDVK 618

>Sklu_2174.4 YER049W, Contig c2174 3142-5040 reverse complement
          Length = 632

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/618 (69%), Positives = 510/618 (82%), Gaps = 13/618 (2%)

Query: 16  SKQISLEEDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHELVNDDLLRAVRKEIE 75
           +KQ + EE K+K +FN KIWD  FQ  L++EI +S+PYNWGTI +L+NDDLLRAVRKEIE
Sbjct: 14  TKQQAGEESKVKPLFNSKIWDPEFQAALRQEIAESKPYNWGTIRDLINDDLLRAVRKEIE 73

Query: 76  TEIHFTKKETDIYRVNQSGDLANLSGLDWDDLSRLPNLFKLRQILYSKQYRDFFGYVTKA 135
           T+IHFT KETDIY+VNQSGDLANLSGLDW+DLSRLPNLFKLR+ILYS+ YRD   YVT A
Sbjct: 74  TQIHFTNKETDIYKVNQSGDLANLSGLDWNDLSRLPNLFKLREILYSEIYRDVISYVTGA 133

Query: 136 GKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKSHYGGGLRLFPSI 195
           GKLSGSKTDMSINTYTKGCHLLTHDDVIGSRR+SFILYLPDPD++WK HYGGGLRLFPSI
Sbjct: 134 GKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKQWKDHYGGGLRLFPSI 193

Query: 196 LPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLSIQGWYHIPQVGEEGY 255
           + NVPHSD SAKLVPQFNQIAFF+V PGFSFHDVEEV+VDKHRLSIQGWYHIPQVGE G+
Sbjct: 194 VANVPHSDHSAKLVPQFNQIAFFQVQPGFSFHDVEEVRVDKHRLSIQGWYHIPQVGEPGH 253

Query: 256 IPGEEEAWVRNNTSTLAQIESNVLEDFEFPKDERNILSFHEVKHFEKMLKGDAGAKTDNT 315
           IPGEEE WV+ NTSTLAQ+ESNVL+D+EFPK+ER+IL +H+VKHFEK+L+  +     + 
Sbjct: 254 IPGEEEEWVKTNTSTLAQLESNVLQDYEFPKNERDILPYHQVKHFEKVLQDSSPDSDSSK 313

Query: 316 PKESMTSVISDSVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFVENSSLQIESFLNDDK 375
            K S  S I D+  L+E E  YLSQ++S E+L+  GI+ LQ +F+ENS LQI SFLND K
Sbjct: 314 EK-SPVSAIVDTKNLTEEELHYLSQFVSEEYLTPTGIQSLQSRFLENSFLQIGSFLNDSK 372

Query: 376 SELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGKEYRNFQTEADILEAL 435
           S+LLK++IK  EL ++CPY S  V APWKTAIPPHK RYLYIDGK + NF++EADIL  L
Sbjct: 373 SKLLKRLIKNDELNKDCPYESDKVDAPWKTAIPPHKWRYLYIDGKSHENFRSEADILAKL 432

Query: 436 NNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKSTIFKKYLALLTSLCP 495
           NN +LPN+ F K  +           +   D E  L+ L  F +STIFKKYLALLTSLCP
Sbjct: 433 NNEELPNYTFLKQTLD----------KEKHDTEYELVQLVEFFQSTIFKKYLALLTSLCP 482

Query: 496 VSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCLTPSAGWESGELGGYE 555
           +SEQIL+RRFRPG DFTLATK   N+LL +    +DAVLEGTLCLTP+ GW+SGE+GGYE
Sbjct: 483 LSEQILVRRFRPGKDFTLATKINQNKLLSNVEGYVDAVLEGTLCLTPTNGWDSGEVGGYE 542

Query: 556 LYMMDDDEDNKQYLKEDVEDASVYRADDSGDSVLINDPPAWNTFNLVLRDESVLEFVKYV 615
           LYM  +D+D+++   +D+EDA+VY+ADDSGDSVLIN PP+WN+ NLVLRDESVL+FVKY+
Sbjct: 543 LYM--NDQDDEEMRDKDLEDAAVYKADDSGDSVLINSPPSWNSLNLVLRDESVLQFVKYI 600

Query: 616 SWSAKSSRWDVKMKWDVK 633
           SWSAKSSRWDV M+WDVK
Sbjct: 601 SWSAKSSRWDVSMQWDVK 618

>Kwal_47.18145
          Length = 624

 Score =  837 bits (2161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/633 (64%), Positives = 507/633 (80%), Gaps = 16/633 (2%)

Query: 1   MKRKTAEVKGEKERNSKQISLEEDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHE 60
           MKR ++    E  +  KQ + E  KIK +FN KIWD  FQD LK+EI DS+PYNWGTI +
Sbjct: 1   MKRTSSTHNDEISK--KQPTNEVGKIKSLFNSKIWDPKFQDDLKQEIADSKPYNWGTIRD 58

Query: 61  LVNDDLLRAVRKEIETEIHFTKKETDIYRVNQSGDLANLSGLDWDDLSRLPNLFKLRQIL 120
           LV+DDLLRAVRKE+ET+IHFTKKETDIY+VNQSGDLANLSGLDW+DLSRLPNL KLR+IL
Sbjct: 59  LVDDDLLRAVRKEVETQIHFTKKETDIYKVNQSGDLANLSGLDWEDLSRLPNLCKLREIL 118

Query: 121 YSKQYRDFFGYVTKAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRK 180
           YS+ YRD   +VT AGKLSGSK DMSINTYTKGCHLLTHDDVIGSRR+SFILYLPDP+ +
Sbjct: 119 YSEVYRDVISHVTGAGKLSGSKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPNTR 178

Query: 181 WKSHYGGGLRLFPSILPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLS 240
           WK HYGGGLRLFPSI+ NVP SD SAKL+PQFNQIAFF+V PGFSFHDVEEV+V++HRLS
Sbjct: 179 WKEHYGGGLRLFPSIVANVPQSDHSAKLIPQFNQIAFFQVQPGFSFHDVEEVRVNRHRLS 238

Query: 241 IQGWYHIPQVGEEGYIPGEEEAWVRNNTSTLAQIESNVLEDFEFPKDERNILSFHEVKHF 300
           IQGWYHIPQ GE+GYIPGEEE WV+ NTSTLAQ+ESNVL+D+EFPK ER+IL  H++KH+
Sbjct: 239 IQGWYHIPQEGEKGYIPGEEEEWVKTNTSTLAQLESNVLQDYEFPKGERDILPNHQIKHY 298

Query: 301 EKMLKGDAGAKTDNTPKESMTSVISDSVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFV 360
           E +L+     K + +  + +   + D   L++ E  +LS ++S E+L+ +GI KLQK+F+
Sbjct: 299 EHLLEAQPANKEEESSSDEL--ALPDLSFLTDKEMKFLSSFVSAEYLTPEGIAKLQKRFI 356

Query: 361 ENSSLQIESFLNDDKSELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGK 420
           +NS LQ++ FL+D+++ LLK++IK+ EL++ECPY S +V+ PWKTA+PPHK RYLYIDGK
Sbjct: 357 DNSHLQVDDFLSDERANLLKQLIKRDELDKECPYESVNVEMPWKTAMPPHKWRYLYIDGK 416

Query: 421 EYRNFQTEADILEALNNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKS 480
            + NF TE DIL+ LNN + PN+   K ++           +  +D E  LI +A F +S
Sbjct: 417 SHENFTTEQDILDKLNNEERPNYVLLKQSLD----------KKKYDTETELISVAEFFQS 466

Query: 481 TIFKKYLALLTSLCPVSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCL 540
           T FKKYLALLT L P+SEQ+LIRRFRPG DFTLAT+   N+LL     I+DAVLEGTLCL
Sbjct: 467 TAFKKYLALLTLLSPLSEQVLIRRFRPGKDFTLATQLNKNDLLGHVEGIVDAVLEGTLCL 526

Query: 541 TPSAGWESGELGGYELYMMDDDEDNKQYLKEDVEDASVYRADDSGDSVLINDPPAWNTFN 600
           TP+ GWESGE+GGYELYM  D++D  + + +D+EDA+VY+ DD+GD+VLIN PP+WN+ N
Sbjct: 527 TPTNGWESGEVGGYELYM--DNQDESEDMDKDIEDAAVYKTDDAGDAVLINKPPSWNSLN 584

Query: 601 LVLRDESVLEFVKYVSWSAKSSRWDVKMKWDVK 633
           LVLRDESVL+F+KYVSWSAKSSRWD+  +WDVK
Sbjct: 585 LVLRDESVLQFIKYVSWSAKSSRWDITAQWDVK 617

>Scas_715.28*
          Length = 632

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/637 (59%), Positives = 491/637 (77%), Gaps = 19/637 (2%)

Query: 1   MKRKTAEVKGEKERNSKQISLEEDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHE 60
           MKR + +   +    +K  +LE+DK+K +FNP+IW+  +Q  L+ EI +S+P+NWG+I +
Sbjct: 1   MKRSSGD---DSAAQAKMQTLEDDKLKALFNPRIWEPDYQKELRDEIANSKPFNWGSIPK 57

Query: 61  LVNDDLLRAVRKEIETEIHFTKKETDIYRVNQSGDLANLSGLDWDDLSRLPNLFKLRQIL 120
           L++DDLLRAVRKEIETEIHF+KKETDIY+VNQSGDLANLS LDW+DLSRLPNLFKLRQ+L
Sbjct: 58  LIDDDLLRAVRKEIETEIHFSKKETDIYKVNQSGDLANLSKLDWNDLSRLPNLFKLRQLL 117

Query: 121 YSKQYRDFFGYVTKAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRK 180
           YS++YRDFF Y+T++G LSG KTDMSINTYTKGCHL+ HDDVIGSRRISFILYLPDPDRK
Sbjct: 118 YSEKYRDFFAYITQSGHLSGKKTDMSINTYTKGCHLVPHDDVIGSRRISFILYLPDPDRK 177

Query: 181 WKSHYGGGLRLFPSILPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLS 240
           WKSHYGGGLRL+ +I+PNVP +DP AKLVPQFNQIAFFKV PGFSFHDVEEVKVDKHRLS
Sbjct: 178 WKSHYGGGLRLYDTIMPNVPENDPCAKLVPQFNQIAFFKVNPGFSFHDVEEVKVDKHRLS 237

Query: 241 IQGWYHIPQVGEEGYIPGEEEAWVRNNTSTLAQIESNVLEDFEFPKDERNILSFHEVKHF 300
           IQGWYHIPQ G++GYIP EE  ++  N + L +++S VLEDFEFPK+ER +L  +++KHF
Sbjct: 238 IQGWYHIPQEGDKGYIPNEEATYIDKNITQLGELDSAVLEDFEFPKEERELLPNYQIKHF 297

Query: 301 EKMLK----GDAGAKTDNTPKESMTSVISDSVKLSEAEFTYLSQYISPEHLSSKGIEKLQ 356
           EK+L+    GD  +    +    M  + S+   L+E E  YLS+Y++ EHL+ +GI KLQ
Sbjct: 298 EKILERSNSGDNDSSNVLSIPSGMKVIPSEIPSLTEEEVAYLSEYVALEHLTKEGISKLQ 357

Query: 357 KQFVENSSLQIESFLNDDKSELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLY 416
           + F+ENS L IESFLN++KS LL+  IK+ ELE++CP  SKDV  PWKTA+P HK +YLY
Sbjct: 358 ESFLENSFLSIESFLNEEKSSLLENQIKRTELEKDCPLFSKDVAYPWKTAMPSHKCKYLY 417

Query: 417 IDGKEYRNFQTEADILEALNNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAV 476
           IDGK+ ++  T   ++  LNN++  NF+  K+ + I         + + D E +LI+L++
Sbjct: 418 IDGKKQQDLATADGLITTLNNDENSNFEMVKELVNI--------GKEDIDTEKSLIELSI 469

Query: 477 FHKSTIFKKYLALLTSLCPVSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEG 536
           F KS IFKKYL LLTSLC ++EQ+LIRRFRPG DFTLA KC+ N   K   +++D VL  
Sbjct: 470 FFKSLIFKKYLVLLTSLCLITEQVLIRRFRPGNDFTLANKCKMN--TKYLNEVLDNVLRR 527

Query: 537 TLCLTPSAGWESGELGGYELYMMDDDEDNKQYLKEDVEDASVYRADDSGDSVLINDPPAW 596
                   GWE+G++GGYE+YMMD  ++  +   ED  +A  Y+ D++G+S+L+N P +W
Sbjct: 528 YFMFDSIKGWETGDVGGYEIYMMDGTKEKAE--DEDDVEAERYKNDENGESILLNSPASW 585

Query: 597 NTFNLVLRDESVLEFVKYVSWSAKSSRWDVKMKWDVK 633
           NTFNLVLRDESVLEFVKY+SW AKSSRWD+K+KWDV+
Sbjct: 586 NTFNLVLRDESVLEFVKYISWEAKSSRWDIKLKWDVR 622

>ADL114C [1627] [Homologous to ScYER049W - SH] (484310..486154)
           [1845 bp, 614 aa]
          Length = 614

 Score =  791 bits (2044), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/619 (64%), Positives = 483/619 (78%), Gaps = 31/619 (5%)

Query: 16  SKQISLEEDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHELVNDDLLRAVRKEIE 75
           SKQ  LE +K+K  FN KIWD ++++ L++E+  ++PYNWGTIH+LV+ DLLR+VR+EIE
Sbjct: 13  SKQPFLEIEKVKASFNSKIWDDSYREQLREEVASNKPYNWGTIHDLVDPDLLRSVRREIE 72

Query: 76  TEIHFTKKETDIYRVNQSGDLANLSGLDWDDLSRLPNLFKLRQILYSKQYRDFFGYVTKA 135
            EIHFT KETDIY+VNQSGDLANLSGLDW DLSRLP+L +LRQILYS  YRDF GYV  A
Sbjct: 73  KEIHFTNKETDIYKVNQSGDLANLSGLDWKDLSRLPSLCRLRQILYSDVYRDFIGYVAGA 132

Query: 136 GKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKSHYGGGLRLFPSI 195
           GKLSG+K DMSINTYTKGCHLLTHDDVIGSRR+SFILYLPDPD+ WK HYGG LRLFPSI
Sbjct: 133 GKLSGTKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKTWKEHYGGALRLFPSI 192

Query: 196 LPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLSIQGWYHIPQVGEEGY 255
           +PNVP SD SAKLVPQFNQ+AFF V PG+SFHDVEEVKVDKHRLSIQGWYHIPQ GEEG+
Sbjct: 193 IPNVPTSDFSAKLVPQFNQLAFFHVHPGYSFHDVEEVKVDKHRLSIQGWYHIPQEGEEGF 252

Query: 256 IPGEEEAWVRNNTSTLAQIESNVLEDFEFPKDERNILSFHEVKHFEKMLKGDAGAKTDNT 315
           +PGEEE +V  N STLAQ+ES +L+D+EF K ER+IL   ++K  EK L    G+++++T
Sbjct: 253 VPGEEEQYVNTNISTLAQLESILLQDYEFLKSERSILPLQQLKQLEKFL----GSESEDT 308

Query: 316 PKESMTSVISDSVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFVENSSLQIESFLNDDK 375
                      +  L+  E  YLS YIS EHLS +GI+ LQ +F ENS LQI+SFLN+ K
Sbjct: 309 -----------AFYLNADELAYLSMYISEEHLSLEGIKSLQSKFTENSYLQIDSFLNEQK 357

Query: 376 SELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGKEYRNFQTEADILEAL 435
           S LLKK+IK +ELE+ECPY + +V+ PWKTAIPP+K R++YIDGK + +F +E DI   L
Sbjct: 358 SALLKKLIKIEELEKECPYKAAEVEKPWKTAIPPYKWRFMYIDGKSHEHFCSEDDIKRRL 417

Query: 436 NNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKSTIFKKYLALLTSLCP 495
            + +LPNF   K  +            ++   E AL++L  F KS  FKKYLALLT LCP
Sbjct: 418 VHEELPNFTLLKQGLS-----------DHLSVEPALLELVEFFKSFAFKKYLALLTLLCP 466

Query: 496 VSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCLTPSAGWESGELGGYE 555
           ++EQ+LIRRFRPG DFTLATK   ++LL+     +DAVLEG LCLTP+ GWESGELGGYE
Sbjct: 467 LTEQLLIRRFRPGHDFTLATKIYPSQLLQHVEGFVDAVLEGVLCLTPTDGWESGELGGYE 526

Query: 556 LYMMD-DDEDNKQYLKEDVEDASVYRADDSGDSVLINDPPAWNTFNLVLRDESVLEFVKY 614
           LYM D DDED    + +DVEDA+VYR+DDSG SVLIN P +WN+FNLVLRDESVL+FVKY
Sbjct: 527 LYMGDQDDED----MNKDVEDAAVYRSDDSGSSVLINKPASWNSFNLVLRDESVLQFVKY 582

Query: 615 VSWSAKSSRWDVKMKWDVK 633
           VSW+AKSSRWD+ M WDVK
Sbjct: 583 VSWAAKSSRWDISMNWDVK 601

>KLLA0E04411g 404611..406413 similar to sp|P40032 Saccharomyces
           cerevisiae YER049w singleton, start by similarity
          Length = 600

 Score =  766 bits (1979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/613 (61%), Positives = 474/613 (77%), Gaps = 39/613 (6%)

Query: 21  LEEDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHELVNDDLLRAVRKEIETEIHF 80
           LE  K  G FN KIWDK+FQD L++EI+++QPYNWGTI +LV+ +LL+ VR+EIET IHF
Sbjct: 24  LESSKAVGSFNSKIWDKSFQDDLRQEIKNAQPYNWGTIRDLVDPNLLQEVRREIETSIHF 83

Query: 81  TKKETDIYRVNQSGDLANLSGLDWDDLSRLPNLFKLRQILYSKQYRDFFGYVTKAGKLSG 140
           T+KETDIY+VNQSGDLANLSGLD  DLS+LP+L KLR++LYS++YRDF  YVT++GKLSG
Sbjct: 84  TQKETDIYKVNQSGDLANLSGLDDADLSKLPSLVKLRELLYSEKYRDFIAYVTQSGKLSG 143

Query: 141 SKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKSHYGGGLRLFPSILPNVP 200
           SKTD+SINTYTKGCHLLTHDDVIGSRR+SFILYLP+P+R WK HYGGGLRLFPSI+PNVP
Sbjct: 144 SKTDISINTYTKGCHLLTHDDVIGSRRVSFILYLPEPERVWKEHYGGGLRLFPSIVPNVP 203

Query: 201 HSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLSIQGWYHIPQVGEEGYIPGEE 260
            SD SAKLVPQFNQIAFFKV PGFSFHDVEEVKVDKHRLSIQGWYHIPQ GE GY PGEE
Sbjct: 204 FSDHSAKLVPQFNQIAFFKVQPGFSFHDVEEVKVDKHRLSIQGWYHIPQEGEPGYTPGEE 263

Query: 261 EAWVRNNTSTLAQIESNVLEDFEFPKDERNILSFHEVKHFEKMLKGDAGAKTDNTPKESM 320
           E W++ N STL+Q+ ++ L+D+EFPK +R  LS +E    +         +TD+      
Sbjct: 264 EEWIKTNISTLSQLVNSPLQDYEFPKIDRTPLSHYESGKLD---------RTDDL----- 309

Query: 321 TSVISDSVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFVENSSLQIESFLNDDKSELLK 380
                    L+E + T+LS++++PEHL+++ + K+  +FVE+S + IESFLND+ S LLK
Sbjct: 310 ---------LTEDDITFLSKFLNPEHLTTESMRKISDKFVEDSFINIESFLNDEYSSLLK 360

Query: 381 KVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGKEYRNFQTEADILEALNNNDL 440
           K+I  KE   +CPY S +V+ PWKT++PPHK RYLYIDGK Y NF+ E DI +ALNN +L
Sbjct: 361 KLIMDKEFNYDCPYESVNVRHPWKTSLPPHKWRYLYIDGKSYTNFRNEEDIKKALNNPEL 420

Query: 441 PNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKSTIFKKYLALLTSLCPVSEQI 500
           PNF       +++S  +    +  F+ E  L +LA+F +S  FKK++  LT L  +SEQ+
Sbjct: 421 PNFH------QLLSSFAD---KEEFNCEAKLCELAIFLQSISFKKWIVQLTKLVILSEQL 471

Query: 501 LIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCLTPSAGWESGELGGYELYMMD 560
           LIRRFRPG DFTLAT    NELLK+ P  ++A+LE TLCLTPS GW+SGE+GGYELYM  
Sbjct: 472 LIRRFRPGKDFTLATTTEVNELLKTIPGFVEAILECTLCLTPSKGWDSGEVGGYELYM-- 529

Query: 561 DDEDNKQYLKEDVEDASVYRADDSGDSVLINDPPAWNTFNLVLRDESVLEFVKYVSWSAK 620
               N Q   ++ +DA++YRADD GDSVLIN P +WN+ NLVLRDE+VL+F+KYVSW+AK
Sbjct: 530 ----NNQ-DDDEDDDAAIYRADDDGDSVLINKPASWNSLNLVLRDENVLQFIKYVSWAAK 584

Query: 621 SSRWDVKMKWDVK 633
           SSRWD+ ++WDVK
Sbjct: 585 SSRWDISLQWDVK 597

>KLLA0A07733g complement(688856..692050) similar to sp|P15938
           Saccharomyces cerevisiae YKR086w PRP16 RNA-dependent
           ATPase, start by similarity
          Length = 1064

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 8/64 (12%)

Query: 86  DIYRVNQSGDLANLSGLDWDDLSRLP--------NLFKLRQILYSKQYRDFFGYVTKAGK 137
           +I R N +  L  L  L+ ++LS+ P        NL      L++ +  D FG++TK G+
Sbjct: 713 EIQRTNLANTLLQLKSLNINNLSKFPFIDPPPSQNLMTSLYDLWALEALDNFGHLTKLGR 772

Query: 138 LSGS 141
           L G+
Sbjct: 773 LMGA 776

>Kwal_34.15857
          Length = 471

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 49/111 (44%), Gaps = 15/111 (13%)

Query: 296 EVKHFEKMLKGDAGAKTDNTP--KESMTSVISDSVKLSEAEFTYLSQYISPEHLSSKGIE 353
           E K ++ +L G  GA         E + S+I D+ K     F        P  + ++  E
Sbjct: 37  EGKVYKDILDGVTGAAVGALGWGDEEVLSIIQDAAKGHTYSF--------PSLIGNQASE 88

Query: 354 KLQKQFVENS-----SLQIESFLNDDKSELLKKVIKQKELEQECPYHSKDV 399
            L K ++ENS     +  +      + +E   K+++Q +LE+ CP  +K +
Sbjct: 89  DLAKFYIENSPKGAFAAALWCCSGSESNENAMKIVRQYQLERGCPKKTKII 139

>Scas_638.2
          Length = 805

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 60/143 (41%), Gaps = 35/143 (24%)

Query: 119 ILYSKQYRDFFGYVTKAGKLSG-SKTDMSINTYTK--GCHLLTHDDVIG----------- 164
           +LY +Q      +V+K  KL   SKTD   + Y+K  G +LL+  D +G           
Sbjct: 143 VLYMQQQGGDDDHVSKLVKLENKSKTDFQFDGYSKELGAYLLSIKDNMGQYYSDSTLKSM 202

Query: 165 --------SRRISFILYLPDPDRKWKSHYGGGLRLFPSILPNVPH-------SDPSAKLV 209
                   S+     L +PD D+ WK+       +F +IL +          +D   +L 
Sbjct: 203 EVALGADCSKPTHLSLRIPD-DQSWKAR-----DVFQTILGDSVKEILQNNANDFDRRLT 256

Query: 210 PQFNQIAFFKVLPGFSFHDVEEV 232
           P   QI  F  LP  +FH V++ 
Sbjct: 257 PSLYQIRNFYNLPPGNFHYVQKT 279

>Scas_680.29
          Length = 786

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 5/51 (9%)

Query: 338 LSQYISPEHLSSKGIEKLQKQFVENSSLQIESFLNDDKSELLKKVIKQKEL 388
           + Q+I  ++L  + +E L++QF EN++  I  F+ + K     +VIKQ EL
Sbjct: 141 IRQFIQLDYL--RFVESLERQFNENATFSIREFIQNIKD---TEVIKQLEL 186

>Scas_716.11
          Length = 464

 Score = 29.6 bits (65), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 14/72 (19%)

Query: 432 LEALNNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKSTIFKKYLALLT 491
           LE L N  L N QFT  +  +               ++  +D ++  K ++ +KYLA++T
Sbjct: 293 LELLYNLALNNTQFTSHSFTV--------------RDMVTLDKSLLFKPSLEEKYLAIVT 338

Query: 492 SLCPVSEQILIR 503
           S  P    IL+R
Sbjct: 339 SHVPYMRLILVR 350

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,175,394
Number of extensions: 1121510
Number of successful extensions: 4111
Number of sequences better than 10.0: 53
Number of HSP's gapped: 4233
Number of HSP's successfully gapped: 54
Length of query: 633
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 525
Effective length of database: 12,857,365
Effective search space: 6750116625
Effective search space used: 6750116625
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)