Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER048W-A94944923e-66
Kwal_47.1814299902981e-36
KLLA0E04389g91922874e-35
ADL113C108852625e-31
CAGL0J02794g103772591e-30
Sklu_2174.593902512e-29
Scas_715.28d95872138e-24
YEL018W (EAF5)27947582.3
YMR228W (MTF1)34192582.7
KLLA0E09372g44839573.2
Scas_695.4334337547.7
Scas_721.6144123549.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER048W-A
         (94 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER048W-A (YER048W-A) [1476] chr5 (250717..251001) Protein of un...   194   3e-66
Kwal_47.18142                                                         119   1e-36
KLLA0E04389g 403312..403587 similar to sgd|S0007237 Saccharomyce...   115   4e-35
ADL113C [1628] [Homologous to ScYER048W-A - SH] (486497..486823)...   105   5e-31
CAGL0J02794g 272273..272584 similar to gi|6320889|sgd|S0007237 S...   104   1e-30
Sklu_2174.5 YER048W-A, Contig c2174 5568-5849 reverse complement      101   2e-29
Scas_715.28d                                                           87   8e-24
YEL018W (EAF5) [1407] chr5 (121471..122310) Protein of unknown f...    27   2.3  
YMR228W (MTF1) [4184] chr13 (724625..725650) Mitochondrial RNA p...    27   2.7  
KLLA0E09372g complement(834365..835711) weakly similar to sgd|S0...    27   3.2  
Scas_695.43                                                            25   7.7  
Scas_721.61                                                            25   9.9  

>YER048W-A (YER048W-A) [1476] chr5 (250717..251001) Protein of
          unknown function [285 bp, 94 aa]
          Length = 94

 Score =  194 bits (492), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 94/94 (100%), Positives = 94/94 (100%)

Query: 1  MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFK 60
          MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFK
Sbjct: 1  MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFK 60

Query: 61 EAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH 94
          EAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH
Sbjct: 61 EAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH 94

>Kwal_47.18142
          Length = 99

 Score =  119 bits (298), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 59/90 (65%), Positives = 69/90 (76%), Gaps = 1/90 (1%)

Query: 5  TAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKN 64
            PTR QVL+LYK+FIKNAN FNNYN+REYFL K RTTFR++    DP  +   ++ A  
Sbjct: 5  AGPTRAQVLALYKQFIKNANGFNNYNYREYFLRKARTTFREHKTLTDPASVETAWEIANK 64

Query: 65 DLGVLKRQSVISQMYTFDRLVVEPLQGRKH 94
          +LGVLKRQSVISQMYTFD+ VVEPL  RKH
Sbjct: 65 ELGVLKRQSVISQMYTFDKQVVEPLD-RKH 93

>KLLA0E04389g 403312..403587 similar to sgd|S0007237 Saccharomyces
          cerevisiae YER048wa, start by similarity
          Length = 91

 Score =  115 bits (287), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 54/92 (58%), Positives = 70/92 (76%), Gaps = 1/92 (1%)

Query: 1  MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFK 60
          MP  T  ++ Q+L +YKEFI+NA++  NYNFREYFL + R +FR N N ++P+ +  L  
Sbjct: 1  MPA-TGASKTQILHMYKEFIRNASKIQNYNFREYFLRRARESFRANKNVENPEKISELLS 59

Query: 61 EAKNDLGVLKRQSVISQMYTFDRLVVEPLQGR 92
          EA+ DLGVLKRQSVIS MYTFD+LVVEPL+ R
Sbjct: 60 EAEKDLGVLKRQSVISNMYTFDKLVVEPLKKR 91

>ADL113C [1628] [Homologous to ScYER048W-A - SH] (486497..486823)
           [327 bp, 108 aa]
          Length = 108

 Score =  105 bits (262), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 50/85 (58%), Positives = 65/85 (76%), Gaps = 1/85 (1%)

Query: 5   TAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKN 64
             PTR  VL LY+EF+++A QFNNYNFREYF+  +R TFRK+  +   + L  L++ A+ 
Sbjct: 23  AGPTRAGVLHLYREFVRSARQFNNYNFREYFMRHSRDTFRKH-REASGEELQQLWERAQQ 81

Query: 65  DLGVLKRQSVISQMYTFDRLVVEPL 89
           ++GVLKRQSVISQMYTFD+LVVE L
Sbjct: 82  EVGVLKRQSVISQMYTFDKLVVEQL 106

>CAGL0J02794g 272273..272584 similar to gi|6320889|sgd|S0007237
          Saccharomyces cerevisiae YER048wa, hypothetical start
          Length = 103

 Score =  104 bits (259), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 50/77 (64%), Positives = 60/77 (77%)

Query: 8  TRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLG 67
           R+QVL LYK+ IKNANQF+NYNFREYFL K RT F+ N    D   + +LF+ A+ DLG
Sbjct: 3  ARQQVLQLYKQIIKNANQFSNYNFREYFLRKARTEFKANKALTDAAKIESLFQGAQRDLG 62

Query: 68 VLKRQSVISQMYTFDRL 84
          VLKRQS+ISQMYTFD+L
Sbjct: 63 VLKRQSIISQMYTFDKL 79

>Sklu_2174.5 YER048W-A, Contig c2174 5568-5849 reverse complement
          Length = 93

 Score =  101 bits (251), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 73/90 (81%)

Query: 5  TAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKN 64
          T PTR QVL+LY++F+KNAN FNNYNFREYFL K RTTF+++   QD   +   ++EA+ 
Sbjct: 4  TVPTRPQVLALYRQFVKNANNFNNYNFREYFLRKARTTFKESKQLQDSTKVNAAWEEAQR 63

Query: 65 DLGVLKRQSVISQMYTFDRLVVEPLQGRKH 94
          +LGVLKRQSVISQMYTFD+LVVEPL+ + H
Sbjct: 64 ELGVLKRQSVISQMYTFDKLVVEPLRKKHH 93

>Scas_715.28d
          Length = 95

 Score = 86.7 bits (213), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 53/87 (60%), Positives = 68/87 (78%), Gaps = 2/87 (2%)

Query: 1  MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFK 60
          MP    P+R QVLSLYK+FI+N+NQFNN+NFREYFL  +R  F++N   QD + +  L++
Sbjct: 1  MPA--TPSRLQVLSLYKQFIRNSNQFNNFNFREYFLRISREKFKENAPIQDKEKVAKLYE 58

Query: 61 EAKNDLGVLKRQSVISQMYTFDRLVVE 87
           A+ DLGVLKRQ +ISQMYTFD+LVVE
Sbjct: 59 AAQRDLGVLKRQKLISQMYTFDKLVVE 85

>YEL018W (EAF5) [1407] chr5 (121471..122310) Protein of unknown
           function [840 bp, 279 aa]
          Length = 279

 Score = 26.9 bits (58), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 25/47 (53%)

Query: 7   PTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPK 53
           P R ++L LY++ + N  +    NF++ F S   +  +  +N +D K
Sbjct: 179 PKREKLLKLYRDTVLNKLESKTGNFQKLFKSPDGSIIKNEINYEDIK 225

>YMR228W (MTF1) [4184] chr13 (724625..725650) Mitochondrial RNA
           polymerase specificity factor, distantly related to
           bacterial sigma factors [1026 bp, 341 aa]
          Length = 341

 Score = 26.9 bits (58), Expect = 2.7,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 7/92 (7%)

Query: 4   FTAPTRRQVLSLYKEF-IKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEA 62
           +  P   +VL LY    I++A  +N Y  R+Y L + R++  K +N +     + + K  
Sbjct: 42  YKHPEELKVLDLYPGVGIQSAIFYNKYCPRQYSLLEKRSSLYKFLNAKFEGSPLQILKRD 101

Query: 63  KNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH 94
             D       S  S +   +R+ V  +Q   H
Sbjct: 102 PYDW------STYSNLIDEERIFVPEVQSSDH 127

>KLLA0E09372g complement(834365..835711) weakly similar to
           sgd|S0005549 Saccharomyces cerevisiae YOR023c AHC1
           component of the ADA histone acetyltransferase complex,
           start by similarity
          Length = 448

 Score = 26.6 bits (57), Expect = 3.2,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 23/39 (58%)

Query: 33  EYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKR 71
           E  L+K+ T  +K   + D K ++N  K+AKNDL  + +
Sbjct: 337 ESALTKSTTHLQKMYGKDDFKDIINYVKDAKNDLETIMK 375

>Scas_695.43
          Length = 343

 Score = 25.4 bits (54), Expect = 7.7,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 15  LYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQD 51
           L K F+   +QF  +NF+EY       T R N N QD
Sbjct: 140 LGKNFMNKCHQFK-FNFQEYVSDVINGTKRFNENVQD 175

>Scas_721.61
          Length = 441

 Score = 25.4 bits (54), Expect = 9.9,   Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 3/23 (13%)

Query: 15  LYKEFIKNANQFN---NYNFREY 34
           +YK +  N NQFN   NYN  EY
Sbjct: 358 IYKSYTTNENQFNENDNYNEDEY 380

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,050,361
Number of extensions: 112244
Number of successful extensions: 407
Number of sequences better than 10.0: 24
Number of HSP's gapped: 406
Number of HSP's successfully gapped: 24
Length of query: 94
Length of database: 16,596,109
Length adjustment: 65
Effective length of query: 29
Effective length of database: 14,345,939
Effective search space: 416032231
Effective search space used: 416032231
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 54 (25.4 bits)