Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YER001W (MNN1)76274938490.0
Sklu_2225.679768514240.0
KLLA0E09790g74669211451e-146
Kwal_14.205773368011091e-141
Kwal_23.29265685005546e-62
Scas_717.56395825052e-54
YIL014W (MNT3)6306295023e-54
Kwal_55.209846196455014e-54
AAR183C6484564638e-49
KLLA0D13376g6636284542e-47
Scas_643.196576344532e-47
YGL257C (MNT2)5585074393e-46
AEL345W6455854284e-44
AFL235W3814074126e-44
Kwal_55.222385844774202e-43
CAGL0H09262g6256694168e-43
ABR245C6414634151e-42
YNR059W (MNT4)5804964122e-42
CAGL0C04048g6206714123e-42
Kwal_23.54545835374052e-41
CAGL0C03960g6236363947e-40
CAGL0H09240g6426413902e-39
CAGL0C04004g6326563884e-39
CAGL0C03938g6376313823e-38
CAGL0C03916g6286393771e-37
CAGL0G04279g6605323593e-35
CAGL0C03894g6273343353e-32
CAGL0C03982g6295903246e-31
CAGL0C04026g6366483141e-29
ADR020C6045532613e-23
KLLA0A11880g4233102183e-18
CAGL0B03003g3402801824e-14
KLLA0A11891g2022191604e-12
CAGL0B02992g3752641264e-07
CAGL0M02871g6002801161e-05
Kwal_33.136935582811114e-05
CAGL0I04532g6122781087e-05
Scas_576.95071841015e-04
Scas_689.9586155960.002
KLLA0E17831g638287950.003
YBR015C (MNN2)597286950.003
KLLA0C16467g607141920.007
Sklu_2306.4741188760.59
Kwal_56.23117607143750.67
KLLA0F06490g52884731.2
Scas_296.2295158702.2
YJR092W (BUD4)144887712.3
YCR089W (FIG2)160934703.2
Scas_594.7170342693.8
YLR106C (MDN1)4910131694.9
Scas_526.5387158675.5
Kwal_56.23247379123676.0
Sklu_2330.723196658.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YER001W
         (749 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YER001W (MNN1) [1423] chr5 (153519..155807) Alpha-1,3-mannosyltr...  1487   0.0  
Sklu_2225.6 YER001W, Contig c2225 7299-9692                           553   0.0  
KLLA0E09790g 867899..870139 similar to sp|P39106 Saccharomyces c...   445   e-146
Kwal_14.2057                                                          431   e-141
Kwal_23.2926                                                          218   6e-62
Scas_717.5                                                            199   2e-54
YIL014W (MNT3) [2651] chr9 (326101..327993) Mannosyltransferase ...   197   3e-54
Kwal_55.20984                                                         197   4e-54
AAR183C [371] [Homologous to ScYIL014W (MNT3) - NSH] (672091..67...   182   8e-49
KLLA0D13376g 1150858..1152849 some similarities with sp|P40549 S...   179   2e-47
Scas_643.19                                                           179   2e-47
YGL257C (MNT2) [1743] chr7 complement(12481..14157) Mannosyltran...   173   3e-46
AEL345W [2160] [Homologous to ScYIL014W (MNT3) - NSH] complement...   169   4e-44
AFL235W [2960] [Homologous to ScYIL014W (MNT3) - NSH; ScYER001W ...   163   6e-44
Kwal_55.22238                                                         166   2e-43
CAGL0H09262g complement(908258..910135) similar to sp|P40549 Sac...   164   8e-43
ABR245C [839] [Homologous to ScYIL014W (MNT3) - NSH] (854585..85...   164   1e-42
YNR059W (MNT4) [4642] chr14 (736800..738542) Protein with strong...   163   2e-42
CAGL0C04048g complement(399734..401596) similar to sp|P40549 Sac...   163   3e-42
Kwal_23.5454                                                          160   2e-41
CAGL0C03960g complement(389250..391121) similar to sp|P40549 Sac...   156   7e-40
CAGL0H09240g complement(905670..907598) some similarities with s...   154   2e-39
CAGL0C04004g complement(394614..396512) similar to sp|P40549 Sac...   154   4e-39
CAGL0C03938g complement(386673..388586) weakly similar to sp|P40...   151   3e-38
CAGL0C03916g complement(383989..385875) weakly similar to sp|P40...   149   1e-37
CAGL0G04279g complement(404144..406126) weakly similar to sp|P40...   142   3e-35
CAGL0C03894g complement(381514..383397) weakly similar to sp|P40...   133   3e-32
CAGL0C03982g complement(391909..393798) similar to sp|P40549 Sac...   129   6e-31
CAGL0C04026g complement(397303..399213) weakly similar to sp|P40...   125   1e-29
ADR020C [1761] [Homologous to ScYIL014W (MNT3) - SH] (740415..74...   105   3e-23
KLLA0A11880g 1026919..1028190 some similarities with ca|CA0854|I...    89   3e-18
CAGL0B03003g 295997..297019 some similarities with sp|P40549 Sac...    75   4e-14
KLLA0A11891g 1028064..1028672 similar to sp|P53059 Saccharomyces...    66   4e-12
CAGL0B02992g 294927..296054 some similarities with sp|P40549 Sac...    53   4e-07
CAGL0M02871g 324009..325811 similar to sp|P46982 Saccharomyces c...    49   1e-05
Kwal_33.13693                                                          47   4e-05
CAGL0I04532g 404659..406497 similar to sp|P38069 Saccharomyces c...    46   7e-05
Scas_576.9                                                             44   5e-04
Scas_689.9                                                             42   0.002
KLLA0E17831g complement(1572985..1574901) some similarities with...    41   0.003
YBR015C (MNN2) [208] chr2 complement(267672..269465) Mannosyltra...    41   0.003
KLLA0C16467g 1442002..1443825 weakly similar to sp|P46982 Saccha...    40   0.007
Sklu_2306.4 , Contig c2306 6263-8488 reverse complement                34   0.59 
Kwal_56.23117                                                          33   0.67 
KLLA0F06490g complement(626983..628569) similar to sp|P20437 Sac...    33   1.2  
Scas_296.2                                                             32   2.2  
YJR092W (BUD4) [2983] chr10 (598649..602995) Protein required fo...    32   2.3  
YCR089W (FIG2) [612] chr3 (267430..272259) Protein involved in m...    32   3.2  
Scas_594.7                                                             31   3.8  
YLR106C (MDN1) [3521] chr12 complement(349007..363739) Nuclear p...    31   4.9  
Scas_526.5                                                             30   5.5  
Kwal_56.23247                                                          30   6.0  
Sklu_2330.7 YML079W, Contig c2330 11157-11852 reverse complement       30   8.1  

>YER001W (MNN1) [1423] chr5 (153519..155807)
           Alpha-1,3-mannosyltransferase, required for complex
           glycosylation of both N- and O-oligosaccharides [2289
           bp, 762 aa]
          Length = 762

 Score = 1487 bits (3849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 715/749 (95%), Positives = 715/749 (95%)

Query: 1   MLALRRFILNQRSLRSCTXXXXXXXXXXXXXXFQLVTHRNDALIRSSNVNSTNKKTLKDA 60
           MLALRRFILNQRSLRSCT              FQLVTHRNDALIRSSNVNSTNKKTLKDA
Sbjct: 1   MLALRRFILNQRSLRSCTIPILVGALIIILVLFQLVTHRNDALIRSSNVNSTNKKTLKDA 60

Query: 61  DPKVLIEAFGSPEVDPVDTIPVSPLELVPFYDQSIDTKRSSSWLINKKGYYKHFNELSLT 120
           DPKVLIEAFGSPEVDPVDTIPVSPLELVPFYDQSIDTKRSSSWLINKKGYYKHFNELSLT
Sbjct: 61  DPKVLIEAFGSPEVDPVDTIPVSPLELVPFYDQSIDTKRSSSWLINKKGYYKHFNELSLT 120

Query: 121 DRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKDANGNPMDEKSERLYRRKYDMF 180
           DRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKDANGNPMDEKSERLYRRKYDMF
Sbjct: 121 DRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKDANGNPMDEKSERLYRRKYDMF 180

Query: 181 QAFERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPNYDPDNFKKYD 240
           QAFERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPNYDPDNFKKYD
Sbjct: 181 QAFERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPNYDPDNFKKYD 240

Query: 241 QFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYEYDP 300
           QFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYEYDP
Sbjct: 241 QFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYEYDP 300

Query: 301 SKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDELSQE 360
           SKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDELSQE
Sbjct: 301 SKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDELSQE 360

Query: 361 LVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVVLL 420
           LVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVVLL
Sbjct: 361 LVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVVLL 420

Query: 421 NLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRENVNERCIARYETLLPRN 480
           NLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRENVNERCIARYETLLPRN
Sbjct: 421 NLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRENVNERCIARYETLLPRN 480

Query: 481 LESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTIPL 540
           LESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTIPL
Sbjct: 481 LESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTIPL 540

Query: 541 VLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNGKRQEA 600
           VLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNGKRQEA
Sbjct: 541 VLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNGKRQEA 600

Query: 601 AVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXXXXXXXXXXXXXEEMEK 660
           AVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAA                    EEMEK
Sbjct: 601 AVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAKDDWKKDGDFKKFKDQFKTFEEMEK 660

Query: 661 YYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCATHKTLLKPYSYNHRTTHGELITL 720
           YYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCATHKTLLKPYSYNHRTTHGELITL
Sbjct: 661 YYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCATHKTLLKPYSYNHRTTHGELITL 720

Query: 721 DEEQRLHIDAVNTVWSHANKDNTRSFTEE 749
           DEEQRLHIDAVNTVWSHANKDNTRSFTEE
Sbjct: 721 DEEQRLHIDAVNTVWSHANKDNTRSFTEE 749

>Sklu_2225.6 YER001W, Contig c2225 7299-9692
          Length = 797

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/685 (40%), Positives = 429/685 (62%), Gaps = 23/685 (3%)

Query: 74  VDPVDTIPVSPLELVPFYDQSIDTKRSSSW-LINKKGYYKHFNELSLTDRCKFYFRTLYT 132
           + P+D +PVSPLE+VP YD  +   R +SW  INK   YKHFNEL L  RC FYFRTLY 
Sbjct: 116 IKPIDQVPVSPLEVVPDYDLDVSRNRKASWNFINKNKKYKHFNELDLQTRCHFYFRTLYN 175

Query: 133 LDDEWTNSVKKLEYSIND---NEGVDEGKDANG-NPMDEKSERLYRRKYDMFQAFERIRA 188
           ++ +W+N      + IN+    E + +  D +G + ++++S  L++R +D+  A ER+R 
Sbjct: 176 MNAKWSNDHHLYTFDINEEIEGEKLKDMSDKDGVSLVNKESLGLHKRLHDISLALERMRI 235

Query: 189 YDRCFMQANPVNIQEIFPKS--------DKMSKERVQSKLIKTLNATFPNYDPDN---FK 237
           YD CF+Q + V+ + IF           DK+SK++  S        T      D    +K
Sbjct: 236 YDECFIQNDSVDFEGIFTNKKDDLGVDVDKVSKQKRSSINFNGGGGTNGELSGDQTEYYK 295

Query: 238 KYDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYE 297
            +DQ++ E++MFPF+  +T E F  M+P +TSP G  L  G+ P  + KTG  + + +++
Sbjct: 296 NFDQWDLENRMFPFLKYYTHENFTNMMPILTSPNGSQLATGWFPIHNRKTGVAESFEQHK 355

Query: 298 YDPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDEL 357
           YD SK+FW NW  +S K A RGIV+SLG+ Q    +K +A+LRF+GN LPIQV+++GD L
Sbjct: 356 YDKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKGD-L 414

Query: 358 SQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLV 417
           S++ V KL   A++ +F    N++DN+T+V QE+WF+DVS T++P    +F  +K+KWL 
Sbjct: 415 SEDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVINEFDRFKNKWLA 474

Query: 418 VLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRENVNERCIARYETLL 477
           V+ NL  EFVF+D+DAISY  I++YF+T+EY+ +GTVF+++R+L    + +C A + TL+
Sbjct: 475 VVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTLM 534

Query: 478 PRNLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHT 537
           P+ LESK FQ+  +ID D+  ++C   LT EE IFK FF +  QHQ+E+GL A+DKS+H 
Sbjct: 535 PKALESKYFQSFSMIDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVAIDKSQHI 594

Query: 538 IPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNGKR 597
           +PLV++ +++++K    C HGDKE FWLGF+ +GH Y+   V + A+G  ++K   +  R
Sbjct: 595 MPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAAAVGKLIEKESEDKLR 654

Query: 598 QEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXXXXXXXXXXXXXEE 657
           QE   EIC+ Q+AHMS D   LLW+NGG   CK D A                     EE
Sbjct: 655 QEQRSEICNIQLAHMSYDDH-LLWLNGGSQNCKFDVAE---DDWNNEKFGFTKNYNNVEE 710

Query: 658 MEKYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCATHKTLLKPYSYNHRTTHGEL 717
           ++K  Y + +  ++ ++P  K   W +   G C GY+WCA + + +K Y+Y++R   G+L
Sbjct: 711 LKK-EYASFLEVEHAVIPTEKGGGWGKID-GRCKGYVWCARYSSYIKEYTYSNRVNIGKL 768

Query: 718 ITLDEEQRLHIDAVNTVWSHANKDN 742
           +  DEE++ +ID++N +W  A+ D+
Sbjct: 769 VKFDEEEKKYIDSLNKIWWKASTDS 793

>KLLA0E09790g 867899..870139 similar to sp|P39106 Saccharomyces
           cerevisiae YER001w MNN1 alpha-1, 3-mannosyltransferase,
           start by similarity
          Length = 746

 Score =  445 bits (1145), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 249/692 (35%), Positives = 386/692 (55%), Gaps = 34/692 (4%)

Query: 65  LIEAFGSPEVDPVDTIPVSPLELVPFYDQSIDTKRSSSW-LINKKGYYKHFNELSLTDRC 123
           L E   + ++ P++  PVSPLEL+P  + S   K  +SW L+ +   YK FN+  L  +C
Sbjct: 65  LSELMSNVKIKPIEETPVSPLELIPDIEISTRKKYDASWDLLFRGRKYKSFNDYDLHTKC 124

Query: 124 KFYFRTLYTLDDEWTNSVKKLEYSIND---NEGVDEGKDANGNPM-DEKSERLYRRKYDM 179
           +FYF+ LY L+++WTN+++   + IND   +  +D  KD++G  + DEK+ RLY+R +++
Sbjct: 125 EFYFQNLYNLNEDWTNNIRTFTFDINDVDTSTKIDALKDSDGVQLVDEKAIRLYKRTHNV 184

Query: 180 FQAFERIRAYDRCFMQA---NPVNIQEIFPKSDKMSKERV--------QSKLIKTLNATF 228
             A ER+R YD+CF+ +   NP+ +  +F +S+K SK           +    KT   +F
Sbjct: 185 ALATERLRLYDKCFVNSPGSNPLKMDHLF-RSNKKSKTTALDDEVTGNRDTFTKTKKTSF 243

Query: 229 -PNYDPDNFKKYDQFEFEHKMFPFINNFTTETFHEMVPKIT-SPFGKVLEQGFLPKFDHK 286
             + D  +F+KYDQ++FEH+MFP I  F    F  ++P  T S  G+ L QG  P  D K
Sbjct: 244 LSDMDTSSFQKYDQWDFEHRMFPMIPYFEEHNFTNVMPIFTGSNGGEPLPQGKFPVLDPK 303

Query: 287 TGKVQEYFKYEYDPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTL 346
           +G++     + YD SK+ W NW DMS+    RGI+L+ G  Q    ++ IA+LR +GN L
Sbjct: 304 SGELLRVETFRYDKSKSLWKNWNDMSSASGKRGIILAAGDGQVDQCIRLIATLRAQGNAL 363

Query: 347 PIQVVYRGDELSQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRG 406
           PIQ+++  ++L+++ V  L  AA+S +F         S+   Q +W ++V  T+    + 
Sbjct: 364 PIQIIHN-NQLNEKSVKLLSEAAKSTEF---------SSGRAQSLWLVNVGPTLESSMKS 413

Query: 407 DFGSYKSKWLVVLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRENVN 466
           +FG +K+KWL V+ N  +EF+F+D DAISY  + +YF   EY+ TGT+F+++R+L     
Sbjct: 414 NFGRFKNKWLSVIFNTFEEFIFIDTDAISYINMADYFNFKEYKSTGTLFFKDRSLAIGTE 473

Query: 467 ERCIARYETLLPRNLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEA 526
           ++C   +ETL PR LE   F    +I+ D+   +C   LT EE ++K FF    QH LE+
Sbjct: 474 QKCGPLFETLEPRILEMYYFNTLPMINGDYVEQQCMGMLTPEEKVYKRFFEVGHQHNLES 533

Query: 527 GLFAVDKSKHTIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGD 586
           GL A++K++H + LV A ++++A     C  GDKE FWLG L AG  Y++  + + AIG 
Sbjct: 534 GLLAINKNEHIMGLVTATVLNIAPKVGGCGWGDKEFFWLGLLVAGQRYSIYDIDASAIGV 593

Query: 587 YVKKTDLNGKRQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXXXX 646
             +K  +    +     ICS Q+AH S D   LLW+NGG  +CK                
Sbjct: 594 PQQKQSIANGDEFDEYRICSLQVAHTSYDGH-LLWINGGSQYCKK--PETFEGDWTNIKE 650

Query: 647 XXXXXXXXXEEMEKYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCATHKTLLKPY 706
                    E+  K Y  T +  +  I+PD +S+ W R     C GY WC    + LKPY
Sbjct: 651 LRESYSDDKEKALKAYSDT-VKVEAAIVPDSRSNGWGRDDQ-RCKGYFWCGKFTSKLKPY 708

Query: 707 SYNHRTTHGELITLDEEQRLHIDAVNTVWSHA 738
           +YN   T G+LI   +E+   I  +N +W+ A
Sbjct: 709 TYNTVVTKGDLIRFGDEEIESISKINKIWNDA 740

>Kwal_14.2057
          Length = 733

 Score =  431 bits (1109), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 239/680 (35%), Positives = 374/680 (55%), Gaps = 33/680 (4%)

Query: 60  ADPKVLIEAFG--SPEVDPVDTIPVSPLELVPFYDQSIDTKRSSSW-LINKKGYYKHFNE 116
           ++P    +A+G    E+  V  I  SPLE +  Y+++++ KR +SW  + +   +K F++
Sbjct: 77  SEPSSSHDAYGFLKGELPHVTGIAFSPLERIKTYNENMEKKRKASWDFLGRNNRFKKFDD 136

Query: 117 LSLTDRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKDANGNPMDEKSERLYRRK 176
           LS   +C FYF  LY ++ +W N+  K  + +ND E   E + +      +++ R  +R+
Sbjct: 137 LSEESQCYFYFHNLYEINPKWENNYSKWGFIVNDEE---EERLSTVAEDTKEAIRSRKRE 193

Query: 177 YDMFQAFERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPNYDPDNF 236
            D+    ER+R Y+ CF+     ++ ++F            S +  + N+         F
Sbjct: 194 NDIALGLERMRMYETCFLDRKDADMSKMF------------SNIRNSGNS---------F 232

Query: 237 KKYDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKY 296
             + Q++FE +M+PFI  F  ++F E++P  TSP G  LE G LP   H +  +++  KY
Sbjct: 233 SSFTQWDFEKRMWPFIREFDKKSFSELIPHFTSPDGVALEAGHLPPLGHSSDYIKKAIKY 292

Query: 297 EYDPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDE 356
           EY+  ++F  NW  MS+ VA +GIVLS G  Q   A + IA LR+ GN LP+QVV++GD 
Sbjct: 293 EYNEKRSFMWNWNHMSSLVAQKGIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGD- 351

Query: 357 LSQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWL 416
           LS+  +  L   A+S D    E +Y+   NV QE+WF+DVS T+ P   G F  +K+KWL
Sbjct: 352 LSEGSIKALQKIAQSDDITFPETDYEGGQNVKQELWFVDVSPTLDPVMAGSFTRFKNKWL 411

Query: 417 VVLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRENVNERCIARYETL 476
               NL +EF+ +D+D + Y  ++ YF + EYQ TGT+F+R+R   E V E C A  ETL
Sbjct: 412 ATSFNLFEEFILIDVDTVHYVDLEQYFHSVEYQHTGTLFFRDRYSSEKVEEICPAMIETL 471

Query: 477 LPRNLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKH 536
            P  LES  F +  ++D D+    C+  L     + K++F    +HQ+++GL AV+K  H
Sbjct: 472 PPNILESYYFGHYRMVDLDYIERMCEKDLAPNTKVIKSYFIDNLRHQMDSGLVAVNKKSH 531

Query: 537 TIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNGK 596
            +PL+L+AM+H+      C++GDKE FWLGF A GH +A   + +GA+G   ++ ++N  
Sbjct: 532 IVPLMLSAMLHMTDKLGSCSYGDKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNHH 591

Query: 597 RQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXXXXXXXXXXXXXE 656
            ++   EIC+  IAH+ST+   LLW NGG  +CK ++AA                    E
Sbjct: 592 LKQKKSEICTIIIAHLSTE-GNLLWANGGAEYCKFEDAA--EDDWKNEKLNMQSKYSSLE 648

Query: 657 EMEKYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCATHKTLLKPYSYNHRTTHGE 716
           E+ K  Y + +S K  I+P  K   W  +  G C GY +CA ++  +KPYS+N     G 
Sbjct: 649 EL-KSLYKSSVSVKSGIVPMDKQGAWG-SQDGRCRGYSYCARYERHIKPYSFNKMYEKGF 706

Query: 717 LITLDEEQRLHIDAVNTVWS 736
           LI    +     DA+N VW+
Sbjct: 707 LIDFHPDLTTKYDAINKVWA 726

>Kwal_23.2926
          Length = 568

 Score =  218 bits (554), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 149/500 (29%), Positives = 235/500 (47%), Gaps = 58/500 (11%)

Query: 242 FEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYEYDPS 301
           ++ + +M+PF+    T  F     K T       E G LP            FKY+YD S
Sbjct: 114 YDLDKRMYPFLRPGKTPKFQSGDLKTT------YEGGILPSMADSGS-----FKYKYDYS 162

Query: 302 KTFWANWRDMSA--KVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDELSQ 359
            T+ +NW  +S+  +   RGIVLS   +   L ++ +  L  + N LPIQV+++GD    
Sbjct: 163 DTWTSNWYRLSSQGREPTRGIVLSFPDSHVSLVIRLLKVLHHQKNELPIQVIHKGD--LS 220

Query: 360 ELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVVL 419
           E    LI  A SP                Q +WF+DVS+ ++ ++  DF  YK+KWL ++
Sbjct: 221 EASKNLISEALSPS---------------QNLWFVDVSSMLNKRFVRDFSGYKNKWLAMI 265

Query: 420 LNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRENVN-ERCIARYETLLP 478
           LN   E VF+D DA+S    ++YF+   Y +TG +F+++RA     + + C+   ++L P
Sbjct: 266 LNTFSEAVFIDADAVSMMSFEDYFEMGLYNQTGALFFKDRAFDHKFDYDFCVPMIKSLQP 325

Query: 479 RNLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTI 538
              E++ FQ+   +      N  D +  TE+ I K FF   ++HQ+++GL  ++K KH  
Sbjct: 326 GKHETRYFQHRKRLIDLQLRNTQDPS--TEQTIIKDFFEGYQRHQMDSGLVLIEKGKHLT 383

Query: 539 PLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNGKRQ 598
           PL+ A  ++LA   + CTHGDKE FWL FL   H ++     + AIG    K D NG   
Sbjct: 384 PLLAAVFLNLAPKLSKCTHGDKETFWLAFLLMNHEFSFHPEEASAIG----KADENG--- 436

Query: 599 EAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXXXXXXXXXXXXXEEM 658
               EICS Q+ H S +   LLW N G   CK  +A                      E 
Sbjct: 437 ----EICSVQLGHTSAEGD-LLWFNSGFRTCKFADAIEFDWDGYPKEDLHSRFSSL--ED 489

Query: 659 EKYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCATHKTLLKPYSYNHRTTHGELI 718
            + +Y +    +   LP+   + W       C GY +CA              + +G+L+
Sbjct: 490 ARLFYESLAEIEAAALPNKHLNPWTGGFGDHCLGYRYCAKAG-----------SGYGKLV 538

Query: 719 TLDEEQRLHIDAVNTVWSHA 738
             + + + ++  +  VW +A
Sbjct: 539 HFEPQIQKNLKEIGEVWMNA 558

>Scas_717.5
          Length = 639

 Score =  199 bits (505), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 154/582 (26%), Positives = 267/582 (45%), Gaps = 97/582 (16%)

Query: 121 DRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKDANGNPMDEKSERLYRRKYDMF 180
           D+C++   ++Y  D  W+N            EG+        +  DE  + L      + 
Sbjct: 108 DQCRYLVYSIYQQDANWSN------------EGM-----CTYHSNDELDDSL------LA 144

Query: 181 QAFERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPNYDPDNFKKYD 240
              ER+R YD CF+    +N++++F  +D +++         ++ A+             
Sbjct: 145 LMGERLRIYDYCFITGK-LNVKDVF--NDYLTENN-------SITAS------------- 181

Query: 241 QFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYEYDP 300
             +F+ +MFPF+ + + E+     P +T               + KTG+VQ   K    P
Sbjct: 182 --DFQKRMFPFLRSDSEESNELFWPIVT---------------NLKTGEVQPRPKVSVSP 224

Query: 301 SK---TFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDEL 357
            +    FW  W+  S    G+GIVL++G     +  K +  L   GN LPIQ+V  G E 
Sbjct: 225 KEFNSQFWKYWKQSSH---GKGIVLTMGERDVDMFKKQLRVLDHLGNKLPIQLVTAGSEY 281

Query: 358 SQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYK-SKWL 416
           S E +  L       DF    N         QE++ ++ S  + P++   +  +   KW+
Sbjct: 282 SPEFLKDLT------DFLKTTN---------QEVYLVEASPILDPEFVSKYIVFFFHKWI 326

Query: 417 VVLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALR-ENVNERCIARYET 475
            +LLN  +E V +D D + +  + ++FK+  Y+ TG + +++R ++ E+    C+   + 
Sbjct: 327 AILLNTFEELVLIDADVVPFVPLKSFFKSEGYKTTGLLLFKDRNMKGEHTFTYCMESLKY 386

Query: 476 LLPRNLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSK 535
           + P   E++  Q +LLID    L     T + E  ++  FF   R H +++GL  V+K++
Sbjct: 387 MEPSRQETEYIQTNLLIDSTKELPS--PTSSEEAAVYNHFFKDLRLHHVDSGLVTVNKNE 444

Query: 536 HTIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNG 595
               L+++ M+HL      C +GDKE FWLG L AG  Y++  + +G  G  + +++ N 
Sbjct: 445 KMNGLLMSFMLHLNGKIQRCVYGDKEFFWLGQLFAGQDYSIHPMDAGVAGG-IDRSNPNS 503

Query: 596 KRQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXXXXXXXXXXXXX 655
             +E    ICS QI+H+  ++K LLW NGG  FC+  N+A                    
Sbjct: 504 SPKEYF--ICSAQISHIDENQK-LLWQNGGSNFCEVSNSATSDFEKDPSYFRGRYQSM-- 558

Query: 656 EEMEKYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCA 697
            E  K  Y +P+    VI+PD  ++ W +     C  Y++CA
Sbjct: 559 -ESLKTLYDSPVKFDGVIIPDASANPWLQLK--ECSNYMYCA 597

>YIL014W (MNT3) [2651] chr9 (326101..327993) Mannosyltransferase
           that adds the final mannose to O-linked oligosaccharide
           chains [1893 bp, 630 aa]
          Length = 630

 Score =  197 bits (502), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 156/629 (24%), Positives = 266/629 (42%), Gaps = 107/629 (17%)

Query: 115 NELSLTDRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKDANGNPMDEKSERLYR 174
           NE++ +D+C++ F  LY +D +W N+     Y++   +GVD    +              
Sbjct: 100 NEIAKSDKCRYIFEVLYKIDPDWDNAQTAKFYNV---DGVDNTLAS-------------- 142

Query: 175 RKYDMFQAFERIRAYDRCFM--QANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPNYD 232
                    ER+R+YD CF+  Q +P  I                       N+T   +D
Sbjct: 143 ------LLGERLRSYDYCFLSGQLDPTAI---------------------FANSTVNPHD 175

Query: 233 PDNFKKYDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQE 292
                       +++MFPF+     E+   M P IT               D  TG+   
Sbjct: 176 -----------LQNRMFPFLKKINEESKTVMWPIIT---------------DMTTGEAVP 209

Query: 293 YFKYEYDPSK---TFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQ 349
             + + + S     FW+NW  +S    GRG VL++     PL +K +  + F  N LP Q
Sbjct: 210 APEVDMESSNFNGNFWSNWNRLS---KGRGFVLTIAEKDVPLFLKQLKVMEFSKNELPFQ 266

Query: 350 VVYRGDELSQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFG 409
           +V  G+ELS E + K+   A+  +               Q ++ +D S  +   +   + 
Sbjct: 267 IVSTGNELSAESIAKISETAKETE---------------QRVYLVDCSTVLDTNFANTYI 311

Query: 410 S-YKSKWLVVLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALR-ENVNE 467
           S +++KW+  L N  +E++ LD D + +   D +F +  Y+++G + +++R +  E   +
Sbjct: 312 SFFQNKWVATLFNTFEEYILLDADVVPFVGSDYFFDSPSYRESGILLFKDRVMENEQTFQ 371

Query: 468 RCIARYETLLPRNLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAG 527
            CI     + P   E +   + L+ D     +   +  + E  ++  FF   R H +++G
Sbjct: 372 YCIEMLNEVEPSAQERRFIGSRLVFDSSLPFS---SETSEEASVYYNFFKKLRLHHVDSG 428

Query: 528 LFAVDKSKHTIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDY 587
           L  V+K +    L+++ M++L      C +GDKE FWLG L AG  Y++  V    IG  
Sbjct: 429 LVVVNKLEKLNGLLMSFMLNLDGKLQRCVYGDKEIFWLGQLYAGQDYSINPVDGSIIGPV 488

Query: 588 VKKTDLNGKRQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXXXXX 647
            ++ + +   +     ICS QIAH S  K  LLWVNGG   CK  N+A            
Sbjct: 489 NEEPENDDGHKSGMYYICSTQIAH-SDSKNRLLWVNGGLKTCKISNSAEDDFGREPEYFK 547

Query: 648 XXXXXXXXEEMEKYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCATHKTLLKPYS 707
                       K  Y   ++ + +I+PD     W +     C  Y++CA          
Sbjct: 548 SRYGDISK---LKRIYDASLNVEGLIVPDVSVHPWMQIK--ECSNYMYCAYAT---GDGH 599

Query: 708 YNHRTTHGELITLDEEQRLHIDAVNTVWS 736
            N     G LIT  E++  +I+ ++  W+
Sbjct: 600 TNSELDEGRLITFTEKELRYINDISRTWN 628

>Kwal_55.20984
          Length = 619

 Score =  197 bits (501), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 153/645 (23%), Positives = 286/645 (44%), Gaps = 108/645 (16%)

Query: 102 SWLINKKGYYKHFNELSLTDRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKDAN 161
           +W  + +  ++ F   +L ++C  YF+  Y  + +WTN   +L +      GVD   DA 
Sbjct: 70  NWFSSHQSGWQEFRSQTLPEQCSRYFQATYAKNPDWTNDDLRLFW------GVDARDDAK 123

Query: 162 GNPMDEKSERLYRRKYDMFQAFERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLI 221
                            +    ER+R +D CF++++ + + ++ P+S  +S         
Sbjct: 124 -----------------LSNIVERVRVFDDCFIKSD-LTLNQVLPESINIS--------- 156

Query: 222 KTLNATFPNYDPDNFKKYDQFEFEHKMFPFINNFTTETFHEMVPKITS-PFGKVLEQGFL 280
                                +F H+MFPF+     E   ++ P IT    G+V+ +G  
Sbjct: 157 ---------------------DFHHRMFPFLK--VAEDATDLWPTITHLNSGQVVARGVR 193

Query: 281 PKFDHKTGKVQEYFKYEYDPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLR 340
           P +        +   +  D SK+FW NW   S    G+G+V SLG       ++ +  L 
Sbjct: 194 PHYSK-----DDDVPFSADNSKSFWQNWNSFSK---GKGLVFSLGERHLDPFLRLLKILD 245

Query: 341 FEGNTLPIQVVYRGDELSQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTI 400
            + N+LPIQ+V +  ELS   +  L    +S                 QE++++D    +
Sbjct: 246 QQNNSLPIQIVQQPHELSDAFLGNLTEFLQSSH---------------QEVYYIDCEALL 290

Query: 401 HPKWRGDFGSYKSKWLVVLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERA 460
              ++     + +KWL  + N   E V +D D + +  ++++F+  +Y+ TG + Y++R 
Sbjct: 291 DTTYKAYMTYFVNKWLASIFNTFSEVVLMDADVVPFVPVESFFQEEQYKATGVLLYKDRD 350

Query: 461 L-RENVNERCIARYETLLPRNLE-----SKNFQNSLLIDPDHAL--NECDNTLTTEEYIF 512
           + +E   + CI  ++ L P + E      +   NS ++DP   +  NE D        ++
Sbjct: 351 MPQETTFDYCITTFKLLEPSSQEVVLMNHRMKTNSSVVDPGAHIFANEKDK-------VY 403

Query: 513 KAFFHHRRQHQLEAGLFAVDKSKHTIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGH 572
             FF++   H +++GL  + K++    L+++ +++L +  ++C +GDKE FWLG L +G+
Sbjct: 404 HRFFYNETLHNVDSGLVVLHKTERLSGLLISFIMNLDQKASNCIYGDKELFWLGQLFSGN 463

Query: 573 TYALQGVYSGAIGDYVKKTDLNGKRQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHD 632
            YA+  +   A+G      D     Q+   EIC+ Q+ H S+D + LLW NGG   CK  
Sbjct: 464 DYAIDPLDGAAVGRVNLTHDKVSGHQK--YEICATQMGHGSSDGR-LLWTNGGLKACKIK 520

Query: 633 NAAXXXXXXXXXXXXXXXXXXXXEEMEKYYYITPISSKYVILPDPKSDDWHRASAGACGG 692
            AA                    EE  +  Y  P+S +  I+P+   + W +     C  
Sbjct: 521 GAA---HIDFERKPEHFEQHFGTEEKLQALYDLPLSIEGYIIPNISRNAWLKGQ--DCLE 575

Query: 693 YIWCATHKTLLKPYSYNHRTTHGELITLDEEQRLHIDAVNTVWSH 737
           Y +CA+   L++          G ++  D++    ++ ++ +W+ 
Sbjct: 576 YSYCAS--LLVED---QKEPPLGTVVVFDDDYSQQLNELSKIWNQ 615

>AAR183C [371] [Homologous to ScYIL014W (MNT3) - NSH]
           (672091..674037) [1947 bp, 648 aa]
          Length = 648

 Score =  182 bits (463), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 130/456 (28%), Positives = 210/456 (46%), Gaps = 68/456 (14%)

Query: 183 FERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPNYDPDNFKKYDQF 242
            ER+R +D CFMQ + + ++E+F +   +                              +
Sbjct: 168 LERLRVFDTCFMQGD-IGLREVFGEDINL------------------------------Y 196

Query: 243 EFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYEYDPSK 302
              H++FPF+       + E++P++       L  G      +K    ++ FK + D   
Sbjct: 197 SLHHELFPFLKK--VRDWSELLPQVLD-----LNDGSRYLLGNKLP--EQAFKVDND--L 245

Query: 303 TFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDELSQELV 362
            FW N R  S+   GRGIV ++         + +  L   GN LPI++VY+G++ S+  +
Sbjct: 246 PFWENLRRSSS---GRGIVATVADIHLDQLKRLLHVLDELGNKLPIELVYKGNDFSRLPI 302

Query: 363 DKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVVLLNL 422
            +L    R               +  Q +  +D S  +          + +KWL  + N 
Sbjct: 303 KRLKRYVRQ--------------HTKQRVRLVDCSRVLRSTHIPKIKRFMNKWLATIFNS 348

Query: 423 LQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRENVNERCIARYETLLPRNLE 482
            +E + LD+D +    ID+YFK   Y KTG +F+++R L E +   C      L P + E
Sbjct: 349 FEEIILLDVDVVPLVPIDSYFKLPGYTKTGALFFKDRTLPEYLPVSCTKAILLLPPSSEE 408

Query: 483 SKNFQNSLLI-DPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTIPLV 541
           +K + +S+    P       D T + E  +   +F  R +HQ+E GL  +++ +    LV
Sbjct: 409 NKLWGHSMRYRTPMTKAGALDRTNSAETEVMYNYFIERYRHQVETGLVVLNRKQRLFSLV 468

Query: 542 LAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNGKRQEAA 601
            + MIHL    + C HGDKE FWLG L  G+ Y++  + +  IG+  +     G+R+ AA
Sbjct: 469 TSFMIHLNLRFSECFHGDKEVFWLGQLLTGNEYSIHPMPAAIIGELQQ-----GERKLAA 523

Query: 602 VE--ICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAA 635
            E  ICS QIAH  TD  T+LW+NGG   CK + AA
Sbjct: 524 TEYRICSTQIAHPDTD-GTVLWINGGMWNCKDNKAA 558

>KLLA0D13376g 1150858..1152849 some similarities with sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3 alpha-1,
           3-mannosyltransferases responsible for adding the
           terminal mannose residues of O-linked oligosaccharides,
           hypothetical start
          Length = 663

 Score =  179 bits (454), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 167/628 (26%), Positives = 275/628 (43%), Gaps = 113/628 (17%)

Query: 117 LSLTDRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKD-ANGNPMDEKSERLYRR 175
           L L  +C+FYF +   ++  W N               D  KD  N N +D+    L   
Sbjct: 130 LPLEQKCRFYFESTLEINPTWNN---------------DHIKDFHNDNNLDDPLAEL--- 171

Query: 176 KYDMFQAFERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPNYDPDN 235
                   ERIR YD CF+    ++  ++F +S           ++K      PN     
Sbjct: 172 ------MLERIRMYDSCFISGG-LSTSKVFKRS-----------VVK------PN----- 202

Query: 236 FKKYDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFK 295
                  + E ++FPF++  T   F  + PK+      V     +P F +   + ++ +K
Sbjct: 203 -------DLESRLFPFLSKKT--PFRHLWPKMI----HVNPWTLIPSFSNPLLEGKDTWK 249

Query: 296 YEYDPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGD 355
              D + +F+ NW + +    G+GIVL+LG        K + +L    NTLPIQV++ G 
Sbjct: 250 --MDDNYSFFYNWNNFA---EGKGIVLTLGLRHGDQFKKLLLTLENLNNTLPIQVIHNGS 304

Query: 356 ELSQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSY-KSK 414
           EL++      IY   S         + N+  + Q+++F+++   I   + G +  Y  +K
Sbjct: 305 ELTE----AFIYDIHS---------FLNAKKLSQQVYFVNIEPLIDASFVGQYVHYFINK 351

Query: 415 WLVVLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRER-ALRENVNERCIARY 473
           W+ +L N   E + LD D++S+  +++YF    YQ TG + +R+R  + E     C    
Sbjct: 352 WMALLFNTFSECILLDADSVSFASLESYFDFKGYQDTGMLLFRDRNIIGEKTFIYCTDTL 411

Query: 474 ETLLPRNLESKNFQNSLLIDPDHALNECDN----TLTTEEYIFKAFFHHRRQHQLEAGLF 529
           + L P ++E  +F +     P   L E DN    TL+ EE I+  FFH+ + H +++GL 
Sbjct: 412 KKLFP-SVEETHFMSHRSTFP-LELVENDNINIDTLSMEEQIYYKFFHNLQLHHIDSGLV 469

Query: 530 AVDKSKHTIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDYVK 589
            VD+ K    L+++ M+++      C +GDKE FWLG L AG  Y++       +G    
Sbjct: 470 VVDRVKKLSSLLISTMMNIDGKLQRCVYGDKEIFWLGQLLAGEKYSIYPTEGSIMGTVKN 529

Query: 590 KTDLNGKRQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCK-HDNAAXXXXXXXXXXXXX 648
           K D          EIC  Q+AH+ST+  TLLW NGG   CK  D A              
Sbjct: 530 KPD-------DTFEICGTQMAHVSTE-GTLLWSNGGLKKCKVQDCAVADFDHDPDYFQEK 581

Query: 649 XXXXXXXEEMEKYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCATHKTLLKPYSY 708
                  ++M    Y + +S    I P+     W +     C  Y +CAT K  +     
Sbjct: 582 YGNPVALQQM----YDSSLSISGYITPNVGQYPWEKIK--ECHQYTYCATAKENV----- 630

Query: 709 NHRTTHGELITLDEEQRLHIDAVNTVWS 736
                 G ++  D +    + +V+ +W+
Sbjct: 631 ------GTIVKFDTDTISRLQSVSDIWN 652

>Scas_643.19
          Length = 657

 Score =  179 bits (453), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 155/634 (24%), Positives = 271/634 (42%), Gaps = 112/634 (17%)

Query: 111 YKHFNELSLTDRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKDANGNPMDEKSE 170
           +KH + L   D+C+F  R++Y  D +W NS             + E KD      DEK++
Sbjct: 113 WKHADRL---DQCRFLIRSMYNADMDWNNS------------NILEFKD------DEKAD 151

Query: 171 RLYRRKYDMFQAFERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPN 230
                   +    ERIR YD CF+ +  +N++++F  ++K+            +N     
Sbjct: 152 NTA-----IVLMSERIRLYDYCFI-SGKLNLKQVF--NEKLG-----------VNVA--- 189

Query: 231 YDPDNFKKYDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKV 290
                    D  +F+H+MFPF+     +                 E G +PK  +     
Sbjct: 190 ---------DVADFQHRMFPFMKKLNID-----------------EMGTIPKITNLNNGK 223

Query: 291 QE--YFKYEYDPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPI 348
            E   FK     ++ F+A+W ++S    G+GIV+++   +  L +  IA+L+   NTLPI
Sbjct: 224 DETPIFKDVKTVNENFFAHWNEVSK---GKGIVINMKETEKDLFMSLIATLQEVKNTLPI 280

Query: 349 QVVYRGDELSQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKW-RGD 407
           Q++  G +  +E  + +             N +  +T+  Q++  +D S+ +   + +  
Sbjct: 281 QIITTGQDFEKETFESM-------------NRFLQTTD--QQVSLIDCSSILDADFVKEH 325

Query: 408 FGSYKSKWLVVLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERAL-RENVN 466
             S+  KW   L N  +E V LD D++ +   + +FK  EY+  G+ F+R++ L  E   
Sbjct: 326 IASHLHKWFGTLFNTFEEVVILDADSVPFVAPETFFKNKEYKDAGSFFFRDKTLGNERTY 385

Query: 467 ERCIARYETLLPRNLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEA 526
           + CI   E + P   ES      L    +   N  ++  +    ++  FF   +   L++
Sbjct: 386 QYCIEMIEAMEPSKAESGLINTKLKFTSN---NPPEDNSSPAASVYNTFFGKYKHKNLDS 442

Query: 527 GLFAVDKSKHTIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQ---GVYSGA 583
           G+  + K +    L++  M++L      C  G+KE FWLG L AG  YA+    G  +G 
Sbjct: 443 GVVVLKKKEKLTSLLMGFMMNLDAKMKQCVSGEKELFWLGHLIAGQDYAIDQWFGTIAGT 502

Query: 584 IGDYVKKTDLNGKRQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXX 643
           +G      D      E+ + ICS Q+AH++ D   +LW+NGG   CK  N A        
Sbjct: 503 VGSMNDGKD----GAESTLYICSTQVAHVNKDDD-ILWINGGLNTCKFKNIA---SKEFE 554

Query: 644 XXXXXXXXXXXXEEMEKYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCA--THKT 701
                       E   +  Y + +    +I PD + + W +     C   ++CA      
Sbjct: 555 RSPSYFKQRYQVERNLQSVYDSAVKIDGLIKPDGRLNKWIQID--ECQRRMYCAFIGGPE 612

Query: 702 LLKPYSYNHRTTHGELITLDEEQRLHIDAVNTVW 735
             KP + +   T   L  LD++ +  +  +  VW
Sbjct: 613 AAKPGAVDDSKT---LYMLDKDGKSKLAGLTNVW 643

>YGL257C (MNT2) [1743] chr7 complement(12481..14157)
           Mannosyltransferase required for addition of terminal
           mannose residues to O-linked oligosaccharides [1677 bp,
           558 aa]
          Length = 558

 Score =  173 bits (439), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 132/507 (26%), Positives = 230/507 (45%), Gaps = 57/507 (11%)

Query: 243 EFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYEYDPSK 302
           + E K+FP+IN    ET        T+ +   +    + +FD K  +        +D   
Sbjct: 100 DIEKKLFPYINFEKLETDESAFWHTTTRWNGEVYHASMLEFDPKNHQFLRSKPINFDTGL 159

Query: 303 TFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDELSQELV 362
           +FW NW     +   +GIV+S    Q    ++ +  LRF  N  PIQ+V+  D LSQ+ +
Sbjct: 160 SFWENWLHTVTQSGSKGIVISASDVQLNETIRLLKVLRFIKNDYPIQIVHNAD-LSQDSM 218

Query: 363 DKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVVLLNL 422
             +I  ARS          D +    QE+WFL+V + ++PK+   F +Y +KWL +  + 
Sbjct: 219 KSIIKYARS---------LDTAEYPAQELWFLNVHSLLNPKYSKKFTTYSNKWLALTFSS 269

Query: 423 LQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRENV---NERCIAR--YETLL 477
            +  + +D D + +  I+ +++  E+QKTG +F+++R + +++   +E  I R      +
Sbjct: 270 FEIPILMDSDTVPFVSIEKFYELEEFQKTGVLFFKDRVISDDLFESSELKILREIVYGCI 329

Query: 478 PRNLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHT 537
             +LE ++  +  + DP  A             + +  F  + +H LE+GL  + K KH 
Sbjct: 330 GLDLEDESKIHEQVEDPVVA------------QVLENMFIKKYKHHLESGLVILHKGKHL 377

Query: 538 IPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYS---GAIGDYVKKTDLN 594
             ++ +  +  +   A   HGDK+ FWLG L + + +    V +   G +G+ V K    
Sbjct: 378 FSMLTSIALQFSP-IAEYFHGDKDFFWLGELLSNNRFTFHPVDASNIGQLGNVVSKESTG 436

Query: 595 GKRQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXXXXXXXXXXXX 654
              Q     ICS Q++H   D  +LLW+NGG   CK  +                     
Sbjct: 437 EFYQ-----ICSVQLSHTDRD-GSLLWLNGGLNICKKTSWEYDYEHRQRLNDMFQNADEL 490

Query: 655 XEEMEKYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCATHKTLLKPYSYNHRTTH 714
            E     YY +P+  + +I+PD     W   ++G C  + +C    TL K   +      
Sbjct: 491 RE-----YYASPVKLEGIIIPDTSISGW--INSGECFLFNYC----TLFKEGEF------ 533

Query: 715 GELITLDEEQRLHIDAVNTVWSHANKD 741
           G+LI   E+++L +  +  +W   NKD
Sbjct: 534 GKLIKFKEDEKLRLSQIVDIW---NKD 557

>AEL345W [2160] [Homologous to ScYIL014W (MNT3) - NSH]
           complement(1961..3898) [1938 bp, 645 aa]
          Length = 645

 Score =  169 bits (428), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 143/585 (24%), Positives = 239/585 (40%), Gaps = 96/585 (16%)

Query: 119 LTDRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKDANGNPMDEKSERLYRRKYD 178
           L +RCK YF   Y  +  W+N V  L   I                    S+  Y  K  
Sbjct: 115 LQERCKRYFELTYRKEPAWSNQVPFLSRDI-------------------ISDASYSAKL- 154

Query: 179 MFQAFERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPNYDPDNFKK 238
                ER R +  CF++ N                      L  TL+            +
Sbjct: 155 ----MERWRIFADCFIEGN--------------------EPLSTTLDG-----------R 179

Query: 239 YDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYEY 298
            D F+F+ +M+PF+       + E+ P IT      L  G      ++ G +++  +   
Sbjct: 180 VDIFDFQQRMYPFLTK--VRRWEEIWPMITD-----LNTGE----QYQPGHLKDGQRLTI 228

Query: 299 DPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDELS 358
           D + +FW NW+  S    GRGI ++ G+    +  + +  L   GNTLPI+++   D L 
Sbjct: 229 DDNLSFWKNWQLFSK---GRGITITAGAEHVEMLPRLLNVLDHIGNTLPIELINAAD-LP 284

Query: 359 QELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVV 418
              +DK+        +  +++N        Q +  +D   T+   +R     ++ KWL  
Sbjct: 285 PTTIDKIA------KYVQMKSN--------QTVRLVDCGKTLEHSYRSLITGFRHKWLAY 330

Query: 419 LLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRENVNERCIARYETLLP 478
           + N  +E VF+D+DA+ +  ++  F+   Y+  G + +R+R+      + C      ++P
Sbjct: 331 IFNTFEEAVFIDLDAVPFVDLEKLFEVEGYKSEGILMFRDRSYDGEKPDDCPKAMRIMMP 390

Query: 479 RNLESKNFQNSLLIDPDHALNECDNTL--TTEEYIFKAFFHHRRQHQLEAGLFAVDKSKH 536
              E   +Q+    D   A +E             +  +   +  H  E+GL  + K+K 
Sbjct: 391 SPKEHTMWQHGSNYDKQVAEDELTKKPRDAGAATFYIKYMEGKSFHMAESGLIVMHKNKK 450

Query: 537 TIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNGK 596
              L+++ M+H+   T  C+HGDKE  WLG L +G  Y +       IG  V +  ++  
Sbjct: 451 LPSLLISLMLHMTFETHLCSHGDKEYLWLGQLVSGENYYVDPRPPAIIG--VPQL-VSNH 507

Query: 597 RQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXXXXXXXXXXXXXE 656
            Q    +ICS QIAHM  D  ++LWVNGG   CK D                       E
Sbjct: 508 GQVDEYKICSAQIAHMD-DDGSILWVNGGLKNCKFDAV---ERDFEDYTEYFSKKYINKE 563

Query: 657 EMEKYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCATHKT 701
            ++K+Y +  +  +   +PD    DW +A    C  + WC+T K 
Sbjct: 564 NLQKFYDLE-VDMQMAFIPDFVDSDWVKAP--ECRAFTWCSTIKA 605

>AFL235W [2960] [Homologous to ScYIL014W (MNT3) - NSH; ScYER001W
           (MNN1) - NSH] complement(2..1147) [1146 bp, 381 aa]
          Length = 381

 Score =  163 bits (412), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 109/407 (26%), Positives = 183/407 (44%), Gaps = 35/407 (8%)

Query: 335 FIASLRFEGNTLPIQVVYRGDELSQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFL 394
            +A L   GNTLPI++V   +  S E + K+ +  R                  Q +  +
Sbjct: 1   LLAVLDHHGNTLPIELVLT-ESPSHERIQKIAHYLRD--------------KTKQSLRIV 45

Query: 395 DVSNTIHPKWRGDFGSYKSKWLVVLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTV 454
           D    + P +R     ++ KWL  LLN  +E VF+D+D + +  ID +F+   Y+ TG +
Sbjct: 46  DCKKILEPSYRPLIFDFRYKWLAYLLNSSEEVVFIDLDVVPFVSIDKFFEMEGYKSTGIL 105

Query: 455 FYRERALRENVNERCIARYETLLPRNLESKNFQNSLLIDPDHALNECDNTL--TTEEYIF 512
            +++R      N +C      +LP + E   +++      + A +   N         ++
Sbjct: 106 MFQDRVFNSIKNSKCRTAIHHILPSHAEQTLWKHQAKYTKEKAKHRLKNFPDDAGAASVY 165

Query: 513 KAFFHHRRQHQLEAGLFAVDKSKHTIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGH 572
             +    R H +E+GL  VDK K    L+++ M+H+  N A C++GDKE  WLG L +G 
Sbjct: 166 DRYLEGDRMHMVESGLVVVDKRKKISSLIISLMLHM--NIAECSYGDKEYLWLGQLVSGE 223

Query: 573 TYALQGVYSGAIGDYVKKTDLNGKRQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHD 632
            Y +  +    +G   +    N K+     E+CS QIAHM  D  ++LWVNGG   CK  
Sbjct: 224 DYYIHPLPPAILGMPQEVKHDNKKK----YEVCSTQIAHMDHD-GSILWVNGGMQNCKFP 278

Query: 633 NAAXXXXXXXXXXXXXXXXXXXXEEMEKYYYITPISSKYVILPDPKSDDWHRASAGACGG 692
             A                    +E+ + +Y +PI+ +   +P+    +WH  +   C  
Sbjct: 279 EFA---DSEVESNNEYFSSQHSDKEVLRKFYESPINIQMAFIPNLVDSNWH--AIATCNS 333

Query: 693 YIWCATHKTLLKPYSYNHRTTHGELITLDEEQRLHI-DAVNTVWSHA 738
           Y WCA     +KP  +   ++ G  I    + RL + + +  +W HA
Sbjct: 334 YTWCAE----IKP-DFTESSSRGNFIISGNDPRLPVYNEIKGIWMHA 375

>Kwal_55.22238
          Length = 584

 Score =  166 bits (420), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 130/477 (27%), Positives = 208/477 (43%), Gaps = 58/477 (12%)

Query: 240 DQFEFEHKMFP-FINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYEY 298
           D  + EHK+FP F  +F T             +  +L +G+ PK    +GK+      E 
Sbjct: 125 DVKKLEHKLFPMFSGDFPT----------FQRWDGLLVEGY-PKLVASSGKMTTT-NVEK 172

Query: 299 DPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDELS 358
            P  +FW   + +   + GRGIV+SLG        + +  LR  GN LPIQ+V++GD LS
Sbjct: 173 GPKASFW---KHLKESMNGRGIVISLGEGGVSDVKRLLRVLRTVGNRLPIQLVHKGD-LS 228

Query: 359 QELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVV 418
           +  + ++I   R      +  +   S   PQ+IWF+D   +++      F  + +KW+  
Sbjct: 229 RAAMQEIINIGRGDVIVEI-GDVSQSIGNPQDIWFVDAGKSVNSSSAHLFKRFSNKWIAS 287

Query: 419 LLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRENVNERCIARYETLLP 478
           L N  +E + +D DA+ +   +  F TTEY+++G +F+ +R + E +    +  Y+ L P
Sbjct: 288 LFNSFEEIILMDCDAVPFVDPELLFNTTEYKESGALFFVDRLIDEYIKTNDLKLYQKLFP 347

Query: 479 RNLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTI 538
              E        L    H L    +         + F+    +H +E+G+  + +  H  
Sbjct: 348 LENEKS------LFGLQHTLGGAVD--------LRGFYEFGYKHTMESGMVVMKREDHLP 393

Query: 539 PLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHT-YALQGVYSGAIGDYVKKTDLNGKR 597
            L+++  +   K T+   +GDKE FWLG   +G+  Y      +GAIG   + TD     
Sbjct: 394 GLLISTCLQFWKETSEPFYGDKELFWLGQSISGNGEYRFNAYPAGAIGLLNQDTD----- 448

Query: 598 QEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXXXXXXXXXXXXXEE 657
            E    ICS Q AH S D + LLW+NGG   CK                          E
Sbjct: 449 -ENLNYICSTQPAHFSKDLQ-LLWLNGGARRCK-----IPSWDMDFSKQKFLRQKYNSAE 501

Query: 658 MEKYYYITPISSKYVILPDPKS------------DDWHRASAGACGGYIWCATHKTL 702
             +  Y +PI+    I+P P+S              + +     C GY WCA  + L
Sbjct: 502 KLRDVYKSPINVNGAIIP-PRSALSVLQKLKKVKSGFQKCKRLGCAGYTWCAYDREL 557

>CAGL0H09262g complement(908258..910135) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 625

 Score =  164 bits (416), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 167/669 (24%), Positives = 286/669 (42%), Gaps = 127/669 (18%)

Query: 78  DTIPVSPLE-LVPFYDQSIDTKRSSSWLINKKGYYKHFNELSLTDRCKFYFRTLYTLDDE 136
           D  P   LE ++P +  S  T R    L+N       +++ S  D+C    + LY  D  
Sbjct: 68  DNKPFFSLENMLPSWMLSTHTAREKRVLLN-------WDKSSGFDQCAMLIKGLYN-DPN 119

Query: 137 WTNSVKKLEYSINDNEGVDEGKDANGNPMDEKSERLYRRKYDMFQ-AFERIRAYDRCFMQ 195
           W N    +++   DN  +++                     ++FQ + ER+R Y+ CF+Q
Sbjct: 120 WDNMAITIDH---DNATIND---------------------EVFQMSAERVRLYNHCFLQ 155

Query: 196 ANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPNYDPDNFKKYDQFEFEHKMFPFINNF 255
            N  +I E+F K                +  T P+            +++ +MFPF+   
Sbjct: 156 -NSYDINEMFEKY--------------RMYYTSPH------------DYQRRMFPFLRKV 188

Query: 256 TTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYEYDPSKTFWANWRDMSAKV 315
           T    + + P IT+     L  G     + +TG + +    E++ +  F A+W++   + 
Sbjct: 189 TAMDGYYIYPTITN-----LRTG-----EVQTGPIADMSYQEFNSN--FIAHWKN---EA 233

Query: 316 AGRGIVLSLGSNQFPLAVKFIASLRFE----GNTLPIQVVYRGDELSQELVDKLIYAARS 371
            GRGIV++   N      +F+ S  F     GNT PIQVV +G E+  EL+ K+   A  
Sbjct: 234 KGRGIVVTASVND----CRFLRSQFFVWKELGNTYPIQVVTKGKEMPPELIAKIKEYATE 289

Query: 372 PDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDF-GSYKSKWLVVLLNLLQEFVFLD 430
            D               QE++ +D+ N + P +   +  ++ +KW   + N  +E + +D
Sbjct: 290 AD---------------QEVYIVDLQNVLDPNYAEKYIENFHNKWYAAMFNTFEEAILVD 334

Query: 431 IDAISYEKIDNYFKTTEYQKTGTVFYRERALRE-NVNERCIARYETLLPRNLESKNFQNS 489
            D +SY   D YF++ +++KTG   +R+R + + +V+  C+      LP   E +    +
Sbjct: 335 ADVVSYVHPDEYFESADFKKTGLKLWRDRDIPDIHVHIYCLNMAPYFLPSKEEHRTLGTT 394

Query: 490 LLIDPDHALNE--CDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTIPLVLAAMIH 547
           L     + L E    +  T+E      FF  +    +++GL   +K K    L+++   H
Sbjct: 395 L----KYRLEEESLKDAGTSEADGLHKFFFEKSGSIVDSGLVVFNKKKKLHSLIISEFFH 450

Query: 548 LAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNGKRQEAAVEICSG 607
                  CT+GDKE F LG  +AG  Y+L    +  IG   + T+      +    ICS 
Sbjct: 451 TDAKFKPCTYGDKEIFMLGAYSAGVDYSLDPEAAVIIGPIRESTN------KKFNSICSA 504

Query: 608 QIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXXXXXXXXXXXXXEEMEKYYYITPI 667
           Q+ H +  +  LLW NGG   CK+ N A                    E+ EKYY  + +
Sbjct: 505 QMGH-TNGRGKLLWSNGGLQVCKNPNFA--KDDFEKDVKFMSNNYGTLEDTEKYYK-SNL 560

Query: 668 SSKYVILPDPKSDDWHRASAGACGGYIWCATHKTLLKPYSYNHRTTHGELITLDEEQRLH 727
           S    I P+  +  + +    AC  Y++C                  GEL+  D+EQR  
Sbjct: 561 SIDGFISPNVPNLKFQQQP--ACHHYMYCVHMPV--------DGEDMGELVRFDQEQRER 610

Query: 728 IDAVNTVWS 736
           ++ ++ VW+
Sbjct: 611 VNKISNVWN 619

>ABR245C [839] [Homologous to ScYIL014W (MNT3) - NSH]
           (854585..856510) [1926 bp, 641 aa]
          Length = 641

 Score =  164 bits (415), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 115/463 (24%), Positives = 198/463 (42%), Gaps = 39/463 (8%)

Query: 238 KYDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYE 297
           K D  +F  +MFPF+       + +M P IT     +  +G         G V E  + E
Sbjct: 179 KIDMHDFHQRMFPFLAK--KREWRDMWPVITDINTGMTFEG---------GAVWEGRQSE 227

Query: 298 YDPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDEL 357
            D   +FW NWR  S    G+GI +S+G     + ++ +  L + GN LPI++V +G EL
Sbjct: 228 IDDGASFWKNWRSFSH---GKGITMSVGDGHLEMLLRMLTVLDYLGNELPIEIVEKGGEL 284

Query: 358 SQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLV 417
           SQ+  DKL    R+                 Q++  +  + T+          +  KW+ 
Sbjct: 285 SQQFRDKLTEFVRN--------------KSKQKVRIISCARTLDETHARLIFGFSCKWVA 330

Query: 418 VLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRENVNERCIARYETLL 477
           ++ N  +E +FLD+DA+ Y   + +F    Y+ TG + +R+R + ++V++ C      ++
Sbjct: 331 LMFNTFEEAIFLDVDAVPYILPEQFFDMEGYKSTGIMLFRDRLIDQHVSKECPDAVRQMI 390

Query: 478 PRNLESKNFQNSLLIDPDHALNEC-DNTL-TTEEYIFKAFFHHRRQHQLEAGLFAVDKSK 535
           P   E+  + +        A  E  DNT       ++  FF     H +E+G+   +K  
Sbjct: 391 PTQEETSIWNHKAKFSGPAANKEAYDNTKDEGAAAVYDRFFRDHYYHVVESGVVVFNKKN 450

Query: 536 HTIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNG 595
               +V + M++L      C +GDKE  W+G L +   Y +       +G      +   
Sbjct: 451 KLQSIVNSFMLNLNFYYVGCFYGDKELMWVGQLLSAEDYYIHPAPPAILGS---AEEFER 507

Query: 596 KRQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXXXXXXXXXXXXX 655
           +    +  +C  QI HM  D  +LLW NGG   CK  + A                    
Sbjct: 508 EGNTVSYRVCGAQIGHMELD-GSLLWTNGGLRTCKFTDTA---EQDFSKSPEYFNPKYSS 563

Query: 656 EEMEKYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCAT 698
            +  + +Y  P+  + + +P+     W ++    C GY WC+T
Sbjct: 564 PQQLQEHYSKPLEIQLIFIPELTYSVWEKSV--ECQGYTWCST 604

>YNR059W (MNT4) [4642] chr14 (736800..738542) Protein with strong
           similarity to mannosyltransferases Mnn1p, Mnt2p and
           Mnt3p [1743 bp, 580 aa]
          Length = 580

 Score =  163 bits (412), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 125/496 (25%), Positives = 221/496 (44%), Gaps = 48/496 (9%)

Query: 245 EHKMFPFIN--NFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYEYDPSK 302
           E K+FP+IN     +E  H   P + + F     +G + +F  +          E+  S+
Sbjct: 124 ETKLFPYINFTALNSEQSHNFWP-VHTRFDGTKYRGQVLQFSSENNSFIGTSPIEFKASE 182

Query: 303 TFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGD--ELSQE 360
            FW NW + + +   +G+V+S+        ++ I  LR   N+LPI++V++ D  E SQ+
Sbjct: 183 PFWENWLNSALQRNSKGVVMSVSEYLVADTIRLIRVLRLLNNSLPIEIVHKSDLHESSQQ 242

Query: 361 LVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVVLL 420
           L   LI AAR         NY      PQE+WFLDV + ++ ++   F  + +KWL +  
Sbjct: 243 L---LIAAARESG----SLNYP-----PQELWFLDVKDMLNDEYLARFKRFSNKWLAITF 290

Query: 421 NLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERAL-RENVNERCIARYETLLPR 479
              Q  +FLD D + +  +D  ++   +++TGT+F+++R+     ++   +   + ++  
Sbjct: 291 CSFQIPIFLDSDTVPFVPLDTLYEIDGFKRTGTLFFKDRSFPTSKLSPLQVKVLKQIINN 350

Query: 480 NLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTIP 539
           +L+  +          H LN+       E  IFK     +++H +++GL   DK KH   
Sbjct: 351 SLDVSSDSEQGFEILKHNLNDEMAIDAIEALIFK-----KQKHYMDSGLVIFDKQKHFFC 405

Query: 540 LVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNGKRQE 599
           L +A M+  +       HGDKE FWL    +   +    + +  +G   K   L      
Sbjct: 406 LPIAIMLQFSP-IQEFFHGDKEWFWLSLFISKKEFTFYPIEASNVGRLEKPETLESS--- 461

Query: 600 AAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXXXXXXXXXXXXXEEME 659
               ICS Q++H       LLW+NGG + CK +                       +E+ 
Sbjct: 462 ---TICSTQLSHTDV-YGNLLWLNGGLSVCKKN----CWNYDFTKRKEIAAKYKSVDELR 513

Query: 660 KYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCATHKTLLKPYSYNHRTTHGELIT 719
            YY  +P+  + VI+PD     W + S   C  Y +C  ++          +  +G+LI 
Sbjct: 514 NYYQ-SPVKLEAVIIPDVSKSPWSQQS--ECVMYSYCTHYR----------KGQYGKLIE 560

Query: 720 LDEEQRLHIDAVNTVW 735
             + Q+ + + V  +W
Sbjct: 561 FTDSQKKYYEKVVELW 576

>CAGL0C04048g complement(399734..401596) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 620

 Score =  163 bits (412), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 161/671 (23%), Positives = 273/671 (40%), Gaps = 120/671 (17%)

Query: 81  PVSPLELVPFYDQSIDTKRSSS------WLINKKGYYKHFNELSLTDRCKFYFRTLYTLD 134
           PVSP   V  Y  + +  RSS+      +L   K     +N  S   +C    +++Y   
Sbjct: 55  PVSPFSYVNNYLLNSEKTRSSTVKKLLPFLNKPKDGLVDWNSSSKYQKCLLLVKSMYKAH 114

Query: 135 DEWTNSVKKLEYSINDNEGVDEGKDANGNPMDEKSERLYRRKYDMFQAFERIRAYDRCFM 194
             W+N      Y   DNE V++                     ++  A ERI+ Y +CF+
Sbjct: 115 PHWSNRDIMTAY---DNESVED--------------------LNLQLAGERIKIYKQCFL 151

Query: 195 QANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPNYDPDNFKKYDQFEFEHKMFPFINN 254
             N +   E F +                   + P+ D         ++F+ +MF F  +
Sbjct: 152 D-NDIEPIEFFKR------------------LSIPDVDA--------YDFQKRMFYFFRD 184

Query: 255 FT---TETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYEYDPSKTFWANWRDM 311
            T   T+ FH  +  + S  G+V+ +   PK        QEY       +     NWR +
Sbjct: 185 ITASNTDYFHPAIKNVKS--GEVVSK---PKTKLTP---QEY-------NANIIGNWRKL 229

Query: 312 SAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDELSQELVDKLIYAARS 371
           S    G+GIVL++  +  PL  +     +  GN LPIQVV++G E++ EL  K+      
Sbjct: 230 SR---GKGIVLTVSQSDVPLLRQQFRVWKELGNKLPIQVVHKGTEINAELEQKI------ 280

Query: 372 PDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKW-RGDFGSYKSKWLVVLLNLLQEFVFLD 430
                     + +  + Q+++ +D+S  I P +      ++ +KW   + N  +E + +D
Sbjct: 281 ---------KEYAIEMEQDVYVVDLSPVIDPDFAENSIQNFHNKWYAAIFNTFEELILID 331

Query: 431 IDAISYEKIDNYFKTTEYQKTGTVFYRERAL-RENVNERCIARYETLLPRNLESKNFQNS 489
            DAI Y   +++ K+  Y+KTG   +R+R +  E     C+       P  LE  N   +
Sbjct: 332 ADAIPYVPAEDFLKSKSYKKTGLRLWRDRDITHERTLHFCVEMAPYFEP-TLEEHNLIGT 390

Query: 490 LLI--DPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTIPLVLAAMIH 547
            L     D  L +  ++   E      FF     H +++GL  +DK      L+++ ++H
Sbjct: 391 TLSYRLTDSGLKDAKDS---EGRALYEFFQKMYLHHVDSGLVVIDKKDKIHSLIMSEILH 447

Query: 548 LAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNGKRQEAAVEICSG 607
                  CT+GDKE F LG    G +Y L+   +  IG       +  +++ +   IC+ 
Sbjct: 448 SHTRFGRCTYGDKELFMLGAYMVGESYTLEAQSAAIIG------TVGYEKEFSRHYICAT 501

Query: 608 QIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXXXXXXXXXXXXXEEMEKYYYITPI 667
           Q+ H   D + LLW NGG   CK D A                         K  Y + +
Sbjct: 502 QMGHSDEDNR-LLWSNGGLRTCKFDCAEEDFNKDEEYYKKRYQNVDNL----KAVYSSRL 556

Query: 668 SSKYVILPDPKSDDWHRASAGACGGYIWCATHKTLLKPYSYNHRTTHGELITLDEEQRLH 727
           +    I+PD   + W + S   C  Y++CA           N     G L+ L +E++  
Sbjct: 557 NIDGFIIPDTTVNKWLQLS--ECRQYMYCAHVDD-------NREKDKGTLVRLTDEEKQK 607

Query: 728 IDAVNTVWSHA 738
           ++ ++  W+ A
Sbjct: 608 VNRISEFWNSA 618

>Kwal_23.5454
          Length = 583

 Score =  160 bits (405), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 139/537 (25%), Positives = 222/537 (41%), Gaps = 98/537 (18%)

Query: 176 KYDMFQAFERIRAYDRCFMQA----NPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPNY 231
           K  +  + +R+R Y RCF+      N +NI ++                           
Sbjct: 98  KRQIISSVQRLRIYGRCFVSGSAPMNDINISDV--------------------------- 130

Query: 232 DPDNFKKYDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQ 291
                        E ++FP    FT E     VP  +   G + E     K   K  +V+
Sbjct: 131 -------------ESRLFPV---FTRE-----VPIFSRWDGSITEGFPEAKLSKKDYEVK 169

Query: 292 EYFKYEYDPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVV 351
           E        SK   A W+ +  + +G+GIV+S+G       ++ +  LR   NTLPIQ+V
Sbjct: 170 EEI-----ASKD--AYWKQVKERYSGKGIVISIGEGGVDEVIRLLRVLRALKNTLPIQLV 222

Query: 352 YRGDELSQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSY 411
           ++GD +S   ++ +I A R    +  +  Y + +  PQEIWF++ + +I       F  +
Sbjct: 223 HKGD-VSASSMNMIIQAGRG-KIEDKQGIYSDISEHPQEIWFVNAARSIKKGNLDLFQRF 280

Query: 412 KSKWLVVLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRENVNERCIA 471
            +KW+  L N  +E + +D D + +      F  TEY++TG  F+++R + E +    ++
Sbjct: 281 SNKWIASLFNSFEEMILMDSDVVPFLNPKELFDATEYRETGAYFFKDRPIDEFLRSSDLS 340

Query: 472 RYETLLPRNLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAV 531
            Y  LLP   E   F+   L D  +                  F  H  +H +E+G+  +
Sbjct: 341 FYRKLLPSEWEYTAFEMQPLTDHTYG---------------NGFLKHGYKHFMESGVVVL 385

Query: 532 DKSKHTIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGH-TYALQGVYSGAIGDYVKK 590
           ++  H   L+++A + L K T+   +GDKE FWLG   AG+  Y      +GAIG   KK
Sbjct: 386 NRRNHMPGLLISATMQLWKETSQPIYGDKELFWLGQSIAGNENYRFNKNEAGAIG---KK 442

Query: 591 TDLNGKRQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXXXXXXXX 650
              N    E    +CS Q AH   ++  LLW NGG   CK  +                 
Sbjct: 443 GVYNSNNIEY---VCSVQPAHFD-NELNLLWTNGGLRNCKKGS----WNRDFAENKYLRR 494

Query: 651 XXXXXEEMEKYYYITPISSKYVILP----------DPKSDDWHRASAGACGGYIWCA 697
                EE++KYY         +I P            K   + +     C GY+WCA
Sbjct: 495 KYHNVEELKKYYQSPLELDGAMIAPRSHLNFFERIQGKKVGFQKCPHMGCMGYVWCA 551

>CAGL0C03960g complement(389250..391121) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 623

 Score =  156 bits (394), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 156/636 (24%), Positives = 258/636 (40%), Gaps = 115/636 (18%)

Query: 112 KHFNELSLTDRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKDANGNPMDEKSER 171
           K+++  S  D+CK+  R +YT D  WTN +  LE++   N+  D+ K             
Sbjct: 96  KNWDNSSRKDKCKWLIRGIYT-DSNWTN-IDILEWT---NDATDKNK------------- 137

Query: 172 LYRRKYDMFQAF-ERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPN 230
                   FQ   ER+R Y+ CFM  N ++  E+F +                LN  F  
Sbjct: 138 --------FQVCSERVRIYNYCFMNGN-IDPVEVFDE----------------LNIPFA- 171

Query: 231 YDPDNFKKYDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKV 290
                    D ++F+ +MF F+          M P I     K +  G +          
Sbjct: 172 ---------DPYDFQSRMFMFLKKVNRNDKAYMYPLI-----KNVRNGDIIAKPRTKMSA 217

Query: 291 QEYFKYEYDPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQV 350
           +EY       +  F  +W+   A+  GRGI L++  +   L       L   GN  P++V
Sbjct: 218 KEY-------NANFMGHWK---AEARGRGITLTVAPDDIKLLRSLFKVLEKLGNEYPVEV 267

Query: 351 VYRGDELSQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKW-RGDFG 409
           V++G E++ ++ D +               Y   TN  QE++ +++S  + P +   +  
Sbjct: 268 VHKGGEMTPKMEDLI-------------RQYAEETN--QEVYVINLSPILDPDFAEENIK 312

Query: 410 SYKSKWLVVLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRE-NVNER 468
            + +KWL  + N  +E + LD D + Y   D++F+   YQ TG + +++R + + +V ++
Sbjct: 313 RFSNKWLAAMFNTFEEVMLLDADVVLYNHPDHFFELKGYQDTGLMLWKDREITDTDVYDK 372

Query: 469 CIARYETLLPRNLESK---NFQNSLLIDPD-HALNECDNTLTTEEYIFKAFFHHRRQHQL 524
           C A      P   E K     Q   L  P   A NE + T   +      +F  +R + +
Sbjct: 373 CTAMAPFFEPSLEEHKLLGTTQKYRLTGPSLEAHNESEATTLID------YFRKKRLNVI 426

Query: 525 EAGLFAVDKSKHTIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAI 584
           ++G+   +K +    LVL+   H+ +    C HGDKE F  G LAAG  Y +    + A+
Sbjct: 427 DSGVVIFNKKQKLHALVLSNYYHINRKFLGCVHGDKEFFEFGVLAAGEDYHIAPQRAAAL 486

Query: 585 GDYVKKTDLNGKRQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXX 644
           G        +  RQ+  V  CS Q+ H   +   +LW NGG   CK D A          
Sbjct: 487 G----PIGFHPGRQKYYV--CSTQMGH-PDENNNILWSNGGLKNCKLDKAEADFKRHPEY 539

Query: 645 XXXXXXXXXXXEEMEKYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCATHKTLLK 704
                          K YY   +  +  I+PD K  +W +     C  Y +CA  +    
Sbjct: 540 FKAKYGNVATA----KVYYTYRVEIQGFIIPDVKKQEWFQYP--DCAHYWYCAFLEDTPD 593

Query: 705 PYSYNHRTTHGELITLDEEQRLHIDAVNTVWSHANK 740
             S       G+L+   E++    + +   W H  K
Sbjct: 594 SLS------TGKLVKFTEKEIERYNDIGKAWYHGTK 623

>CAGL0H09240g complement(905670..907598) some similarities with
           sp|P40549 Saccharomyces cerevisiae YIL014w MNT3,
           hypothetical start
          Length = 642

 Score =  154 bits (390), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 149/641 (23%), Positives = 265/641 (41%), Gaps = 115/641 (17%)

Query: 113 HFNELSLTDRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKDANGNPMDEKSERL 172
           ++N+ S  D+C+   +  YT D++W N      +S  D                      
Sbjct: 105 NWNKGSRFDQCRLLVKGFYT-DEKWNNMNLVYAWSSKD---------------------- 141

Query: 173 YRRKYDMFQAFERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPNYD 232
           Y  K   F A E +R Y+ CF + + VN +E+F K D              L AT     
Sbjct: 142 YMEKTAQF-AGECMRIYNYCFFEGD-VNPRELFKKLD--------------LQAT----- 180

Query: 233 PDNFKKYDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQE 292
                  D ++F+ +MF F+ N T E    + P I +                +TG+V  
Sbjct: 181 -------DAYDFQKRMFFFLKNVTQEDSDYLYPTIKNV---------------RTGEVVS 218

Query: 293 YFKYEYDPSK---TFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQ 349
             K +  P +    F+ANWR +++   GRGIVLS   +   +  + ++  +  GN  PIQ
Sbjct: 219 KPKTKQSPQEFNSNFFANWRKIAS---GRGIVLSAKPDDIDMLRQQLSVWKELGNKYPIQ 275

Query: 350 VVYRGDELSQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGD-F 408
           VV++G EL+++    L   A   D               Q I+ +D    +   +  +  
Sbjct: 276 VVHKGGELTRDNEISLKQFAEETD---------------QNIYIVDAGPVLDKNFADEHI 320

Query: 409 GSYKSKWLVVLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERAL-RENVNE 467
             + +KW+ VL N  +E++ +D D + +   +++F++  ++K+G   +R+R L   ++ E
Sbjct: 321 TKFHNKWVGVLFNTFEEYIMVDADTVPFISAEDFFESENFKKSGMRMWRDRTLTNRHIRE 380

Query: 468 RCIARYETLLPRNLESKNFQNSL---LIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQL 524
            C      L P   E +    +L   L+DPD          T+EE  F     +   H +
Sbjct: 381 HCPDLALKLEPSLEEHRILGTTLRFKLLDPD-----LKQEKTSEERAFNQMRTNLALHHV 435

Query: 525 EAGLFAVDKSKHTIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAI 584
           ++GL  ++K +    L+L+           C++GDKE FW    +A   Y ++   +  I
Sbjct: 436 DSGLVVINKKEKLHSLLLSEFFQNHALFRRCSYGDKELFWYAAFSANTDYVIEPEDAATI 495

Query: 585 GDYVKKTDLNGKRQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXX 644
           G       L    ++    IC+ Q+AH  ++ + LLW N G   CK    A         
Sbjct: 496 G------KLEYSEKDRRYSICAIQMAHTDSNDQ-LLWTNTGLRNCKIPEVAKKDFDENPK 548

Query: 645 XXXXXXXXXXXEEMEKYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCATHKTLLK 704
                       E+ K  Y  P+     ++PDP+  +W +     C  Y +C     L  
Sbjct: 549 MMTEKYGSL---EVMKISYHAPLQIDGYLIPDPEEHEWQQTH--VCADYTYCGFVDELNI 603

Query: 705 PYSYNHRTTHGELITLDEEQRLHIDAVNTVWSHANKDNTRS 745
            YS        ++    +E++  ++ ++ +W++A+ +  R+
Sbjct: 604 GYS------KAKVHEFSDEEKKRLNKISKIWNNADVNKERN 638

>CAGL0C04004g complement(394614..396512) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 632

 Score =  154 bits (388), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 143/656 (21%), Positives = 269/656 (41%), Gaps = 112/656 (17%)

Query: 83  SPLELVPFYDQSIDTKRSSSWLINKKGYYKHFNELSLTDRCKFYFRTLYTLDDEWTNSVK 142
           S L+L+PF     D +        ++    H+ + +  D+C    + LY   D W+N   
Sbjct: 86  SLLKLIPFLGNGKDAR--------ERKVLAHWAQANRKDQCPQLIKGLYATPD-WSN--- 133

Query: 143 KLEYSINDNEGVDEGKDANGNPMDEKSERLYRRKYDMFQAFERIRAYDRCFMQANPVNIQ 202
                   NE V   K      +DE          +M  + ERIR Y+ CF++   +++ 
Sbjct: 134 --------NEIVAAHKKVR---VDE---------INMQVSVERIRIYNYCFLEGG-LDVT 172

Query: 203 EIFPKSDKMSKERVQSKLIKTLNATFPNYDPDNFKKYDQFEFEHKMFPFINNFTTETFHE 262
           E+   +                              YD F+F+ +MF F+   T      
Sbjct: 173 EVLKDA--------------------------GLSSYDAFDFQSRMFIFLKQVTKTDAKY 206

Query: 263 MVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYEYDPSKTFWANWRDMSAKVAGRGIVL 322
           + P I +     L    +      T   Q++       +  F ANWR ++    G+GI +
Sbjct: 207 LYPIIQN-----LNTEEIISEPTTTKSPQDF-------NANFMANWRQLAN---GKGIAI 251

Query: 323 SLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDELSQELVDKLIYAARSPDFKPVENNYD 382
           ++  +     ++    L+  GNT PIQV+ +G EL+  L++++   A       +E N  
Sbjct: 252 TVNPDDVEFMIRLFRVLKELGNTYPIQVIQKGGELTSPLIEQIKKTA-------IETN-- 302

Query: 383 NSTNVPQEIWFLDVSNTIHPKW-RGDFGSYKSKWLVVLLNLLQEFVFLDIDAISYEKIDN 441
                 Q +  +D+S  +  K+ R    S+ +K+   + N  +E + LD D + Y  +D 
Sbjct: 303 ------QAVSIVDLSPILDEKFAREQITSFHNKFFAAMFNTFEEVLLLDADVVPYVSLDE 356

Query: 442 YFKTTEYQKTGTVFYRERALRENVNERCIARYETLLPRNLESKNFQNSLLIDPDHALNEC 501
           +F    Y+ TG  F+R+R    + ++ C +     L  +LE  N   + L    ++L + 
Sbjct: 357 FFNLKGYKDTGLQFWRDRNRGSDTHKFC-SNLGVYLEPSLEEHNLLGTELKFRINSLAK- 414

Query: 502 DNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTIPLVLAAMIHLAKNTAHCTHGDKE 561
               ++EE  F  FF+  + H +++G+  ++K +    L++  + +       C +GDKE
Sbjct: 415 KKVRSSEERAFHRFFNELKVHNIDSGIIVLNKKQKLHSLIMGEIFYTNGRFGRCAYGDKE 474

Query: 562 NFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNGKRQEAAVEICSGQIAHMSTDKKTLLW 621
            F +G  A G  + +    +G IG      D      +    ICS Q+ H+  + + +LW
Sbjct: 475 MFMMGAFATGADFIIDPRDAGIIGPIGYNID------QRVNFICSAQMGHLDENNR-VLW 527

Query: 622 VNGGGTFCKHDNAAXXXXXXXXXXXXXXXXXXXXEEMEKYYYITPISSKYVILPDPKSDD 681
            NGG  FCK  + A                    + M + Y  T +     I+P+ + ++
Sbjct: 528 SNGGLRFCKFPDFA-KKDYTPKNQDYFIQKYQSYDNMARIYK-TKVEITGFIIPEVEKNE 585

Query: 682 WHRASAGACGGYIWCATHKTLLKPYSYNHRTTHGELITLDEEQRLHIDAVNTVWSH 737
           W +     C  Y++C   K +          T   ++  + E++  ++ ++ VW++
Sbjct: 586 WMQIP--DCQSYMYCGLAKKV---------DTKALILKFEGEEKERLNRISDVWNN 630

>CAGL0C03938g complement(386673..388586) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 637

 Score =  151 bits (382), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 151/631 (23%), Positives = 254/631 (40%), Gaps = 115/631 (18%)

Query: 112 KHFNELSLTDRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKDANGNPMDEKSER 171
           K++   SL D+C++  R +Y+    W N                          D     
Sbjct: 109 KNWESSSLNDKCRWLVRGIYS-SSAWNN-------------------------FDITKNY 142

Query: 172 LYRRKYDMFQAF-ERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPN 230
            +   Y+ FQA  ER+R Y+ CFM  N ++  E+F +                LN  F  
Sbjct: 143 KFETAYEKFQAVTERVRIYNYCFMNGN-IDPVEVFDE----------------LNIPFA- 184

Query: 231 YDPDNFKKYDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKV 290
                    D ++F+ +MF F+          M P I     K +  G +          
Sbjct: 185 ---------DPYDFQSRMFMFLKKVNRNDKAYMYPLI-----KNVRNGDIIAKPRTKMSA 230

Query: 291 QEYFKYEYDPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQV 350
           +EY       +  F  +W+   A+  GRGI L++  +   L       L   GN  P++V
Sbjct: 231 KEY-------NANFMGHWK---AEARGRGITLTVAPDDIKLLRSLFKVLEKLGNEYPVEV 280

Query: 351 VYRGDELSQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRG-DFG 409
           V++G E++ ++ D +               Y   TN  QE++ +++S  + P +   +  
Sbjct: 281 VHKGGEMTPKMEDLI-------------RQYAEETN--QEVYVINLSPILDPDFASQNIK 325

Query: 410 SYKSKWLVVLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRE-NVNER 468
           S+K+KW   + N  +E + LD+D + Y   + +F+   Y+KTG + +++R   E   ++R
Sbjct: 326 SFKNKWFAAMFNTFEEAILLDVDVVLYASPEYFFELDGYKKTGLMLWKDREYTEVETSDR 385

Query: 469 CIARYETLLPRNLESK---NFQNSLLIDPD-HALNECDNTLTTEEYIFKAFFHHRRQHQL 524
           C +      P   E +     Q   L  PD    NE + T   +      FF+++    +
Sbjct: 386 CASMAPYFEPSEEEHELLGTIQKYRLTGPDLETHNESEATTLND------FFNNKLATII 439

Query: 525 EAGLFAVDKSKHTIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAI 584
           ++G+  ++K +    L+LAA  H++K    CT+GDKE F +  LAAG  Y +    +GAI
Sbjct: 440 DSGVVLINKKQKLNALLLAAYYHMSKYFGGCTYGDKELFEIAALAAGEDYYVDPNKAGAI 499

Query: 585 GDYVKKTDLNGKRQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXX 644
           G        +  R++  V  CS Q+ H   +   LLW NGG   CK D+A          
Sbjct: 500 G----PIGYHPPREKYYV--CSAQMGH-PDENNNLLWSNGGLKNCKLDSAEADFKKLPKY 552

Query: 645 XXXXXXXXXXXEEMEKYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCATHKTLLK 704
                       +  K YY      +  I+PD     W +     C  Y++CA    +  
Sbjct: 553 FKAKYGSL----DTVKLYYKGRSEIQGFIVPDIVKQKWIQYP--DCQHYLYCA---FITD 603

Query: 705 PYSYNHRTTHGELITLDEEQRLHIDAVNTVW 735
           P         G+L+   EE+    + +   W
Sbjct: 604 P---PEDDNTGKLVRFSEEEMEKYNEIGRAW 631

>CAGL0C03916g complement(383989..385875) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 628

 Score =  149 bits (377), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 161/639 (25%), Positives = 259/639 (40%), Gaps = 119/639 (18%)

Query: 112 KHFNELSLTDRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKDANGNPMDEKSER 171
           K++N  S  D+CK+  R +Y  D  W N    +        G DE  D N          
Sbjct: 100 KNWNTSSRVDKCKWLIRGIYA-DPNWNNRDILI--------GSDETNDKN---------- 140

Query: 172 LYRRKYDMFQAFERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPNY 231
               K+ +  + ERIR ++ CFM                  KER+    ++  N      
Sbjct: 141 ----KFHL--SSERIRIHNYCFM------------------KERIDP--VQMFNEL---- 170

Query: 232 DPDNFKKYDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQ 291
              N    D ++F+ +MF F+ N T+     + P I     K +  G +    H      
Sbjct: 171 ---NISSTDAYDFQGRMFMFLRNVTSTDEAYIYPII-----KNVRNGQVTTKPHTKLSPM 222

Query: 292 EYFKYEYDPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASL--RFE--GNTLP 347
           +Y       +  F A W+  S    GRGI L+      P  VK + SL   FE  GNT P
Sbjct: 223 QY-------NSNFMAYWKQESK---GRGIALTAA----PKDVKLLRSLFKVFEKLGNTYP 268

Query: 348 IQVVYRGDELSQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGD 407
           IQ+V +G E+S             P  + +  +Y   TN  Q ++ +D+S  + P +  D
Sbjct: 269 IQIVQKGGEMS-------------PTMESLIKDYAIETN--QNVFIVDLSPVLDPDFATD 313

Query: 408 -FGSYKSKWLVVLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRE-NV 465
               +++KW   + N  +E + +D D + Y + +++F    Y+ TG + +R+R + +   
Sbjct: 314 HIRKFQNKWFASIFNTFEEVMLIDADVVIYTEPESFFNLDGYKNTGLLLWRDREIVDAKT 373

Query: 466 NERCI---ARYETLLPRNLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQH 522
           +ERC      +E  L  +      Q   L  P  +L   D      E +F  FFH R   
Sbjct: 374 HERCTDMAPYFEPALEEHRLLGTVQKYRLTGP--SLETHDEP--EAETLFD-FFHRRIVT 428

Query: 523 QLEAGLFAVDKSKHTIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSG 582
            +++G+   +K +    L+LA   H +K  A C +GDKE F  G L AG  Y ++   + 
Sbjct: 429 IIDSGVVIYNKKQKLHGLILAEYFHNSKQFAGCVYGDKEYFEFGALVAGEDYHVEAEKAV 488

Query: 583 AIGDYVKKTDLNGKRQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXX 642
           AIG        +  R++  V  CSGQ+ H+  +   LLW NGG   CK D A        
Sbjct: 489 AIG----AVGYHPPREKYYV--CSGQMGHVDRN-NNLLWSNGGLKNCKSDCAEADFEKMP 541

Query: 643 XXXXXXXXXXXXXEEMEKYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCATHKTL 702
                        +E    YY   +  +  +LPD +   W       C  +++CA     
Sbjct: 542 KYFKAKYGTLKAVKE----YYNGLMDIQGFVLPDVQKQKW--VQYPDCQQFLYCAFITDP 595

Query: 703 LKPYSYNHRTTHGELITLDEEQRLHIDAVNTVWSHANKD 741
            +P         G+L+   +E+++  + +   W     D
Sbjct: 596 PEP------DNKGKLVRFSDEEKMRYNEIGKAWYSGAND 628

>CAGL0G04279g complement(404144..406126) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 660

 Score =  142 bits (359), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 131/532 (24%), Positives = 226/532 (42%), Gaps = 108/532 (20%)

Query: 113 HFNELSLTDRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKDANGNPMDEKSERL 172
           ++N  S  DRC    + LY  D +W NS           E +   KD            +
Sbjct: 116 YWNAASDLDRCSLLVKALYDGDPKWNNS-----------EILVWNKD------------M 152

Query: 173 YRRKYDMFQAFERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPNYD 232
             +KY +    ERIR Y+ CF+    V++ ++F K             +   NAT     
Sbjct: 153 AMKKYSLLHPVERIRMYNHCFLDKG-VDVIQVFKKLG-----------LDEHNAT----- 195

Query: 233 PDNFKKYDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKV-- 290
                     EF H+MFP        +   + PK+T               D +TGKV  
Sbjct: 196 ----------EFNHRMFPMFQFVNVTSDQYLYPKLT---------------DLRTGKVIT 230

Query: 291 -----QEYFKYEYDPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNT 345
                Q   +Y  +    F  NWR+   +  G+G+V+++ SN   +  K    L+  GNT
Sbjct: 231 KPKTKQRALEYNLN----FLRNWRN---EAKGKGLVITIESNNLHILRKLFKFLKENGNT 283

Query: 346 LPIQVVYRGDELSQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKW- 404
           LPIQ+V++ +       D +I  A   D               Q +  +++   I   + 
Sbjct: 284 LPIQLVFKRNVTLARFKDAIISYAEESD---------------QHVTIIEIEALIDDSFN 328

Query: 405 RGDFGSYKSKWLVVLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALREN 464
           +G F  Y  K+L  + N  ++ V +DI+ I Y   +   +  EY+ +G   +R++ L   
Sbjct: 329 KGTFVGYDDKFLASIFNTFEDVVMMDIEVIPYVNPEELLENEEYKNSGLYMWRDKYLGAL 388

Query: 465 VNER-CIARYETLLPRNLESKNFQNSL-LIDPDHALNECDNTLTTEEYIFKAFFHHRRQH 522
           ++   C    ++L P   E K   +   L   D  L +  + +     I   +++    H
Sbjct: 389 LHAYICTDVMKSLEPSMDEYKTIGSKFPLRMNDPRLTDTSDPMGA---ILHGYYNLYLMH 445

Query: 523 QLEAGLFAVDKSKHTIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSG 582
           Q++ G+  ++K +    L++  ++++ ++ AHC+ G KE FW G   AG  +A+  + +G
Sbjct: 446 QVDGGVILLNKKQKLGGLIMGMVMNMHRDYAHCSTGTKEAFWFGPYVAGMEFAVGTIDAG 505

Query: 583 AIGDYVKKTDLNGKRQEAAVEICSGQIAHMSTDKKTLLWVNGGGTF--CKHD 632
            IG  ++++ +  +      EICS Q+ H+  + K LLW  G GTF  C+ D
Sbjct: 506 IIGP-IRRSTIEDRL--GVPEICSNQVIHVDHEDK-LLW--GKGTFYECESD 551

>CAGL0C03894g complement(381514..383397) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 627

 Score =  133 bits (335), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 89/334 (26%), Positives = 148/334 (44%), Gaps = 27/334 (8%)

Query: 304 FWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDELSQELVD 363
           FW NW+  +    GRGIV++    +  + +K IA L    N LPIQ+V +G++     ++
Sbjct: 212 FWINWKKHAR---GRGIVVTFKEEEANMMMKLIAVLGHLKNRLPIQIVIQGNKFGSRTIE 268

Query: 364 KLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKW-RGDFGSYKSKWLVVLLNL 422
            L                + +    Q+I+ +D +  +  K+       Y +KW+  + N 
Sbjct: 269 ML---------------KEKAIEKKQQIYIVDATKLLMEKYAEVHIQGYTNKWIASIFNT 313

Query: 423 LQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERAL-RENVNERCIARYETLLPRNL 481
            +EF+ LD+D + +     +F+   Y+ TG   Y++R L  E +  +C+           
Sbjct: 314 FEEFILLDVDTVPFINPKKFFEKKGYRTTGFYMYQDRNLVNEKLGRKCVDIISGAQLSGY 373

Query: 482 ESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTIPLV 541
           E++      L  P  A    D+  T     +   F++   HQ E+ L  ++K +    L+
Sbjct: 374 EARVLNTGFLYSPYFARE--DDYTTASARAYYKLFNNWTLHQAESVLVVINKKQKLGGLL 431

Query: 542 LAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNGKRQEAA 601
           ++ M++       C  GDKE FW+G L     Y +    +  +G     TD     Q   
Sbjct: 432 MSFMLNTQIALKQCFLGDKEFFWIGQLMNNSPYYIDERPATIVGPLSSPTD----EQSNY 487

Query: 602 VEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAA 635
            +ICS Q+ H+  D K L WVNGG   CK  NAA
Sbjct: 488 YKICSAQLGHLGEDGK-LDWVNGGMQVCKFKNAA 520

>CAGL0C03982g complement(391909..393798) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 629

 Score =  129 bits (324), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 136/590 (23%), Positives = 233/590 (39%), Gaps = 105/590 (17%)

Query: 113 HFNELSLTDRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKDANGNPMDEKSERL 172
           H+N  S  D+CK+   +LY+ D  W N     EYS N                       
Sbjct: 101 HWNTSSRQDKCKWLISSLYS-DPNWDNR-DIFEYSKNGQ--------------------- 137

Query: 173 YRRKYDMFQAFERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPNYD 232
           Y   + +  A E +R Y+ CF+  N +N  + F                  L+  F    
Sbjct: 138 YNNTFKV--AAENLRIYNYCFLNGN-INPLQFF----------------DDLSIPFT--- 175

Query: 233 PDNFKKYDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQE 292
                  D ++F+ +M  F+   +++    + P I     K +  G +          +E
Sbjct: 176 -------DAYDFQKRMVIFLRKTSSDDEAYLYPLI-----KNVRNGEIIAKPPTKLSPRE 223

Query: 293 YFKYEYDPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVY 352
           Y       +  F  +W+  S    G+GI L++      L       L+ +GN  P+Q++ 
Sbjct: 224 Y-------NSNFMGHWKRESK---GKGITLTIAPGDIKLLRSLFKVLQRQGNEYPVQIIQ 273

Query: 353 RGDELSQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWR-GDFGSY 411
           +G E++             P  + +   Y   T   Q+++ +D++  + P +       +
Sbjct: 274 KGGEMT-------------PKMESLIKKYALETE--QDVYIIDLAPILDPAFAIQRITKF 318

Query: 412 KSKWLVVLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRE-NVNERCI 470
           ++KW   + N  +E + LD D + Y + +++FK   YQ TG + +R+R L      +RC 
Sbjct: 319 QNKWFASMFNTFEEALLLDADVVLYTEPEHFFKMKGYQDTGLLLWRDRELTALETPDRCA 378

Query: 471 ARYETLLPRNLESKNFQNSLL-IDPDHALNECDNTL--TTEEYIFKAFFHHRRQHQLEAG 527
           A     L  +LE    + SLL     + L E    +    E      +FH +    +++G
Sbjct: 379 A-----LAPHLEPSVEEYSLLGTRQKYRLTESSLKIHNEPEARTLYEYFHKKIVTIIDSG 433

Query: 528 LFAVDKSKHTIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDY 587
           +   +K +    L+ A   H+++  A C +GDKE F  G  AAG  Y ++   + AIG  
Sbjct: 434 VVVYNKRQKLHALMTAEYFHISRKFAGCVYGDKEYFEFGAFAAGEDYHIEKDKASAIG-- 491

Query: 588 VKKTDLNGKRQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXXXXX 647
                +     +    ICS Q+ H + +   LLW NGG   CK ++AA            
Sbjct: 492 ----SIEYHSAKDKYYICSAQMGH-ADENNNLLWSNGGLMNCKANSAADDFNENPKYFKA 546

Query: 648 XXXXXXXXEEMEKYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCA 697
                   E     +Y  PI  +  I+PD    +W       C  Y++CA
Sbjct: 547 KYGDVKTLEA----HYSKPIDIQGFIIPDISKHNW--IQYPECKRYVYCA 590

>CAGL0C04026g complement(397303..399213) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 636

 Score =  125 bits (314), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 141/648 (21%), Positives = 250/648 (38%), Gaps = 130/648 (20%)

Query: 105 INKKGYYKHFNELSLTDRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKDANGNP 164
           ++++    ++++ S  D+C    +  Y LD +W N+                        
Sbjct: 104 LHERSVLSNWDKASKADQCALLLQGFY-LDPKWDNA------------------------ 138

Query: 165 MDEKSERLYRRKY-DMFQAFERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLIKT 223
            D  +ER  +  Y +M  A ER+R Y  CFM  + ++I + F  +               
Sbjct: 139 -DILTEREEKEDYRNMQLAIERMRTYKYCFMDED-IDILDTFKAA--------------- 181

Query: 224 LNATFPNYDPDNFKKYDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKF 283
                       F   + + F+ K+F F+      T   + P+I +     L  G + + 
Sbjct: 182 -----------GFSPNEAYVFQKKLFMFLKQTDGSTTEYLYPRIEN-----LRTGVITEE 225

Query: 284 DHKTGKVQEYFKYEYDPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEG 343
                 V EY       +  F   WR+M+    G+GI +S+   +  +     A L  +G
Sbjct: 226 PTTDLSVSEY-------NAKFIPTWRNMAK---GKGIAVSVSPKEIRMLHSLFAVLNQQG 275

Query: 344 NTLPIQVVYRGDELSQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPK 403
           N LPIQ++ +G+ L+  L DK +  +           Y   TN  Q++  +D+S  I  +
Sbjct: 276 NKLPIQIIDKGETLT--LADKELIKS-----------YAVKTN--QDVSVVDLSPIIDAE 320

Query: 404 WRGD-FGSYKSKWLVVLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALR 462
           +  +      +KW   + N  +E + LD+D I +   + +F+   Y     +F+R R ++
Sbjct: 321 YADENIIGMHNKWFAAMFNTFEEVLLLDVDVIPFVGTEKFFQLEPYTSRHILFWRNRDIK 380

Query: 463 ENVNERCIARYETLLPRNLESKNFQNSLLIDPDHAL--NECDNTLTTEEYIFKAFFHHRR 520
           +   + C      L P   E       L  D  H L   +  N  T+E+     F   R+
Sbjct: 381 KKNPKYCPEAAIFLEPTTEE----HQVLKTDLHHKLFTKQVRNPATSEDKALSEFCFQRK 436

Query: 521 QHQLEAGLFAVDKSKHTIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVY 580
            + ++ GL   +K        +  ++H       C     +   LG  AAG T+ L    
Sbjct: 437 SNHVDPGLIVFNKKLRFQTFAITELLHQHDTFRACVGTGADALILGAFAAGETFRLDPRD 496

Query: 581 SGAIG--DYVKKTDLNGKRQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKH------D 632
           +G +G   Y +   +N         +C  QIAH + DK  LLW++GGG  CK+      D
Sbjct: 497 AGIVGSISYSEADKMNF--------VCGTQIAH-NDDKDNLLWISGGGRTCKNPDLLVED 547

Query: 633 NAAXXXXXXXXXXXXXXXXXXXXEEMEKYYYITPISSK--YVILPDPKSDDWHRASAGAC 690
            AA                     ++    Y+ P  S+  +V++PD             C
Sbjct: 548 FAADEEYYEVRYGNYGNAETIYKSKIRIDGYLAPKVSQKEWVVIPD-------------C 594

Query: 691 GGYIWCATHKTLLKPYSYNHRTTHGELITLDEEQRLHIDAVNTVWSHA 738
           G  + CA   + +K +S       G  I  ++E +  +  +  +W +A
Sbjct: 595 GNTMRCAFVDSNVKDFS-------GRSIKYNDETKSRVTNLIDIWYNA 635

>ADR020C [1761] [Homologous to ScYIL014W (MNT3) - SH]
           (740415..742229) [1815 bp, 604 aa]
          Length = 604

 Score =  105 bits (261), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 122/553 (22%), Positives = 201/553 (36%), Gaps = 102/553 (18%)

Query: 85  LELVPFYDQSIDTKRSSSWLINKKGYYKHFNELSLTDRCKFYFRTLYTLDDEWTNSVKKL 144
           L+  P +    D+ RS          +  + E SL  RCK YFR  Y + + W N +   
Sbjct: 51  LKFSPLFMLDTDSYRSP---------FGGWGERSLRMRCKTYFRQTYEVHNAWENRLLL- 100

Query: 145 EYSINDNEGVDEGKDANGNPMDEKSERLYRRKYDMFQAFERIRAYDRCFMQANPVNIQEI 204
                                  ++E  Y +      A ER+R YD CF+          
Sbjct: 101 -----------------------RNEDQYFKDIVASLAMERLRVYDECFISGGLA----- 132

Query: 205 FPKSDKMSKERVQSKLIKTLNATFPNYDPDNFKKYDQFEFEHKMFPFIN-NFTTETFHEM 263
                      V   +++ L                + E   +MFPF+  +   +     
Sbjct: 133 -----------VHDSMLEPLT---------------RIELRTRMFPFLAPSHRQDLIWPT 166

Query: 264 VPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYEYDPSKTFWANWRDMSAKVAGRGIVLS 323
           V   TS  G+ + +         TG++     +   P ++FW NWR+ +    GRGI ++
Sbjct: 167 VINATS--GRHIRR----LLKISTGEL-----HRIRPDRSFWYNWREFAN---GRGIAVA 212

Query: 324 LGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDELSQELVDKLIYAARSPDFKPVENNYDN 383
           +           +A L   GNTLP+Q  + G ELSQ   D+L    ++            
Sbjct: 213 VNDELADSFQALLAVLDHLGNTLPVQAAHNGGELSQRRFDELAAHIQA------------ 260

Query: 384 STNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVVLLNLLQEFVFLDIDAISYEKIDNYF 443
             +  Q+++F+D + T+   W   F       L  L N   EFV LD  A+ +       
Sbjct: 261 --HSRQQVFFVDCTPTLRNMWLRKFARVPPSRLAALFNSFDEFVLLDASAVPFVPPAQLL 318

Query: 444 KTTEYQKTGTVFYRERALRENVNERCIARYETLLPRNLESKNFQNSLLIDPDHALNECDN 503
              E+  T  +F++ RA        C+     LLP   E++ ++ +   +   A    + 
Sbjct: 319 ALPEFADTAALFFKGRAYTTQPQRSCLHSMARLLPSAEEARLWRGAAAFNASGAAAAFNA 378

Query: 504 TLTTEEYIFKAFFHHRRQ--HQLEAGLFAVDKSKHTIPLVLAAMIHLAKNTAHCTHGDKE 561
           +         A    R      L+  L  V K +    L+ A ++ L      C    + 
Sbjct: 379 SGAAAARDGAAAALVRAGLVDGLDHALVLVRKPRALAALLAALLLDLQPRAPGCRPHARS 438

Query: 562 NFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNGKRQEAAVEICSGQIAHMSTDKKTLLW 621
            F L   A    YA+    +GA+G      +L+         +CS Q+AH+    + LLW
Sbjct: 439 LFPLALHAMALPYAVHPGAAGALG------ELDPAAPADCPVLCSAQLAHLDAAGR-LLW 491

Query: 622 VNGGGTFCKHDNA 634
            +GG   C   +A
Sbjct: 492 ASGGLRRCHTSDA 504

>KLLA0A11880g 1026919..1028190 some similarities with
           ca|CA0854|IPF8854 Candida albicans, hypothetical start
          Length = 423

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/310 (25%), Positives = 133/310 (42%), Gaps = 51/310 (16%)

Query: 179 MFQAFERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPNYDPDNFKK 238
           +F +   +R Y  CF+ +N V++  +     KM  E ++++L        P      F +
Sbjct: 102 IFDSVTHLRVYGHCFV-SNAVSVPAL-----KM--EDIETRLFPMFTKKIPV-----FTR 148

Query: 239 YDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYEY 298
           +D F  +   FP ++N                         LPK       ++   + E 
Sbjct: 149 WDGFSPDE--FPILSN-------------------------LPK-----DNIEHASRIEG 176

Query: 299 DPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVK-FIASLRFEGNTLPIQVVYRGDEL 357
            P+ +FW   R    +  GRGIV+S+        VK  + +LR   N LPIQVV++GD L
Sbjct: 177 SPTGSFW---RTAKERYNGRGIVISVSDGIRVNEVKSLMRTLRLLKNRLPIQVVHKGD-L 232

Query: 358 SQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLV 417
           S   + +++ A R+     +    D     PQE+WF++  N I  +    F  + +KW+ 
Sbjct: 233 SDYSIGEIVNAGRAKLTIEIGGE-DLDVEYPQEVWFVNAGNCITQESLRLFQRFNNKWIA 291

Query: 418 VLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRENVNERCIARYETLL 477
            L N  +E + +D D          F+T EY   G  F+R+R L E      +  ++ L+
Sbjct: 292 SLFNSFEEMILMDTDVAPVVNPAELFETKEYLDNGAHFFRDRLLNEYTKRSSVHLFKNLM 351

Query: 478 PRNLESKNFQ 487
             + E + F+
Sbjct: 352 VSDKEYELFR 361

>CAGL0B03003g 295997..297019 some similarities with sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 340

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/280 (22%), Positives = 119/280 (42%), Gaps = 12/280 (4%)

Query: 419 LLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRENVN-ERCIARYETLL 477
           + N  +E + ++ D   +   +  F + +Y+ +G  F++ R  R++     C    + L 
Sbjct: 1   MFNTFEEALVMEPDVSFFLSANTVFDSEDYKNSGFKFWKGRNTRKDAQFPHCKVFTQALE 60

Query: 478 PRNLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHT 537
           P   E     + L++  D+   E  NT   +E    +++ +   H  + G++ ++K +  
Sbjct: 61  PSLEEFNMIHSELVVRLDNPSLESPNT--EQEKALSSYYTYGGLHYADNGVYVINKKQAF 118

Query: 538 IPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNGKR 597
             L+ AA +   K    C+ G+ E  WLG    G+ +    + +G +G+   K +  G R
Sbjct: 119 EGLLGAATLLSHKKYRRCSDGENEFMWLGMFTVGNNFVSDSIDAGILGEI--KLESEGPR 176

Query: 598 QEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXXXXXXXXXXXXXXEE 657
           +  A  +C  Q++H S D   L+W   G   CK +NAA                    E 
Sbjct: 177 RGYAY-VCGTQVSH-SDDVGRLVWSKDGLVTCKFENAA---HEDFSRDSQYFTDRYLDEH 231

Query: 658 MEKYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCA 697
                Y + ++    I+PD + + W + S   C   ++CA
Sbjct: 232 NLDEIYKSKLNINGFIVPDTRKNPWKQIS--ECRATMYCA 269

>KLLA0A11891g 1028064..1028672 similar to sp|P53059 Saccharomyces
           cerevisiae YGL257c MNT2 alpha-1, 3-mannosyltransferases
           responsible for adding the terminal mannose residues of
           O-linked oligosaccharides, hypothetical start
          Length = 202

 Score = 66.2 bits (160), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 101/219 (46%), Gaps = 25/219 (11%)

Query: 524 LEAGLFAVDKSKHTIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGA 583
           +E+G+  +++SK+   L++A ++ L + T+   HGDKE FWLG   +G+       Y+G+
Sbjct: 1   MESGVVTINRSKNLPGLLIATVLQLWQPTSEPFHGDKELFWLGQSISGNEDYQFNRYAGS 60

Query: 584 IGDYVKKTDLNGKRQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAXXXXXXXX 643
               ++  D      E +V +CS QI H   + + LLW+NGG   CK  ++         
Sbjct: 61  DIGTLEHND-----HEDSVHVCSTQIGHFDENFR-LLWINGGLKTCKFPSSG----YDYS 110

Query: 644 XXXXXXXXXXXXEEMEKYYYITPISSKYVILPDP------KSDDWHRASAGACGGYIWCA 697
                       ++++K+Y    +    ++   P      +   + +     C GY+WCA
Sbjct: 111 KNKALRRVFQSADDLKKHYESAIVIDGALVPMYPLDIKKVQGSMFKQNYDLGCLGYVWCA 170

Query: 698 THKTLLKPYSYNHRTTHGELITLDEEQRLHIDAVNTVWS 736
           ++     P + N +T     ++ +EEQ   +  +  VW+
Sbjct: 171 SN----SPGTPNVKT-----VSFNEEQIGSMRRIIKVWN 200

>CAGL0B02992g 294927..296054 some similarities with sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, start by
           similarity
          Length = 375

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 66/264 (25%), Positives = 112/264 (42%), Gaps = 61/264 (23%)

Query: 111 YKHFNELSLTDRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKDANGNPMDEKSE 170
           +K +  LS  D+C+   + +Y  D +W         S  +  G++   D      D ++E
Sbjct: 107 FKEWASLSRMDQCRLLVKGIYVTDPQW---------STKELFGIETVSD------DSRAE 151

Query: 171 RLYRRKYDMFQAFERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPN 230
                   +  A ER+R Y+ CF   + V   E+F  S  + +E V +K+        P 
Sbjct: 152 --------LALALERLRIYNYCFKHESSVTPYELF-HSMTLPRE-VMAKM------DLPP 195

Query: 231 YDPDNFKKYD---QFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKF-DHK 286
           Y+  N K+       +++ +MFPF+             K  + FGK L     PK  + +
Sbjct: 196 YERMNKKQLALALAVDYQRRMFPFLK------------KTGASFGKYLH----PKLINLR 239

Query: 287 TGKV--QEYFK---YEYDPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRF 341
           TGK+  Q   K   +EY+ +  F  +W   S    GRGIV+ +           +   + 
Sbjct: 240 TGKMSNQPTVKSALHEYNSN--FIQHWVRQS---YGRGIVIPMDYTDLKELYHNLKVWQT 294

Query: 342 EGNTLPIQVVYRGDELSQELVDKL 365
             NTLPIQ+V+    ++ E+ + L
Sbjct: 295 LKNTLPIQLVFSNTVVTAEVQEIL 318

>CAGL0M02871g 324009..325811 similar to sp|P46982 Saccharomyces
           cerevisiae YJL186w MNN5 or sp|P38069 Saccharomyces
           cerevisiae YBR015c TTP1, hypothetical start
          Length = 600

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 113/280 (40%), Gaps = 41/280 (14%)

Query: 318 RGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRG-DELSQELVDKLIYAARSPDFKP 376
           +GIV   G     LA+  I ++R  G+TLP++V++   DE   +  +  +         P
Sbjct: 165 KGIVTLGGGRYTILAMLMIETVRRHGSTLPVEVMFPPEDEGEFDFCNNWL---------P 215

Query: 377 VENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVVLLNLLQEFVFLDIDAISY 436
             N       + QE+ F      +       F SY+ K L +LL   ++FVF+D D  + 
Sbjct: 216 KHNG--RCVMMSQEVPF----EILQKDKEVRFKSYQIKSLALLLTSFKQFVFIDADNNAM 269

Query: 437 EKIDNYFKTTEYQKTGTVFYRERALR-ENVNERCIARYETLLPRNLESKNFQNSL--LID 493
           + ID+ F T  ++  G + + +   R  N     IA  +  L + + + N   S     D
Sbjct: 270 KNIDHIFDTEAFKTHGLILWPDLWKRFTNPGFYDIAGVKYDLGKRVRNVNDDASPPETYD 329

Query: 494 PDHALNECDNTLTTEEYIFKAFFHHRRQHQL---------EAGLFAVDKSKHTIPLVLAA 544
           P+H++    + L   E I K  +       L         E+G   VD  KH   L+LA 
Sbjct: 330 PNHSIYTTHD-LKQREEIAKHLYEDVSLADLDGTIADTTTESGQMMVDNKKHLSTLLLAL 388

Query: 545 --------MIHLAKNTAHCTHGDKENFWLGFLAAGHTYAL 576
                   + +   +      GDKE     F++A H   L
Sbjct: 389 YYNIYGPDLYYYMMSMGTAGEGDKET----FISAAHVLHL 424

>Kwal_33.13693
          Length = 558

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 118/281 (41%), Gaps = 60/281 (21%)

Query: 318 RGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVY-----RGDE-LSQELVDKLIYAARS 371
           +G V   G     L+   I ++R  G+TLPI+VV      +G+E   QE++ KL    R 
Sbjct: 135 KGFVTVGGGRFSLLSYTMIRTMRERGSTLPIEVVIPPQDEKGEEHFCQEILPKL--NGRC 192

Query: 372 PDFKPVENNYDNSTNVPQEIWFLD-VSNTIHPKWRGDFGSYKSKWLVVLLNLLQEFVFLD 430
                              ++F D +  +I   W+  F SY+ K + +LL+  ++ VF+D
Sbjct: 193 -------------------VFFGDTLPPSIVEDWK--FKSYQIKVMALLLSSFKKIVFID 231

Query: 431 IDAISYEKIDNYFKTTEYQKTGTVFYRE--RALRENVNERCIARYETLLP---RNLESKN 485
            D +  + +D+ F++  ++K G V + +  R +   V  R +A  +T L    RNL    
Sbjct: 232 ADDLPLKNLDDVFESKVFKKNGLVLWPDLWRRMTAPVFYR-LANIDTDLTKRVRNLGDDI 290

Query: 486 FQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTIPLVLAAM 545
              S  ++P        N    +   F  F         E+G   +DK +H   L+LA  
Sbjct: 291 SPVSRYLNP--------NAKEQKPIPFHDFAGTIPDPTTESGQMVIDKVRHFQTLLLALY 342

Query: 546 IHL----------AKNTAHCTHGDKENFWLGFLAAGHTYAL 576
            ++          ++ TA    GDKE     F +A H   L
Sbjct: 343 YNVYGPDWYYALFSQGTA--GEGDKET----FASAAHVLEL 377

>CAGL0I04532g 404659..406497 similar to sp|P38069 Saccharomyces
           cerevisiae YBR015c TTP1 type II membrane protein, start
           by similarity
          Length = 612

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 118/278 (42%), Gaps = 55/278 (19%)

Query: 317 GRGIVLSLGSNQFPL-AVKFIASLRFEGNTLPIQVVYRGDELSQELVDKLI--YAARSPD 373
           G GIV ++G  +F L A+  I +LR  G TLP++V    DE      + ++  Y A+   
Sbjct: 175 GEGIV-TVGGGKFTLMALTMIKALRTLGTTLPVEVFIPPDEGESTFCESVLPQYNAKC-- 231

Query: 374 FKPVENNYDNSTNVPQEIWFLDV--SNTIHPKWRGDFGSYKSKWLVVLLNLLQEFVFLDI 431
                            I+  D+   + I    +  F  Y+ K L ++ +  +  + LD 
Sbjct: 232 -----------------IYISDILPDDMIQ---KFTFKGYQFKSLAMITSSFENLLLLDA 271

Query: 432 DAISYEKIDNYFKTTEYQKTGTVFYRERALRENVNERCIARYETL-LPRNLESKNFQNSL 490
           D I  +KID+ F++  ++  G + + +   R  +     A YE   LP N ++K  +N+ 
Sbjct: 272 DNIPVKKIDHIFESQIFRSAGLILWPDFWRRTTMP----AYYEIANLPYN-QNKRVRNAF 326

Query: 491 -LIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTIPLVLAAMIH-- 547
             I P     + D  L+  E  F            E+G   + K+KH +P +L ++ +  
Sbjct: 327 DDITPPEVYTKPDGDLS--EVPFHDMEGTLPDPSTESGQLLISKAKH-LPTLLLSLYYNV 383

Query: 548 ---------LAKNTAHCTHGDKENFWLGFLAAGHTYAL 576
                     ++ TA    GDKE     F++A   Y+L
Sbjct: 384 NGPNWYYPIFSQRTA--GEGDKET----FISAASFYSL 415

>Scas_576.9
          Length = 507

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 73/184 (39%), Gaps = 29/184 (15%)

Query: 317 GRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDELSQELVDKLIYAARSPDFKP 376
           G GIVL  G     L+   + ++R  G TLP++V    DE+ +E          +   K 
Sbjct: 189 GDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEE----------AEFCKT 238

Query: 377 VENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVVLLNLLQEFVFLDIDAISY 436
           + N +D       +I  L  S   H     DF  Y+ K L ++ +  +  + LD D    
Sbjct: 239 MLNEFDAKCVYISDI--LPESMISH----FDFKGYQFKSLAIIASSFENLLLLDADNFPV 292

Query: 437 EKIDNYFKTTEYQKTGTV-------------FYRERALRENVNERCIARYETLLPRNLES 483
           + +DN F+   Y  TG +             FY    +  N+ +R     + L P  +  
Sbjct: 293 KNLDNIFQQEPYTTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYD 352

Query: 484 KNFQ 487
           K+ Q
Sbjct: 353 KSDQ 356

>Scas_689.9
          Length = 586

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 59/155 (38%), Gaps = 51/155 (32%)

Query: 319 GIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDELSQELVDKLIYAARSPDFKPVE 378
           GIV   G     L +  IA LR  G +LPI+V+                        P E
Sbjct: 159 GIVTIGGGRYTVLLMTMIAKLRDTGTSLPIEVII-----------------------PPE 195

Query: 379 NNYDNSTNVPQEIWFLDVSNTIHPKWRGD-----------------FGSYKSKWLVVLLN 421
           +  D+           D  N I PKW G                    SY+ K L VLL+
Sbjct: 196 DEGDD-----------DFCNVILPKWNGKCVFFKDVLPDELNKKLMLQSYQIKPLAVLLS 244

Query: 422 LLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFY 456
             ++ +FLD D  + + +D+ F++  + + G + +
Sbjct: 245 SFKKILFLDADNYAMKDLDHIFESEPFIENGLIVW 279

>KLLA0E17831g complement(1572985..1574901) some similarities with
           sp|P38069 Saccharomyces cerevisiae YBR015c TTP1 type II
           membrane protein, hypothetical start
          Length = 638

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 61/287 (21%), Positives = 108/287 (37%), Gaps = 71/287 (24%)

Query: 316 AGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQV-VYRGDELSQELVDKLI--YAARSP 372
           +G GIV   G     +A   I ++R  G TLP++V +   DE   E  + L+  Y A+  
Sbjct: 218 SGDGIVTVGGGKFSMMAFLIIKTVRNFGTTLPVEVFIPPSDEGDDEFCNVLLPQYNAKC- 276

Query: 373 DFKPVENNYDNSTNVPQEIWFLDVSNTIHPKW--RGDFGSYKSKWLVVLLNLLQEFVFLD 430
                                + +S+   P    + DF  Y+ K L ++ +  +  + LD
Sbjct: 277 ---------------------IYLSDAFPPDLIEKSDFKGYQFKSLAIIASSFKNLLLLD 315

Query: 431 IDAISYEKIDNYFKTTEYQKTGTVFYRERALREN------------VNERCIARYETLLP 478
            D    + +D  F+   Y+ TG + + +   R               +ER     + + P
Sbjct: 316 ADNFPIKPLDGIFEEKSYKDTGLILWPDFWRRTTHPSYYSIANTPISSERIRNTMDDVTP 375

Query: 479 RNLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTI 538
            ++ +K+ ++      D  L++ D T+                   E+G   ++K KH  
Sbjct: 376 PSVYTKDLKDL----SDVPLHDLDGTIPDAS--------------TESGQLMINKLKH-F 416

Query: 539 PLVLAAMIHLAKNTA---------HCTHGDKENFWLGFLAAGHTYAL 576
           P VL ++ +     +             GDKE     F+AA H Y L
Sbjct: 417 PTVLLSLYYNVYGPSWYYSIFSQRSSGEGDKET----FIAAAHFYDL 459

>YBR015C (MNN2) [208] chr2 complement(267672..269465)
           Mannosyltransferase required for forming and extending
           the mannose branches of the outer chain mannans [1794
           bp, 597 aa]
          Length = 597

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 64/286 (22%), Positives = 112/286 (39%), Gaps = 68/286 (23%)

Query: 317 GRGIVLSLGSNQFPL-AVKFIASLRFEGNTLPIQVVYR-GDELSQELVDKLIYAARSPDF 374
           G GI  ++G  +F L A   I +LR  G TLP++V+   GDE   E  +K++        
Sbjct: 170 GSGIA-TVGGGKFSLMAFLIIKTLRNMGTTLPVEVLIPPGDEGETEFCNKIL-------- 220

Query: 375 KPVENNYDNSTNVPQEIWFLDV--SNTIHPKWRGDFGSYKSKWLVVLLNLLQEFVFLDID 432
            P  N+        + I+  D+    TI    +  F  Y+ K L ++ +  +  + LD D
Sbjct: 221 -PKYNS--------KCIYVSDILPRETIE---KFVFKGYQFKSLALIASSFENLLLLDAD 268

Query: 433 AISYEKIDNYFKTTEYQKTGTV-------------FYRERALRENVNERCIARYETLLPR 479
               + +DN F    Y  TG V             +Y    +  +  +R     + + P 
Sbjct: 269 NFPIKPLDNIFNEEPYVSTGLVMWPDFWRRTTHPLYYDIAGIAVDKKKRVRNSRDDITPP 328

Query: 480 NLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTIP 539
            + +K+ ++      D  L++ D T+                   E+G   ++K+KH   
Sbjct: 329 AVYTKDLKDL----SDVPLSDLDGTIP--------------DVSTESGQLMINKTKHLAT 370

Query: 540 LVLAAMIHLAKNTAH--------CTHGDKENFWLGFLAAGHTYALQ 577
            +L+   ++   T +           GDKE     F+AA + Y L 
Sbjct: 371 ALLSLFYNVNGPTWYYPIFSQKAAGEGDKET----FIAAANFYGLS 412

>KLLA0C16467g 1442002..1443825 weakly similar to sp|P46982
           Saccharomyces cerevisiae YJL186w MNN5 putative
           mannosyltransferase, start by similarity
          Length = 607

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 61/141 (43%), Gaps = 22/141 (15%)

Query: 318 RGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYR-GDELSQELVDKLI-YAARSPDFK 375
           RGIV   G     L+   I  +R  G+ LPI+VV    DE   E  + ++ + AR   FK
Sbjct: 163 RGIVTVGGRRYSLLSYLMINMVRRSGSKLPIEVVIPPDDEPETEFCESILQFNARCIYFK 222

Query: 376 PVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVVLLNLLQEFVFLDIDAIS 435
                      +P  +    ++N           SY+ K + +LL+  QEFV +D D + 
Sbjct: 223 ---------DRLPTSL----LANL-------SVKSYQVKGIALLLSSFQEFVLIDSDNMP 262

Query: 436 YEKIDNYFKTTEYQKTGTVFY 456
            + ID  F    ++  G V +
Sbjct: 263 LKNIDEVFDYNVFRDHGMVIW 283

>Sklu_2306.4 , Contig c2306 6263-8488 reverse complement
          Length = 741

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 69/188 (36%), Gaps = 45/188 (23%)

Query: 407 DFGSYKSKWLVVLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTV------------ 454
           D   Y+ K L +L++  ++ + LD D      I+N+F +  + + G V            
Sbjct: 332 DIKGYQLKALALLVSSFRKVLMLDADNYVVNSIENFFDSPVFNEKGLVLWPDFWRRLHHP 391

Query: 455 -FYRERALRENVNERCIARYETLLPRNLESKNFQNSLLIDPDHALNECDNTLTTEEYIFK 513
            FY    +  N NE      + + P  +   N  +S+   P H L      ++T      
Sbjct: 392 KFYEIIGIDVNRNESIRYSIDNVTPPEVYRDNDDDSI---PFHDLANSIPDIST------ 442

Query: 514 AFFHHRRQHQLEAGLFAVDKSKHTIPLVLA--------AMIHLAKNTAHCTHGDKENFWL 565
                      E+G   VDK KH   L+L+        +  +      +   GDK+    
Sbjct: 443 -----------ESGQLLVDKQKHLDTLLLSCYYNYNGPSFYYPLLGQGYAGEGDKDT--- 488

Query: 566 GFLAAGHT 573
            F+AA H 
Sbjct: 489 -FIAAAHV 495

>Kwal_56.23117
          Length = 607

 Score = 33.5 bits (75), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 58/143 (40%), Gaps = 23/143 (16%)

Query: 317 GRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQV-VYRGDELSQELVDKLI--YAARSPD 373
           G GIV   G     LA   I +LR    +LP++V +   DE      ++L+  Y A+   
Sbjct: 182 GDGIVTVGGGKFSMLAFLIIKTLRNLHTSLPVEVFIPPADEGETFFCNELLPQYNAKCIY 241

Query: 374 FKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVVLLNLLQEFVFLDIDA 433
              V         +PQEI    + N        +F  Y+ K + ++ +     + LD D 
Sbjct: 242 ISDV---------LPQEI----IDNF-------EFKGYQFKSIAIIASSFDNLLLLDADN 281

Query: 434 ISYEKIDNYFKTTEYQKTGTVFY 456
              + +DN F    Y+  G V +
Sbjct: 282 FPIKDLDNVFNEEPYKSKGMVLW 304

>KLLA0F06490g complement(626983..628569) similar to sp|P20437
           Saccharomyces cerevisiae YMR199w CLN1 cyclin,
           G1/S-specific, start by similarity
          Length = 528

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 34/84 (40%), Gaps = 12/84 (14%)

Query: 238 KYDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYE 297
           K++QFE  H MF  IN FT +   E+ P + +P         +P        V  Y    
Sbjct: 289 KFEQFEVTHGMFQLINKFTNQ---ELGPLLQTP---------IPTGSTSDAIVDIYIDAI 336

Query: 298 YDPSKTFWANWRDMSAKVAGRGIV 321
            D  +  W ++++    V   G V
Sbjct: 337 LDCPEQLWESYKEFDGIVQFVGEV 360

>Scas_296.2
          Length = 295

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 66/158 (41%), Gaps = 24/158 (15%)

Query: 218 SKLIKTLNATFPNYDPDNFKKYDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQ 277
           +++ K L+ T PN  P   K Y  F +     P  +    +  H+ V +  + F +    
Sbjct: 124 AEVCKILDKTSPNTAPH--KPYVAFRYAR---PLTDEAYKQLLHDGVKRAVA-FSQ---- 173

Query: 278 GFLPKFDHKT--GKVQEYFKY--EYDPSKTFWANWRDMSAKVAGRGIV------LSLGSN 327
              P F + T    + E ++     DP++T   +W  +    +  G++      ++   N
Sbjct: 174 --YPHFSYSTTGSSINELWRQVKRLDPNRTI--SWSTIDRWPSNEGLIKAFSENITAKLN 229

Query: 328 QFPLAVKFIASLRFEGNTLPIQVVYRGDELSQELVDKL 365
           +FP  V+    L F  ++LP+ VV  GD    E+   +
Sbjct: 230 EFPEEVRDKVVLLFSAHSLPMDVVNTGDSYPAEVASTV 267

>YJR092W (BUD4) [2983] chr10 (598649..602995) Protein required for
           axial budding but not for bipolar budding [4347 bp, 1448
           aa]
          Length = 1448

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 45/87 (51%), Gaps = 4/87 (4%)

Query: 33  FQLVTHRND-ALIRSSNVNSTNKKTLKDADPKVLIEAFGSPEVDPVDTIPVSPLELVPFY 91
           F L  + +D +L+  ++V+ST ++      P++      +PE+ PVD     P +L+   
Sbjct: 222 FTLNPNESDKSLVSDTSVDSTGRELDTKTIPELPFCMSSTPEMTPVDEKCNLPSKLLNTS 281

Query: 92  DQSIDTKRSSSWLINKKGYYKHFNELS 118
           + S    RS++ L    G +KHFNE S
Sbjct: 282 NNSHSDSRSANSLC---GGFKHFNESS 305

>YCR089W (FIG2) [612] chr3 (267430..272259) Protein involved in mating
            induction [4830 bp, 1609 aa]
          Length = 1609

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 701  TLLKPYSYNHRTTHGELITLDEEQRLHIDAVNTV 734
            T +KP +Y    T+GELIT+    +  I +V T+
Sbjct: 1503 TTVKPVTYTSSDTNGELITITSSSQTVIPSVTTI 1536

>Scas_594.7
          Length = 1703

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 4/42 (9%)

Query: 134  DDEWTNSVKKLEYSINDNEG---VDEGK-DANGNPMDEKSER 171
            +D+W    +  ++  NDN G   +DEG  DANGNP   K+ R
Sbjct: 1411 EDQWLQQFEVSDHEDNDNNGNNSMDEGSLDANGNPRKRKTAR 1452

>YLR106C (MDN1) [3521] chr12 complement(349007..363739) Nuclear
            protein that may act as a chaperone [14733 bp, 4910 aa]
          Length = 4910

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 58/131 (44%), Gaps = 14/131 (10%)

Query: 64   VLIEAFGSP--EVDPVDTIPVSPLELVPFYDQSIDTKRSSSWLINKKGYYKHFNELSLT- 120
            ++I  F S   E  P  T+ VS L L  F+ +S      ++ L   K +YKH   + L  
Sbjct: 3412 IVISNFVSEKKETAPNATLLVSSLNL--FFSKST-LGEFNARLDLVKAFYKHIQLIGLRS 3468

Query: 121  --------DRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKDANGNPMDEKSERL 172
                    +  KFY++    +D+  TN  K LE  I+D   +   KD N + + + S + 
Sbjct: 3469 SKIAGLLHNTIKFYYQFKPLIDERITNGKKSLEKEIDDIILLASWKDVNVDALKQSSRKS 3528

Query: 173  YRRKYDMFQAF 183
            +   Y + + +
Sbjct: 3529 HNNLYKIVRKY 3539

>Scas_526.5
          Length = 387

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 66/158 (41%), Gaps = 24/158 (15%)

Query: 218 SKLIKTLNATFPNYDPDNFKKYDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQ 277
           +++ K L+ T PN  P   K Y  F +     P  +    +  H+ V +  + F +    
Sbjct: 107 AEVCKILDKTSPNTAPH--KPYVAFRYAR---PLTDEAYKQLLHDGVKRAVA-FSQ---- 156

Query: 278 GFLPKFDHKT--GKVQEYFKY--EYDPSKTFWANWRDMSAKVAGRGIV------LSLGSN 327
              P F + T    + E ++     DP++T   +W  +    +  G++      ++   N
Sbjct: 157 --YPHFSYSTTGSSINELWRQVKRLDPNRTI--SWSTIDRWPSNEGLIKAFSENITAKLN 212

Query: 328 QFPLAVKFIASLRFEGNTLPIQVVYRGDELSQELVDKL 365
           +FP  V+    L F  ++LP+ VV  GD    E+   +
Sbjct: 213 EFPEEVRDKVVLLFSAHSLPMDVVNTGDSYPAEVASTV 250

>Kwal_56.23247
          Length = 379

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 52/123 (42%), Gaps = 15/123 (12%)

Query: 249 FPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKT--GKVQEYFKY--EYDPSKTF 304
           F +    T+ET+ +M   +     K +     P+F + T    + E ++     DP +T 
Sbjct: 120 FRYAKPLTSETYQQM---LKDGVRKAVAFSQYPQFSYSTTGSSINELWRQIKALDPERTI 176

Query: 305 WANWRDMSAKVAGRGIVLSLGSN------QFPLAVKFIASLRFEGNTLPIQVVYRGDELS 358
             +W  +      +G+V +   N      +FP  V+    L F  ++LP+ V+  GD   
Sbjct: 177 --SWSVIDRWPTNKGLVKAFAENITAKLQEFPEEVRKDVVLLFSAHSLPMDVINTGDAYP 234

Query: 359 QEL 361
            E+
Sbjct: 235 AEV 237

>Sklu_2330.7 YML079W, Contig c2330 11157-11852 reverse complement
          Length = 231

 Score = 29.6 bits (65), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 40/96 (41%), Gaps = 19/96 (19%)

Query: 69  FGSPEVDPVDTIPVSPLELVPFYDQSIDTKRSSSWLIN--------KKGYYKHFNELSLT 120
           F SP VD    +PV P++ V F   +I+   S   LI+        + GY+K       T
Sbjct: 15  FSSPTVDAAKPVPVEPIQFVQF--PAIEPPASLKKLIDDWQLIKHREGGYFKE------T 66

Query: 121 DRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDE 156
           DR  F+   +   DDE   S   +  +  +    DE
Sbjct: 67  DRSPFF---MDVCDDEEQASDGGVTCAFGEKAKPDE 99

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,931,785
Number of extensions: 1194664
Number of successful extensions: 3608
Number of sequences better than 10.0: 72
Number of HSP's gapped: 3547
Number of HSP's successfully gapped: 74
Length of query: 749
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 640
Effective length of database: 12,822,747
Effective search space: 8206558080
Effective search space used: 8206558080
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)