Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YEL040W (UTR2)46745919240.0
Scas_608.543133113240.0
CAGL0C02211g48133812561e-170
Kwal_27.1014646934910861e-145
KLLA0F16907g45232610501e-140
KLLA0F04906g4963275911e-70
Kwal_56.245184753365865e-70
YLR213C (CRR1)4223555809e-70
Sklu_1954.15103305703e-67
Scas_674.154183375624e-67
CAGL0J08910g4943125458e-64
ADR078C4503335271e-61
AGR318C4521802506e-23
CAGL0G09449g4522232383e-21
Scas_507.24311712355e-21
YGR189C (CRH1)5071662303e-20
Scas_441.24252412204e-19
Sklu_2390.24782172214e-19
KLLA0F22671g4662112126e-18
Kwal_33.153934591571957e-16
Scas_721.134384223890.007
Scas_720.27388157850.022
Scas_630.3387150850.023
Scas_647.22386179720.69
KLLA0F02233g40174682.3
KLLA0F19294g57075682.7
Scas_647.19d387161655.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YEL040W
         (459 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YEL040W (UTR2) [1387] chr5 (78053..79456) Cell wall protein [140...   745   0.0  
Scas_608.5                                                            514   0.0  
CAGL0C02211g 225012..226457 similar to sp|P32623 Saccharomyces c...   488   e-170
Kwal_27.10146                                                         422   e-145
KLLA0F16907g 1555857..1557215 some similarities with sp|P32623 S...   409   e-140
KLLA0F04906g complement(482183..483673) some similarities with s...   232   1e-70
Kwal_56.24518                                                         230   5e-70
YLR213C (CRR1) [3614] chr12 complement(566656..567924) Sporulati...   228   9e-70
Sklu_1954.1 YLR213C, Contig c1954 323-1855 reverse complement         224   3e-67
Scas_674.15                                                           221   4e-67
CAGL0J08910g complement(877143..878627) similar to tr|Q05790 Sac...   214   8e-64
ADR078C [1819] [Homologous to ScYLR213C (CRR1) - SH] (847158..84...   207   1e-61
AGR318C [4629] [Homologous to ScYGR189C (CRH1) - SH] (1325918..1...   100   6e-23
CAGL0G09449g 898735..900093 similar to sp|P53301 Saccharomyces c...    96   3e-21
Scas_507.2                                                             95   5e-21
YGR189C (CRH1) [2140] chr7 complement(876672..878195) Cell wall ...    93   3e-20
Scas_441.2                                                             89   4e-19
Sklu_2390.2 YGR189C, Contig c2390 9663-11099                           90   4e-19
KLLA0F22671g complement(2115530..2116930) some similarities with...    86   6e-18
Kwal_33.15393                                                          80   7e-16
Scas_721.134                                                           39   0.007
Scas_720.27                                                            37   0.022
Scas_630.3                                                             37   0.023
Scas_647.22                                                            32   0.69 
KLLA0F02233g 199224..200429 similar to sp|P47051 Saccharomyces c...    31   2.3  
KLLA0F19294g complement(1784664..1786376) similar to sgd|S000252...    31   2.7  
Scas_647.19d                                                           30   5.0  

>YEL040W (UTR2) [1387] chr5 (78053..79456) Cell wall protein [1404
           bp, 467 aa]
          Length = 467

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/459 (78%), Positives = 362/459 (78%)

Query: 1   MAIVNSWLICLVSIFSFVVRVEAATFCNATQACPEDKPCCSQYGECGTGQYCLNNCDVRY 60
           MAIVNSWLICLVSIFSFVVRVEAATFCNATQACPEDKPCCSQYGECGTGQYCLNNCDVRY
Sbjct: 1   MAIVNSWLICLVSIFSFVVRVEAATFCNATQACPEDKPCCSQYGECGTGQYCLNNCDVRY 60

Query: 61  SFSHDSCMPVPICKSSSTKFKDYSSKLGNANTFLGNVSEADWLYTGDVLDYDDEESLILA 120
           SFSHDSCMPVPICKSSSTKFKDYSSKLGNANTFLGNVSEADWLYTGDVLDYDDEESLILA
Sbjct: 61  SFSHDSCMPVPICKSSSTKFKDYSSKLGNANTFLGNVSEADWLYTGDVLDYDDEESLILA 120

Query: 121 MPKNSGGTVLSSTRAVWYGKVSARIKTSHLAGVVTGFILYSGAGDELDYEFVGADLETAQ 180
           MPKNSGGTVLSSTRAVWYGKVSARIKTSHLAGVVTGFILYSGAGDELDYEFVGADLETAQ
Sbjct: 121 MPKNSGGTVLSSTRAVWYGKVSARIKTSHLAGVVTGFILYSGAGDELDYEFVGADLETAQ 180

Query: 181 TNFYWESVLNYTNSANISTTDTFENYHTYELDWHEDYVTWSIDGVVGRTLYKNETYNATT 240
           TNFYWESVLNYTNSANISTTDTFENYHTYELDWHEDYVTWSIDGVVGRTLYKNETYNATT
Sbjct: 181 TNFYWESVLNYTNSANISTTDTFENYHTYELDWHEDYVTWSIDGVVGRTLYKNETYNATT 240

Query: 241 QKYQYPQTPSKVDISIWPGGNSTNAPGTIAWSGGEINWDASDISNPGYYYAIVNEVNITC 300
           QKYQYPQTPSKVDISIWPGGNSTNAPGTIAWSGGEINWDASDISNPGYYYAIVNEVNITC
Sbjct: 241 QKYQYPQTPSKVDISIWPGGNSTNAPGTIAWSGGEINWDASDISNPGYYYAIVNEVNITC 300

Query: 301 YDPPSDTKKNGTSAYVYTSSSEFLAKDIAITDDEVMMDSDEGSGLDPHKGXXXXXXXXXX 360
           YDPPSDTKKNGTSAYVYTSSSEFLAKDIAITDDEVMMDSDEGSGLDPHKG          
Sbjct: 301 YDPPSDTKKNGTSAYVYTSSSEFLAKDIAITDDEVMMDSDEGSGLDPHKGATTSSTQKSS 360

Query: 361 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNGDKVXXXXXXXX 420
                                                          NGDKV        
Sbjct: 361 SSTATSSSKTSSDHSSSTKKSSKTSSTASSSSSSSSSSSSSSSTATKNGDKVVSSVSSSV 420

Query: 421 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNWRLTVL 459
                                           NWRLTVL
Sbjct: 421 TSQTQTTSSVSGSASSSTSSMSGNNAGANVAANWRLTVL 459

>Scas_608.5
          Length = 431

 Score =  514 bits (1324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 235/331 (70%), Positives = 280/331 (84%)

Query: 20  RVEAATFCNATQACPEDKPCCSQYGECGTGQYCLNNCDVRYSFSHDSCMPVPICKSSSTK 79
           +V A T CNATQ+CPED PCCSQ G+CGTGQYCL +C+  +SF+ DSCMP+PICK SSTK
Sbjct: 19  KVNAVTICNATQSCPEDLPCCSQGGQCGTGQYCLGSCNPSFSFNIDSCMPLPICKDSSTK 78

Query: 80  FKDYSSKLGNANTFLGNVSEADWLYTGDVLDYDDEESLILAMPKNSGGTVLSSTRAVWYG 139
           F +YSSK+ N  TFLGNVS ADWLY+G+++DY DE SLILAMPKNSGGTVL+STRAVWYG
Sbjct: 79  FDNYSSKILNEYTFLGNVSAADWLYSGNIIDYADENSLILAMPKNSGGTVLTSTRAVWYG 138

Query: 140 KVSARIKTSHLAGVVTGFILYSGAGDELDYEFVGADLETAQTNFYWESVLNYTNSANIST 199
           K++AR+K SHL GV+T FIL+SG  DE+D+EFVGAD+E  QTN+YW+  LNY +S NI+ 
Sbjct: 139 KITARMKASHLGGVITAFILFSGIQDEIDFEFVGADIEKVQTNYYWQGTLNYNHSTNITV 198

Query: 200 TDTFENYHTYELDWHEDYVTWSIDGVVGRTLYKNETYNATTQKYQYPQTPSKVDISIWPG 259
            D F++YHTYELDWHEDY+TWS+DG +GRTLYKNETYN+TT  Y++PQTPS+V +SIWPG
Sbjct: 199 DDVFDDYHTYELDWHEDYITWSVDGTIGRTLYKNETYNSTTDTYRFPQTPSQVHLSIWPG 258

Query: 260 GNSTNAPGTIAWSGGEINWDASDISNPGYYYAIVNEVNITCYDPPSDTKKNGTSAYVYTS 319
           GN+TNAPGTIAW+GGEINWDA DIS+PGYYYAIVNEVNITCYDPP   KKNGT AY YT+
Sbjct: 259 GNATNAPGTIAWAGGEINWDAPDISDPGYYYAIVNEVNITCYDPPIFAKKNGTKAYKYTN 318

Query: 320 SSEFLAKDIAITDDEVMMDSDEGSGLDPHKG 350
           S  FL K I ITDDEVM+ SDE +G +  +G
Sbjct: 319 SDNFLEKSIMITDDEVMLGSDEATGNNITEG 349

>CAGL0C02211g 225012..226457 similar to sp|P32623 Saccharomyces
           cerevisiae YEL040w UTR2 cell wall protein, hypothetical
           start
          Length = 481

 Score =  488 bits (1256), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 218/338 (64%), Positives = 279/338 (82%), Gaps = 5/338 (1%)

Query: 18  VVRVEAA-----TFCNATQACPEDKPCCSQYGECGTGQYCLNNCDVRYSFSHDSCMPVPI 72
           ++ VEAA      +CNAT  CPE+ PCCSQ+G+CGTGQYC+NNC+ ++SFS DSC+P+P+
Sbjct: 14  ILSVEAAELTAPIYCNATSQCPEEFPCCSQFGQCGTGQYCINNCNPKFSFSIDSCVPMPV 73

Query: 73  CKSSSTKFKDYSSKLGNANTFLGNVSEADWLYTGDVLDYDDEESLILAMPKNSGGTVLSS 132
           CK SSTKF DYSSK+ NA+T+L N S ADW Y+G ++DY DE+S+ILAMPKNSGG+VLS+
Sbjct: 74  CKDSSTKFDDYSSKVLNADTYLNNASAADWTYSGYLVDYPDEDSMILAMPKNSGGSVLST 133

Query: 133 TRAVWYGKVSARIKTSHLAGVVTGFILYSGAGDELDYEFVGADLETAQTNFYWESVLNYT 192
           TR +WYGKVSAR+K+SHL GVV+  IL+S   DE+D EF+GADL T QTNFYWE  LNYT
Sbjct: 134 TRYMWYGKVSARLKSSHLGGVVSSMILFSNVQDEIDIEFIGADLNTVQTNFYWEGTLNYT 193

Query: 193 NSANISTTDTFENYHTYELDWHEDYVTWSIDGVVGRTLYKNETYNATTQKYQYPQTPSKV 252
           NSAN++T++TFENYH YE+DWHEDY+TWSIDGVVGRTLYKN+TYN TT  Y++PQTPS++
Sbjct: 194 NSANMTTSNTFENYHDYEIDWHEDYITWSIDGVVGRTLYKNQTYNETTGIYEFPQTPSRI 253

Query: 253 DISIWPGGNSTNAPGTIAWSGGEINWDASDISNPGYYYAIVNEVNITCYDPPSDTKKNGT 312
            ISIWPGGN+T+APGTIAW+GG INWDA DI +PGYYY +V E NITCYDPP++ KKNGT
Sbjct: 254 QISIWPGGNATSAPGTIAWAGGAINWDAPDIQDPGYYYMMVQEANITCYDPPANVKKNGT 313

Query: 313 SAYVYTSSSEFLAKDIAITDDEVMMDSDEGSGLDPHKG 350
            +Y+YTS+ +F    I I+D + ++++   +GL+  +G
Sbjct: 314 KSYIYTSNKDFTQDSIMISDKDFVLENSAWTGLNLTEG 351

>Kwal_27.10146
          Length = 469

 Score =  422 bits (1086), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 201/349 (57%), Positives = 259/349 (74%), Gaps = 5/349 (1%)

Query: 6   SWLICLVSIFSFV---VRVEAATFCNAT-QACPEDKPCCSQYGECGTGQYCLNNCDVRYS 61
           SW +  VS FS     V  E   +CN T  +CPEDKPCCSQYG CGTG  CL  C+  YS
Sbjct: 3   SWRLLGVSAFSAFTAYVSAEDVIYCNGTIGSCPEDKPCCSQYGTCGTGLTCLGGCNPMYS 62

Query: 62  FSHDSCMPVPICKSSSTKFKDYSSKLGNANTFLGNVSEADWLYTGDVLDYDDEESLILAM 121
           ++  +CMPVP+CK S T F +YSS++    ++LG+  + DW Y G + D D EE+L++AM
Sbjct: 63  YNLSACMPVPVCKDSKTIFNNYSSEVVPRYSYLGDADKHDWTYEGSLADLD-EEALVMAM 121

Query: 122 PKNSGGTVLSSTRAVWYGKVSARIKTSHLAGVVTGFILYSGAGDELDYEFVGADLETAQT 181
           PK SGGTVLSSTR +WYGKV AR+KTSH AGVVT FI++S   DE+D+EF+GA+L TAQT
Sbjct: 122 PKYSGGTVLSSTRYMWYGKVGARMKTSHRAGVVTAFIMFSSVMDEMDFEFIGANLTTAQT 181

Query: 182 NFYWESVLNYTNSANISTTDTFENYHTYELDWHEDYVTWSIDGVVGRTLYKNETYNATTQ 241
           N+Y+E  LN+TNS NIST+DT+ENYH YE+DWHED++ W +DG VGRTLYKN+TYNATT 
Sbjct: 182 NYYFEGALNWTNSKNISTSDTYENYHLYEVDWHEDHIDWLVDGEVGRTLYKNKTYNATTG 241

Query: 242 KYQYPQTPSKVDISIWPGGNSTNAPGTIAWSGGEINWDASDISNPGYYYAIVNEVNITCY 301
            Y +PQTP+++ +SIWPGGN+T   GT  W+GG+I+WDA DI + GYYYA++  VNITCY
Sbjct: 242 DYMFPQTPARIQLSIWPGGNATQPIGTRQWAGGDIDWDADDIVDNGYYYALLESVNITCY 301

Query: 302 DPPSDTKKNGTSAYVYTSSSEFLAKDIAITDDEVMMDSDEGSGLDPHKG 350
           DPP+ T +NGT+AY Y +S  F    IAIT+D  ++ SDE SG + + G
Sbjct: 302 DPPAGTMQNGTNAYRYINSKNFTQAGIAITNDTTILGSDEDSGFNANDG 350

>KLLA0F16907g 1555857..1557215 some similarities with sp|P32623
           Saccharomyces cerevisiae YEL040w UTR2 cell wall protein,
           hypothetical start
          Length = 452

 Score =  409 bits (1050), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 182/326 (55%), Positives = 245/326 (75%)

Query: 21  VEAATFCNATQACPEDKPCCSQYGECGTGQYCLNNCDVRYSFSHDSCMPVPICKSSSTKF 80
            +  T C+    CPED PCC+QYG CGTG YCL  C+ ++S+  ++CMP+P+C+ + T F
Sbjct: 21  ADETTTCSEDSHCPEDNPCCNQYGTCGTGSYCLGGCNPKFSYKKEACMPLPVCRDTITIF 80

Query: 81  KDYSSKLGNANTFLGNVSEADWLYTGDVLDYDDEESLILAMPKNSGGTVLSSTRAVWYGK 140
            +Y+SK+ N  T+LG+ S+A+W Y G  +DY+DE +LI+AMPKNSGGTVLSST  +WYG 
Sbjct: 81  DNYTSKMANLYTYLGDASKANWTYEGYPIDYEDENALIMAMPKNSGGTVLSSTHYMWYGN 140

Query: 141 VSARIKTSHLAGVVTGFILYSGAGDELDYEFVGADLETAQTNFYWESVLNYTNSANISTT 200
           +  R+K SH AGVV+  IL+S   DE+DYE+VGADLE  QTN+YW+  LNYTNS N++ T
Sbjct: 141 IKTRMKASHGAGVVSAMILFSSVQDEIDYEWVGADLEKVQTNWYWQGALNYTNSKNLTAT 200

Query: 201 DTFENYHTYELDWHEDYVTWSIDGVVGRTLYKNETYNATTQKYQYPQTPSKVDISIWPGG 260
           +  E+YH YE+DW ED +TWS+DG VGRTL+KNETYN+T+++Y+YPQTPS+V +S+WPGG
Sbjct: 201 NNDEDYHIYEIDWKEDVITWSVDGEVGRTLFKNETYNSTSKQYEYPQTPSRVQLSLWPGG 260

Query: 261 NSTNAPGTIAWSGGEINWDASDISNPGYYYAIVNEVNITCYDPPSDTKKNGTSAYVYTSS 320
           N+TN  GTI W+GGEI+WD+ DI + GYYYA++  VNITCYDPPS T KNG+  Y Y+  
Sbjct: 261 NATNEQGTINWAGGEIDWDSDDIKDYGYYYAVLESVNITCYDPPSGTTKNGSEVYQYSGE 320

Query: 321 SEFLAKDIAITDDEVMMDSDEGSGLD 346
             +L K + ITD   ++   + SGLD
Sbjct: 321 DNWLQKGVFITDGNTILKDYDNSGLD 346

>KLLA0F04906g complement(482183..483673) some similarities with
           sgd|S0004203 Saccharomyces cerevisiae YLR213c CRR1,
           hypothetical start
          Length = 496

 Score =  232 bits (591), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 125/327 (38%), Positives = 183/327 (55%), Gaps = 47/327 (14%)

Query: 22  EAATFCNATQACPEDKPCCSQYGECGTGQYCLNNCDVRYSFSHDSCMPVP-ICKSSSTKF 80
           E    C+    CP + PCCSQ+G+CGTG +C+  C+ R S    SC+  P +    S  F
Sbjct: 27  ETPIGCSLENNCPAEWPCCSQFGQCGTGPFCVGGCNPRLSHDPGSCLGQPALLPRMSPSF 86

Query: 81  KDYSS---KLGNANTFL----------------------GNVSEADWL------------ 103
              SS   K    ++FL                      G V+ A++L            
Sbjct: 87  WLQSSLEQKPALKSSFLPRVQPSMDVASNEGGEKDLNNRGIVNFANFLISPQERIIKKML 146

Query: 104 ------YTGDVLDYDDEESLILAMPKNSGGTVLSSTRAVWYGKVSARIKTSHLAGVVTGF 157
                 Y+G V  YD    L LAMPK++ G+++SSTR+  YG+ + ++KT+   GVVT  
Sbjct: 147 RDYHFTYSGFV-KYDAPGQLTLAMPKHTSGSLISSTRSFLYGRATVKMKTARGRGVVTAV 205

Query: 158 ILYSGAGDELDYEFVGADLETAQTNFYWESVLNYTNSANIS-TTDTFENYHTYELDWHED 216
           +L S  GDE+D+EF+G +L  AQ+N+Y +  LN+T    +  ++D+FEN H YE+DW +D
Sbjct: 206 VLISTVGDEIDFEFIGGELHHAQSNYYHQGELNHTRMEKLELSSDSFENTHIYEVDWDQD 265

Query: 217 YVTWSIDGVVGRTLYKNETYNATTQKYQYPQTPSKVDISIWPGGNSTNAPGTIAWSGGEI 276
            + W +DGVV RTLYK +T+N   Q+Y+YPQTP ++ +S+WPGG     PGTI W+GG I
Sbjct: 266 RINWIVDGVVARTLYKEDTWNEEKQRYEYPQTPMRLQVSVWPGGREDADPGTIMWAGGLI 325

Query: 277 NWDAS-DISNPGYYYAIVNEVNITCYD 302
           +W+ S DI   G +YA V  + +T Y+
Sbjct: 326 DWENSPDILEKGQFYATVESIAVTPYE 352

>Kwal_56.24518
          Length = 475

 Score =  230 bits (586), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 122/336 (36%), Positives = 184/336 (54%), Gaps = 46/336 (13%)

Query: 11  LVSIFSFVVRVEAATFCNATQACPEDKPCCSQYGECGTGQYCLNNCDVRYSFSHDSCMPV 70
            V+ FS   + + A  C+  ++CP++ PCCSQYG+CG G  C+  CD R+S S  SC  +
Sbjct: 16  FVTGFSEAYKSDPAIECSKDKSCPQEWPCCSQYGQCGKGPICVGGCDPRFSHSALSCAAI 75

Query: 71  PICKSS----------STKFKDYSSKLGNANTFLG------------------------- 95
           P    S          S K  D        NTF G                         
Sbjct: 76  PALVPSLDSTYQSLQDSEKLIDQLQVSPVVNTFFGAESIIPAAGFNYISTLSSKRLLHFS 135

Query: 96  ------NVSEADWLYTGDVLDYDDEES--LILAMPKNSGGTVLSSTRAVWYGKVSARIKT 147
                  +SEAD+ Y+G  L+++D  S  LILAMP  + G++LSS ++  YGK    +K+
Sbjct: 136 RSDSPTELSEADFTYSG-YLEFEDSPSSDLILAMPPGTTGSLLSSAKSFLYGKAEVTMKS 194

Query: 148 SHLAGVVTGFILYSGAGDELDYEFVGADLETAQTNFYWESVLNYTNSANISTT-DTFENY 206
           +  AGVV+  +L S   DE+D+E +G  L++AQ N+Y++  L +T     S   DT+  Y
Sbjct: 195 ARGAGVVSAMVLMSAVKDEVDFELLGGSLDSAQANYYYQGELIHTRMTQSSVKPDTYSEY 254

Query: 207 HTYELDWHEDYVTWSIDGVVGRTLYKNETYNATTQKYQYPQTPSKVDISIWPGGNSTNAP 266
           HTY  DW+E+ + W +DG V RT+Y+ +TY+  T  ++YPQTP +++++IWPGG   N+P
Sbjct: 255 HTYAFDWNEERIKWLVDGAVVRTVYRADTYDPVTDTFKYPQTPMRLELAIWPGGLPANSP 314

Query: 267 GTIAWSGGEINWD-ASDISNPGYYYAIVNEVNITCY 301
           GT+ W+GG I+W+ ++DI   G +   V  V+IT Y
Sbjct: 315 GTVMWAGGLIDWENSADILENGQFQLAVKHVSITPY 350

>YLR213C (CRR1) [3614] chr12 complement(566656..567924) Sporulation
           specific protein with similarity to Crh1p cell wall
           protein [1269 bp, 422 aa]
          Length = 422

 Score =  228 bits (580), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 132/355 (37%), Positives = 194/355 (54%), Gaps = 53/355 (14%)

Query: 1   MAIVNSWLICLVSIFSFVV----RVEAATFCNATQACPEDKPCCSQYGECGTGQYCLNNC 56
           M I    L+ +V    F +    + + +  C+    CP + PCCS Y ECG G  C+  C
Sbjct: 1   MRISILQLVPVVGYIGFALGELYKPKNSISCSPNNPCPAEWPCCSPYNECGAGPICVGGC 60

Query: 57  DVRYSFSHDSCMPVPICKSSST----------KF-KDYSSKL----GN----ANTFLGNV 97
           +VR SF  +SC P+P   +S            KF  +Y  K     GN    ANT +G V
Sbjct: 61  NVRSSFDEESCAPIPALVASQKLEFVSTPKVPKFIVNYQPKPPIREGNGPNKANTKVGVV 120

Query: 98  SE----------ADWLYTGD-------VLDYDDEES-----------LILAMPKNSGGTV 129
                       A +L T D       + D+D   S           ++LAMPK + G++
Sbjct: 121 EGELNSKRIIHYAKFLVTPDSKEAEKMLEDFDFTHSGYTSIEASSGNIVLAMPKKTTGSL 180

Query: 130 LSSTRAVWYGKVSARIKTSHLAGVVTGFILYSGAGDELDYEFVGADLETAQTNFYWESVL 189
           ++STR+  YGK S R+KT+   GVVT F L S  GDE+D+E++G DL TAQ+N+Y +  L
Sbjct: 181 ITSTRSFLYGKASVRMKTARSRGVVTAFDLTSAIGDEIDFEWLGGDLMTAQSNYYSQGHL 240

Query: 190 NYTNSANIST-TDTFENYHTYELDWHEDYVTWSIDGVVGRTLYKNETYNATTQKYQYPQT 248
           +YT         DT+  YHTYE+DW  D + W +DG + RT+ K +T++  +++Y+YPQT
Sbjct: 241 DYTRMQRFPVGADTWATYHTYEIDWDPDRIIWYVDGKIARTVLKKDTWDPISKEYRYPQT 300

Query: 249 PSKVDISIWPGGNSTNAPGTIAWSGGEINWDAS-DISNPGYYYAIVNEVNITCYD 302
           P +++I++WPGG+ TN PGTI W+GG I+W+ S DI   G + A V ++ +T Y 
Sbjct: 301 PMRLEIAVWPGGSETNGPGTINWAGGLIDWENSPDIIEKGQFTAHVEQITVTPYQ 355

>Sklu_1954.1 YLR213C, Contig c1954 323-1855 reverse complement
          Length = 510

 Score =  224 bits (570), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 124/330 (37%), Positives = 189/330 (57%), Gaps = 52/330 (15%)

Query: 24  ATFCNATQACPEDKPCCSQYGECGTGQYCLNNCDVRYSFSHDSC--MP--VPICKSSSTK 79
           A  C+AT  CP + PCCSQYG CG+G  C+  C+ ++SF+  SC  MP  +P  ++S  K
Sbjct: 29  AISCSATSKCPPEWPCCSQYGLCGSGPLCIGGCNPKFSFNVHSCVAMPALLPPVQASYGK 88

Query: 80  FKDYSSK----LGNANTFLGN-------------VSEAD-----------WLYTGD---- 107
               + +    L +  T L +             V+EAD           +L T D    
Sbjct: 89  QNKQTIQSVQILDDEPTLLTDFRPRDFSLMEGEKVTEADLNSRGLMHFSKYLITPDKSIG 148

Query: 108 -------------VLDYDDEES-LILAMPKNSGGTVLSSTRAVWYGKVSARIKTSHLAGV 153
                         +D D + + +IL MP  + G+++SSTR+  YGK +  +KT+   GV
Sbjct: 149 KQMLENYEFTYSGYMDLDSKSNDIILGMPNRTTGSLISSTRSFLYGKAAVTMKTARSRGV 208

Query: 154 VTGFILYSGAGDELDYEFVGADLETAQTNFYWESVLNYTNSANIST-TDTFENYHTYELD 212
           ++  +L+S   DE+D+EF+G++L  AQTN+Y +  L +T        +D+F NYHTYELD
Sbjct: 209 ISAIMLFSAVRDEIDFEFLGSELTEAQTNYYHQGELVHTRMQRFPIPSDSFHNYHTYELD 268

Query: 213 WHEDYVTWSIDGVVGRTLYKNETYNATTQKYQYPQTPSKVDISIWPGGNSTNAPGTIAWS 272
           W+E+ + W IDGVV RTL+K +T++   + ++YPQTP K+++S+WPGG   N PGTI+W+
Sbjct: 269 WNEERIHWLIDGVVVRTLFKRDTWDPELKIFKYPQTPMKLEVSLWPGGMEGNDPGTISWA 328

Query: 273 GGEINWDAS-DISNPGYYYAIVNEVNITCY 301
           GG I+W+ S DI     +Y++V +V IT Y
Sbjct: 329 GGLIDWENSPDIIEKKQFYSMVKQVTITPY 358

>Scas_674.15
          Length = 418

 Score =  221 bits (562), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 113/337 (33%), Positives = 177/337 (52%), Gaps = 53/337 (15%)

Query: 27  CNATQACPEDKPCCSQYGECGTGQYCLNNCDVRYSFSHDSCMPVPICKSSSTKFK----- 81
           C+    CP D PCCS YG+CG+G  CL  C+ + SF   +C P+PI  S +T+ +     
Sbjct: 32  CSKESHCPPDWPCCSPYGDCGSGPVCLGGCNPKLSFEDTACAPLPILYSPATELRYDRSI 91

Query: 82  ------------------------DYSSKLGNANTFLGN--------------------- 96
                                   ++  ++   N    N                     
Sbjct: 92  PPSSSKDEVFQQMINEHYPQEAPSNFEKEILQNNKLHLNSRGIIHFTDYLMTDSVDKAKD 151

Query: 97  -VSEADWLYTGDVLDYDDEESLILAMPKNSGGTVLSSTRAVWYGKVSARIKTSHLAGVVT 155
            +S+  +LY+G +        + L MPK S G++++S +   YGK+  R++ +   GVVT
Sbjct: 152 MLSKYQFLYSGPINIDPQTNDIQLNMPKQSSGSLITSAKYFLYGKLHVRLRAARSIGVVT 211

Query: 156 GFILYSGAGDELDYEFVGADLETAQTNFYWESVLNYTNSANIST-TDTFENYHTYELDWH 214
           G +L S  GDE+D+EF+GA+L   QTN+Y +  L +TN       T+ +  YHTY +DW+
Sbjct: 212 GLVLISQVGDEIDFEFLGAELNFVQTNYYSQGELIHTNMQKYHIPTNIWATYHTYSIDWN 271

Query: 215 EDYVTWSIDGVVGRTLYKNETYNATTQKYQYPQTPSKVDISIWPGGNSTNAPGTIAWSGG 274
            D + W ++G + RTL+K +T++  +++++YP+TP +++I+IWPGG +TN PGTI+W+GG
Sbjct: 272 PDRILWMVEGQIIRTLFKRDTWDPVSKRFKYPETPMRLEIAIWPGGAATNPPGTISWAGG 331

Query: 275 EINWD-ASDISNPGYYYAIVNEVNITCYDPPSDTKKN 310
            INWD A DI   G +   V   NI  Y  P  T+K 
Sbjct: 332 LINWDTAPDILEKGQFSVYVQHANIVPYINPKITEKQ 368

>CAGL0J08910g complement(877143..878627) similar to tr|Q05790
           Saccharomyces cerevisiae YLR213c CRR1, hypothetical
           start
          Length = 494

 Score =  214 bits (545), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 116/312 (37%), Positives = 170/312 (54%), Gaps = 45/312 (14%)

Query: 32  ACPEDKPCCSQYGECGTGQYCLNNCDVRYSFSHDSCMPVPIC--------KSSSTKF-KD 82
           +CP + PCCS YG CG+G  C+  C+ +YSF  DSC+P P+          +  TK  + 
Sbjct: 40  SCPAEWPCCSPYGVCGSGPTCIGGCNPQYSFREDSCVPSPVLIPYNAIEFSTEGTKLIRI 99

Query: 83  YSSKLGNANTFLGN----------------VSEADWLYTGD-------VLDYD------- 112
            S  L   + FL                  +  +D+L T D       ++DYD       
Sbjct: 100 ASGNLQKGDAFLKKGARMKEREMELKRNKMIHFSDFLITEDATEANKMLMDYDFIYSGMT 159

Query: 113 ----DEESLILAMPKNSGGTVLSSTRAVWYGKVSARIKTSHLAGVVTGFILYSGAGDELD 168
                   + L MPK S G++++S R+  YGKVS  +KT+   GV+T  +L S  GDELD
Sbjct: 160 QMDPTTSEIQLTMPKRSTGSLVASVRSFLYGKVSVTMKTARSGGVITALVLMSAVGDELD 219

Query: 169 YEFVGADLETAQTNFYWESVLNYTNSANISTTD-TFENYHTYELDWHEDYVTWSIDGVVG 227
           +EFVG++L   QTN Y++  L++T        D T+ NYH +E+ W ED V W IDGVV 
Sbjct: 220 FEFVGSELNQVQTNHYYQGELDFTKMKKHEIKDNTWLNYHNFEIFWTEDKVDWVIDGVVV 279

Query: 228 RTLYKNETYNATTQKYQYPQTPSKVDISIWPGGNSTNAPGTIAWSGGEINWD-ASDISNP 286
           RTLYK +T++   + Y++P +P +++I+IWPGG+  N  GTI W+GG ++WD   D+   
Sbjct: 280 RTLYKKDTWDPNAKVYKFPDSPMRLEIAIWPGGSEKNEIGTIMWAGGLVDWDNPPDMLEK 339

Query: 287 GYYYAIVNEVNI 298
           GY+ A V  + I
Sbjct: 340 GYFSANVKVIRI 351

>ADR078C [1819] [Homologous to ScYLR213C (CRR1) - SH]
           (847158..848510) [1353 bp, 450 aa]
          Length = 450

 Score =  207 bits (527), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 115/333 (34%), Positives = 174/333 (52%), Gaps = 57/333 (17%)

Query: 27  CNATQACPEDKPCCSQYGECGTGQYCLNNCDVRYSFSHDSCMPVPIC------------- 73
           C+    CP++ PCCSQYG+CG+G  C++ C+ ++S S +SC+PVP               
Sbjct: 31  CSEASHCPKEWPCCSQYGQCGSGPLCISGCNPKFSHSPESCVPVPALLPQLEIVASDDKG 90

Query: 74  --------KSSSTKFKDYS----------------SKLGNANTFLGNVSEADWLYTG--- 106
                    +  TKF+  S                S L       G +   D++ T    
Sbjct: 91  VYLEMSGQPALVTKFQRKSSAQLLEVHHEEQQYGVSALEQDLNSRGLIHFPDYMITSKPK 150

Query: 107 ---DVLD-YD-----------DEESLILAMPKNSGGTVLSSTRAVWYGKVSARIKTSHLA 151
              ++L+ YD             ESLIL MPK + G+++SS++   YG+ +  +KTS   
Sbjct: 151 VAREMLEQYDFIHSGFISVDGKSESLILGMPKKTTGSLISSSKVFLYGRAAVTMKTSRGP 210

Query: 152 GVVTGFILYSGAGDELDYEFVGADLETAQTNFYWESVLNYTNSANIS-TTDTFENYHTYE 210
           GV+T  +  S   DE+DYEFVG++L T QTN+Y++  LN++     S  +++ E YH YE
Sbjct: 211 GVITAIVFMSSTQDEIDYEFVGSELHTVQTNYYYQGELNHSRMRRHSLPSNSHEEYHIYE 270

Query: 211 LDWHEDYVTWSIDGVVGRTLYKNETYNATTQKYQYPQTPSKVDISIWPGGNSTNAPGTIA 270
           +DW  + + W +DG + RTLYK +T++   + Y+YPQTP  + IS+WP G      GTI 
Sbjct: 271 VDWDAERIHWMVDGEIVRTLYKRDTWDPVHKIYKYPQTPMMLQISLWPAGTPDAPQGTIE 330

Query: 271 WSGGEINWD-ASDISNPGYYYAIVNEVNITCYD 302
           W+GG I+W+ A DI   G   A +  V IT Y+
Sbjct: 331 WAGGLIDWENAPDIKAHGQLAAQIQRVAITPYN 363

>AGR318C [4629] [Homologous to ScYGR189C (CRH1) - SH]
           (1325918..1327276) [1359 bp, 452 aa]
          Length = 452

 Score =  100 bits (250), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 97/180 (53%), Gaps = 21/180 (11%)

Query: 136 VWYGKVSARIKTSHLAGVVTGFILYSGAGDELDYEFVGADLETAQTNFYWE-SVLNYTNS 194
           + YGKV    K +   G+V+ F L S A DE+D E++G D    QTNF+ + +V  YT  
Sbjct: 89  LMYGKVEVTFKAAPGKGIVSSFYLQSDARDEIDLEWLGGDTAQFQTNFFCKGNVTTYTRG 148

Query: 195 ANISTTDTFENYHTYELDWHEDYVTWSIDGVVGRTLYKNETYNATTQKYQYPQTPSKVDI 254
           A  + +   E +HTY +DW  D + + +DG   R + KN+T         YPQ+P ++ +
Sbjct: 149 AFHNVSRPQEEFHTYTIDWKMDELVFYLDGKPIRRV-KNDTSEG------YPQSPMRLYM 201

Query: 255 SIWPGGNSTNAPGTIAWSGGEINWD------------ASDISN-PGYYYAIVNEVNITCY 301
            +W GG+ TN PGT+ W+GG+ ++             ASD S+   Y Y+ V+E  +T +
Sbjct: 202 GVWAGGDPTNHPGTVEWAGGQTDYSKVPFTAYIKRIIASDYSSGRSYMYSDVSEKGVTIH 261

>CAGL0G09449g 898735..900093 similar to sp|P53301 Saccharomyces
           cerevisiae YGR189c CRH1, hypothetical start
          Length = 452

 Score = 96.3 bits (238), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 105/223 (47%), Gaps = 29/223 (13%)

Query: 65  DSCMPV-----PICKSSSTKFKDYSSKLGNANTFLGNVSEADWLYTGD---VLDYDDEES 116
           DSC P+     P  K+ +T F +               SE+ W    D    ++Y   + 
Sbjct: 21  DSCDPLKQTNCPADKALATSFSE------------NFTSESKWFTAEDNPGKIEYT-SDG 67

Query: 117 LILAMPKNSGGTVLSSTRAVWYGKVSARIKTSHLAGVVTGFILYSGAGDELDYEFVGADL 176
           L +++ K      L S   + YGK     K     G+V+ F L S   DE+D E++G+D 
Sbjct: 68  LAMSLTKRFDNPSLKSNFYIMYGKTEVIFKAGDGRGIVSSFFLQSDDLDEIDLEWIGSDD 127

Query: 177 ETAQTNFYWE-SVLNYTNSANISTTDTFENYHTYELDWHEDYVTWSIDGVVGRTLYKNET 235
              Q+N++ + +   Y            + +H Y +DW  + +TW +DG V R L     
Sbjct: 128 TQFQSNYFSKGNTATYDRGEFHGVNQPQKEFHNYTIDWTMEQLTWYLDGQVVRVLP---- 183

Query: 236 YNATTQKYQYPQTPSKVDISIWPGGNSTNAPGTIAWSGGEINW 278
            N T+Q Y  PQTP  + + IW GG+ +NAPGTI W+GGE ++
Sbjct: 184 -NTTSQGY--PQTPMYIKMGIWAGGDPSNAPGTIEWAGGETDY 223

>Scas_507.2
          Length = 431

 Score = 95.1 bits (235), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 56/171 (32%), Positives = 86/171 (50%), Gaps = 8/171 (4%)

Query: 115 ESLILAMPKNSGGTVLSSTRAVWYGKVSARIKTSHLAGVVTGFILYSGAGDELDYEFVGA 174
           + L L + K      L ST  + YGKV A  + +   G+++   L S   DE+D E+ G 
Sbjct: 67  DGLTLTLEKRLDNPSLHSTFYIMYGKVEAIAQAAPGQGMISSVFLQSDDLDEIDIEWTGG 126

Query: 175 DLETAQTNFYWESVLNYTNSANISTTDTFEN-YHTYELDWHEDYVTWSIDGVVGRTLYKN 233
           D    Q+N++ +      +       D+ +  YH Y +DW +D VTW IDGV  R L  +
Sbjct: 127 DTTQVQSNYFSKGQTTTYDRGEFHPVDSPQTTYHNYTVDWTKDAVTWYIDGVSVRVLPSD 186

Query: 234 ETYNATTQKYQYPQTPSKVDISIWPGGNSTNAPGTIAWSGGEINWDASDIS 284
                      +P++P  ++I IW GG+S NAPGTI W+GG  ++  +  S
Sbjct: 187 APEG-------FPESPMALNIGIWAGGDSGNAPGTIEWAGGLTDYSQAPFS 230

>YGR189C (CRH1) [2140] chr7 complement(876672..878195) Cell wall
           protein [1524 bp, 507 aa]
          Length = 507

 Score = 93.2 bits (230), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 83/166 (50%), Gaps = 8/166 (4%)

Query: 115 ESLILAMPKNSGGTVLSSTRAVWYGKVSARIKTSHLAGVVTGFILYSGAGDELDYEFVGA 174
           + L + + K      L S   + YGK+   +K ++  G+V+ F L S   DE+D E+VG 
Sbjct: 83  DGLSMTLAKRYDNPSLKSNFYIMYGKLEVILKAANGTGIVSSFYLQSDDLDEIDIEWVGG 142

Query: 175 DLETAQTNFYWESVLNYTNSANISTTDT-FENYHTYELDWHEDYVTWSIDGVVGRTLYKN 233
           D    Q+NF+ +      +       DT  + +H Y LDW  D  TW +DG   R L   
Sbjct: 143 DNTQFQSNFFSKGDTTTYDRGEFHGVDTPTDKFHNYTLDWAMDKTTWYLDGESVRVL--- 199

Query: 234 ETYNATTQKYQYPQTPSKVDISIWPGGNSTNAPGTIAWSGGEINWD 279
               + T    YPQ+P  + + IW GG+  NA GTI W+GGE N++
Sbjct: 200 ----SNTSSEGYPQSPMYLMMGIWAGGDPDNAAGTIEWAGGETNYN 241

>Scas_441.2
          Length = 425

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 104/241 (43%), Gaps = 36/241 (14%)

Query: 53  LNNCDVRYSFSHDSCMPVPICKSSSTKFKDYSSKLGNANTFLGN-VSE---------ADW 102
           + N D+       +C+      +++T     S+    A+T L   +SE          D 
Sbjct: 1   MRNSDIFLRLVTGACLLSSTALAATTSCNPLSATGCEADTALATAISEDFHTNSSYFIDQ 60

Query: 103 LYTGDVLDYDDEESLILAMPKNSGGTVLSSTRAVWYGKVSARIKTSHLAGVVTGFILYSG 162
            + G +   DD  +L LA  K      L S   + YGK+   +K     G+++ F L S 
Sbjct: 61  KHAGTITYSDDGVALTLA--KRFDNPALKSDFYIMYGKLEVILKAGSGTGIISSFYLQSD 118

Query: 163 AGDELDYEFVGADLETAQTNFYWESVLNYTNSANISTTDTFE---------NYHTYELDW 213
             DE+D E+VG D    Q+N++        +  N++T D  E          YH Y LDW
Sbjct: 119 DLDEIDIEWVGGDTTQFQSNYF--------SKGNVTTYDRGEFHIVESPQTEYHNYTLDW 170

Query: 214 HEDYVTWSIDGVVGRTLYKNETYNATTQKYQYPQTPSKVDISIWPGGNSTNAPGTIAWSG 273
             D  TW +DG   R L         T    YPQ+P  + + IW GG+  NA GTI W+G
Sbjct: 171 AMDKTTWYLDGQAVRVL-------PNTTSEGYPQSPMYIMMGIWAGGDPDNAAGTIEWAG 223

Query: 274 G 274
           G
Sbjct: 224 G 224

>Sklu_2390.2 YGR189C, Contig c2390 9663-11099
          Length = 478

 Score = 89.7 bits (221), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 103/217 (47%), Gaps = 21/217 (9%)

Query: 63  SHDSCMPVPICKSSSTKFKDYSSKLGNANTFLGNVS-EADWLYT---GDVLDYDDEESLI 118
           S  SC P+     S  K          A +FL + S E+D+ +       ++Y   + L 
Sbjct: 29  SASSCNPMKTSGCSPNK--------ALATSFLEDFSSESDYFHAFTDSGTIEYT-SDGLA 79

Query: 119 LAMPKNSGGTVLSSTRAVWYGKVSARIKTSHLAGVVTGFILYSGAGDELDYEFVGADLET 178
           L + +      L S   + YGKV   +K ++  GVVT F L S   DE+D E++G D   
Sbjct: 80  LTLKERFDNPGLKSDFYIMYGKVEVILKAANGTGVVTSFYLQSDDLDEIDLEWLGGDTTE 139

Query: 179 AQTNFYWE-SVLNYTNSANISTTDTFENYHTYELDWHEDYVTWSIDGVVGRTLYKNETYN 237
            Q+NF+ + +V  Y   A         ++H Y +DW  D   W +DG   RTL      N
Sbjct: 140 FQSNFFSKGNVETYDRGAFHGVYQPQIDFHNYTIDWGMDKTVWYLDGQPVRTL-----EN 194

Query: 238 ATTQKYQYPQTPSKVDISIWPGGNSTNAPGTIAWSGG 274
            T++   YPQ+P  V +  W GG+ +N PGTI W+GG
Sbjct: 195 TTSEG--YPQSPMYVMMGTWAGGDPSNEPGTIEWAGG 229

>KLLA0F22671g complement(2115530..2116930) some similarities with
           sp|P53301 Saccharomyces cerevisiae YGR189c CRH1 family
           of putative glycosidases might exert a common role in
           cell wall organization, hypothetical start
          Length = 466

 Score = 86.3 bits (212), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 97/211 (45%), Gaps = 23/211 (10%)

Query: 66  SCMPVP-ICKSSSTKFKDYSSKLGNANTFLGNVSEADWLYTGDVLDYDDEESLILAMPKN 124
           +C P P + KS S  F + SS      T  GNVS  D             + + + + K 
Sbjct: 31  TCSPDPALGKSISVPFDEESSYFERYATN-GNVSYGD-------------DGVEMTINKR 76

Query: 125 SGGTVLSSTRAVWYGKVSARIKTSHLAGVVTGFILYSGAGDELDYEFVGADLETAQTNFY 184
                L S   + +GKV A  K +   G+++ F L S   DE+D E+ G D    Q+NF+
Sbjct: 77  LDNPSLVSEFYIMFGKVQAIAKAAGGQGIISSFYLQSDDLDEIDIEWTGTDTTQVQSNFF 136

Query: 185 WE-SVLNYTNSANISTTDTFENYHTYELDWHEDYVTWSIDGVVGRTLYKNETYNATTQKY 243
            +     +   A  S  D   +YH Y +DW +D +   +D  + RT+  +          
Sbjct: 137 SKGETTTFDRGAFHSVDDPQGSYHNYTIDWTKDEINIYVDSALVRTITSDNGQG------ 190

Query: 244 QYPQTPSKVDISIWPGGNSTNAPGTIAWSGG 274
            YP++P ++   IW GG+S N PGTI W+GG
Sbjct: 191 -YPESPMRIFTGIWAGGDSQNEPGTIEWAGG 220

>Kwal_33.15393
          Length = 459

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 78/157 (49%), Gaps = 8/157 (5%)

Query: 129 VLSSTRAVWYGKVSARIKTSHLAGVVTGFILYSGAGDELDYEFVGADLETAQTNFYWE-S 187
           +L S   + +GKV    K +   G+++ F L S   DE+D E+ G D    QTN++ + +
Sbjct: 83  ILKSDFYLMFGKVEVEFKAAAGQGIISSFYLQSDDLDEIDLEWTGGDTTEFQTNYFSKGN 142

Query: 188 VLNYTNSANISTTDTFENYHTYELDWHEDYVTWSIDGVVGRTLYKNETYNATTQKYQYPQ 247
              +   A        E +HTY +DW ++   + +DG + R+L       A+     YPQ
Sbjct: 143 TTTWDRGAFHGVYTPQEKFHTYTIDWTKEKTDFLLDGALVRSL-------ASDASGGYPQ 195

Query: 248 TPSKVDISIWPGGNSTNAPGTIAWSGGEINWDASDIS 284
           +P  + +  W GG+  N PGTI W+GG  ++  +  S
Sbjct: 196 SPMYLIMGCWAGGDPDNQPGTIEWAGGLTDYTKAPFS 232

>Scas_721.134
          Length = 384

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 84/223 (37%), Gaps = 48/223 (21%)

Query: 87  LGNANTFLGNVSEADWLYTGDVLDYDDE----------ESLILAMPKNSGGTVLSSTRAV 136
           L   N  L ++ + ++     + D+DDE          + L L + ++   T L S   +
Sbjct: 18  LAQENKALASIIDENFHVENSLWDFDDESDNNATMCGSDGLTLTIAESGDSTDLFSEFYI 77

Query: 137 WYGKVSARIKTSHLA-----------------GVVTGFILYS---GAGDELDYEFVGADL 176
            YG++ A +K  +                   G   G        G GDE  Y F  A  
Sbjct: 78  LYGRIEAIVKAGNARSISSSIQFFSAPGTIRDGTSQGLFAIDWDDGEGDEF-YTFSTAMN 136

Query: 177 ETAQTNFYWESVLNYTNSANISTTDTFENYHTYELDWHEDYVTWSIDGVVGRTLYKNETY 236
                +  WE+  +Y  S           YH Y +DW ++ +T+ +DG V R +      
Sbjct: 137 SNKNISTQWET--HYVKSPQTE-------YHNYTIDWTKEKLTFYVDGRVVRVV------ 181

Query: 237 NATTQKYQYPQTPSKVDISIWPGGNSTNAPGT-IAWSGGEINW 278
             +T    +P +P K  I+    G+  NA    I   GGE ++
Sbjct: 182 -PSTATADFPNSPVKFFITHSDDGDPENASAEYIDMHGGETDY 223

>Scas_720.27
          Length = 388

 Score = 37.4 bits (85), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 69/157 (43%), Gaps = 19/157 (12%)

Query: 115 ESLILAMPKNSGGTVLSSTRAVWYGKVSARIKTSHLAGVVTGF-ILYSGA---GDELDYE 170
           + L L + +   GT L S   + YG++ A +K  +   + +    L SG    G E D  
Sbjct: 56  DGLTLTIAERGDGTNLLSNFYILYGRIEAIMKAGNAKSISSEISFLASGTRRDGTEADLF 115

Query: 171 FVGAD------LETAQTNFYWESVLNYTNSANISTTDTFENYHTYELDWHEDYVTWSIDG 224
            +G D       ET  T+    +  +   + ++ +  T   YH Y +DW +D +T+ +DG
Sbjct: 116 TLGWDDGEGDEFETFSTSGGSGNSTDQWETHDVKSPQT--EYHNYTIDWTKDKLTFYVDG 173

Query: 225 VVGRTLYKNETYNATTQKYQYPQTPSKVDISIWPGGN 261
            V R +        +T   ++P  P ++ I+    GN
Sbjct: 174 RVLRVV-------PSTDSAEFPNFPVRIAITHSDDGN 203

>Scas_630.3
          Length = 387

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 70/150 (46%), Gaps = 17/150 (11%)

Query: 115 ESLILAMPKNSGGTVLSSTRAVWYGKVSARIKTSHLAGVVTGFILYSGAG---DELDYEF 171
           + L L + ++   T LSS   ++YG++ A +K  +   + +     SG+G   D+     
Sbjct: 59  DGLTLTIAESGDSTDLSSDFYIFYGRIEAFVKAGNARSISSEIAFVSGSGAMNDDWRRTL 118

Query: 172 VGADLETAQTN-FY-WESVLN-YTNSANISTTDTFEN----YHTYELDWHEDYVTWSIDG 224
              D +  + + FY + + +N + NS     T   ++    YH Y +DW ++ +T+ +DG
Sbjct: 119 FAIDWDDGEGDEFYTFSTAMNSHKNSTAQWETHYVKSPQTEYHNYTIDWTKEKLTFYVDG 178

Query: 225 VVGRTLYKNETYNATTQKYQYPQTPSKVDI 254
            V R +        +T    +P +P++  I
Sbjct: 179 RVVRVV-------PSTATADFPNSPARFFI 201

>Scas_647.22
          Length = 386

 Score = 32.3 bits (72), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 36/179 (20%), Positives = 74/179 (41%), Gaps = 26/179 (14%)

Query: 115 ESLILAMPKNSGGTVLSSTRAVWYGKVSARIKTSHLAGVVTGFILYSGAG---DELDYEF 171
           + L L + ++   T L S   + YG++ A +K  +   + +     SGAG   D +    
Sbjct: 59  DGLTLTIAESGDSTTLWSNFYILYGRIEAIMKAGNARSISSEIAFESGAGSLRDGMRRSL 118

Query: 172 VGADLETAQTNFYWESVLNYTNSANISTTDTFE-----------NYHTYELDWHEDYVTW 220
              D +  + + ++     ++ S N     T +            YH Y +DW ++ +T+
Sbjct: 119 FAIDWDDDEGDGFY----TFSTSLNSHRNSTAQWEAHYVKSPQTEYHNYTIDWTKEKLTF 174

Query: 221 SIDGVVGRTLYKNETYNATTQKYQYPQTPSKVDISIWPGGNSTNAPGT-IAWSGGEINW 278
            +DG   R +        +T    +P +P++  I+    G+  N+    +   GGE ++
Sbjct: 175 YVDGQEVRVV-------PSTAIADFPNSPARFYITHTDDGDLENSDEEYVDMHGGETDY 226

>KLLA0F02233g 199224..200429 similar to sp|P47051 Saccharomyces
           cerevisiae YJL046w singleton, hypothetical start
          Length = 401

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query: 140 KVSARIKTSHL-AGVVTGFILYSGAGDELDYEFVGADLETAQTNFYWESVLNYTNSANIS 198
           K + R+ T+ L +G+     LY+ A +++ +E    D +  + N  +  +   T+ ANI 
Sbjct: 4   KCTHRVATTLLRSGISVPKRLYTPANNQIPFELDETDEKYKELNNIYRELFTPTDKANIL 63

Query: 199 TTDTFENYHTYELD 212
           TT   E+    E+D
Sbjct: 64  TTKDIESNKRSEVD 77

>KLLA0F19294g complement(1784664..1786376) similar to sgd|S0002524
           Saccharomyces cerevisiae YDR117c, start by similarity
          Length = 570

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 3/75 (4%)

Query: 58  VRYSFSHDSCMPVPICKSSSTKFKDYSSK-LGNANTFLGNVSEADWLYTGDVLDYDDEES 116
           V+YS   D  + +PI   +ST   ++  K L + +T + N+ ++ W     +L Y ++E 
Sbjct: 248 VKYSIKFDDKITLPIV--ASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLLKYLEDEG 305

Query: 117 LILAMPKNSGGTVLS 131
            +    KN   TV+S
Sbjct: 306 FLKLKGKNDSCTVIS 320

>Scas_647.19d
          Length = 387

 Score = 29.6 bits (65), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 32/161 (19%), Positives = 62/161 (38%), Gaps = 37/161 (22%)

Query: 115 ESLILAMPKNSGGTVLSSTRAVWYGKVSARIKTSHLAGVVTGFILYS------------- 161
           + L + + ++     LSS   + YG++ A +K  +   + +    +S             
Sbjct: 59  DGLTMTISESGNTRDLSSKFYILYGRIEAIVKAGNARSISSAINFFSPDGTKDDGSGQGL 118

Query: 162 -------GAGDELDYEFVGADLETAQTNFYWESVLNYTNSANISTTDTFENYHTYELDWH 214
                  G GDE  Y F  +      +   WE+  +Y  S           YH Y +DW 
Sbjct: 119 FAIDWDDGEGDEF-YTFSTSVNSHNNSTAQWEA--HYVKSPQT-------EYHNYTIDWT 168

Query: 215 EDYVTWSIDGVVGRTLYKNETYNATTQKYQYPQTPSKVDIS 255
           ++ +T+ +DG   R +        +T    +P +P++  I+
Sbjct: 169 KEKLTFYVDGQEVRVV-------PSTATADFPNSPARFFIT 202

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.131    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,196,830
Number of extensions: 596024
Number of successful extensions: 1255
Number of sequences better than 10.0: 35
Number of HSP's gapped: 1225
Number of HSP's successfully gapped: 43
Length of query: 459
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 354
Effective length of database: 12,961,219
Effective search space: 4588271526
Effective search space used: 4588271526
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 63 (28.9 bits)