Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR475C87683136990.0
CAGL0M08954g85073010541e-130
Scas_660.3077463310231e-126
Kwal_47.182467736218075e-95
YOR019W7305777811e-91
AEL233C7936307431e-85
Scas_699.297167057125e-82
CAGL0H08261g7343844014e-40
KLLA0F02684g7792653189e-30
CAGL0F07975g7702231713e-12
KLLA0E15642g7662201402e-08
YGR237C7852031321e-07
Kwal_14.1028680381293e-07
Scas_595.137662241294e-07
ADL147W626621213e-06
Kwal_26.7496436200750.74
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR475C
         (861 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR475C (YDR475C) [1291] chr4 complement(1407452..1410082) Prote...  1429   0.0  
CAGL0M08954g 890764..893316 weakly similar to tr|Q99248 Saccharo...   410   e-130
Scas_660.30                                                           398   e-126
Kwal_47.18246                                                         315   5e-95
YOR019W (YOR019W) [4832] chr15 (368126..370318) Protein of unkno...   305   1e-91
AEL233C [2273] [Homologous to ScYOR019W - SH; ScYDR475C - SH] (1...   290   1e-85
Scas_699.29                                                           278   5e-82
CAGL0H08261g 810168..812372 weakly similar to tr|Q99248 Saccharo...   159   4e-40
KLLA0F02684g 242962..245301 some similarities with sgd|S0005545 ...   127   9e-30
CAGL0F07975g complement(782229..784541) similar to sp|P50089 Sac...    70   3e-12
KLLA0E15642g 1393066..1395366 weakly similar to sp|P50089 Saccha...    59   2e-08
YGR237C (YGR237C) [2185] chr7 complement(963302..965659) Protein...    55   1e-07
Kwal_14.1028                                                           54   3e-07
Scas_595.13                                                            54   4e-07
ADL147W [1594] [Homologous to ScYGR237C - SH] complement(431887....    51   3e-06
Kwal_26.7496                                                           33   0.74 

>YDR475C (YDR475C) [1291] chr4 complement(1407452..1410082) Protein
           of unknown function [2631 bp, 876 aa]
          Length = 876

 Score = 1429 bits (3699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 715/831 (86%), Positives = 715/831 (86%)

Query: 1   MVVRDQDEALRNSYKYVKLYVRQDQLEDTVDILAKQDEDKSNNXXXXXXXXXXXXXXXXX 60
           MVVRDQDEALRNSYKYVKLYVRQDQLEDTVDILAKQDEDKSNN                 
Sbjct: 1   MVVRDQDEALRNSYKYVKLYVRQDQLEDTVDILAKQDEDKSNNDDRRSLASILDSSSSVK 60

Query: 61  XXXXXXNEKYLPCVSFNTVPRSRVSSPLDEEKREFPGVQISADYTMEEYYDDESGFTSDN 120
                 NEKYLPCVSFNTVPRSRVSSPLDEEKREFPGVQISADYTMEEYYDDESGFTSDN
Sbjct: 61  KKGKGSNEKYLPCVSFNTVPRSRVSSPLDEEKREFPGVQISADYTMEEYYDDESGFTSDN 120

Query: 121 NADYFSGNSYSSRREGSASPGRYSSPPPASKRNIKIGKMFKISENGKIVREDYPTTPTDI 180
           NADYFSGNSYSSRREGSASPGRYSSPPPASKRNIKIGKMFKISENGKIVREDYPTTPTDI
Sbjct: 121 NADYFSGNSYSSRREGSASPGRYSSPPPASKRNIKIGKMFKISENGKIVREDYPTTPTDI 180

Query: 181 NDALVISRAYANWRQLWIKKKNQIDHRLEQKRDFFNYPTILFPPNKKKSSEGATPTIKFN 240
           NDALVISRAYANWRQLWIKKKNQIDHRLEQKRDFFNYPTILFPPNKKKSSEGATPTIKFN
Sbjct: 181 NDALVISRAYANWRQLWIKKKNQIDHRLEQKRDFFNYPTILFPPNKKKSSEGATPTIKFN 240

Query: 241 PPIEDGFTPLTKSQKRKERVLSEKVGFPNTPRTILCHISGRKHTWVALDWALRTLIQNTD 300
           PPIEDGFTPLTKSQKRKERVLSEKVGFPNTPRTILCHISGRKHTWVALDWALRTLIQNTD
Sbjct: 241 PPIEDGFTPLTKSQKRKERVLSEKVGFPNTPRTILCHISGRKHTWVALDWALRTLIQNTD 300

Query: 301 HIVVLANLPRLTKNNFEDNDSMSERKRMLMMMDDXXXXXXXXXXXXXXXXXXXXXXXALS 360
           HIVVLANLPRLTKNNFEDNDSMSERKRMLMMMDD                       ALS
Sbjct: 301 HIVVLANLPRLTKNNFEDNDSMSERKRMLMMMDDSRSVSSARRSRSRSRSRSICTRRALS 360

Query: 361 LGPEESDNKLKHQNFIEWTSGYTQNEIERKLQDLFDYVTLIIPQDRSVKVTVEILIGKTK 420
           LGPEESDNKLKHQNFIEWTSGYTQNEIERKLQDLFDYVTLIIPQDRSVKVTVEILIGKTK
Sbjct: 361 LGPEESDNKLKHQNFIEWTSGYTQNEIERKLQDLFDYVTLIIPQDRSVKVTVEILIGKTK 420

Query: 421 KTLLEAINIYLPDFFVSSTLRWERTDSLVRWKSNFLTDKLCTNFPIPTFIVPAKRMFDLE 480
           KTLLEAINIYLPDFFVSSTLRWERTDSLVRWKSNFLTDKLCTNFPIPTFIVPAKRMFDLE
Sbjct: 421 KTLLEAINIYLPDFFVSSTLRWERTDSLVRWKSNFLTDKLCTNFPIPTFIVPAKRMFDLE 480

Query: 481 IDLQKEFKEPEVTKQKNTSGPKPGFSHSKSADASIPTISNIKRKQDNDYSIDSLCYAPEA 540
           IDLQKEFKEPEVTKQKNTSGPKPGFSHSKSADASIPTISNIKRKQDNDYSIDSLCYAPEA
Sbjct: 481 IDLQKEFKEPEVTKQKNTSGPKPGFSHSKSADASIPTISNIKRKQDNDYSIDSLCYAPEA 540

Query: 541 NGANNSSREEASDDELNAFKDDENDVMSVKSLTSNISVKEKLCTMARKRRKSMAQQLNDA 600
           NGANNSSREEASDDELNAFKDDENDVMSVKSLTSNISVKEKLCTMARKRRKSMAQQLNDA
Sbjct: 541 NGANNSSREEASDDELNAFKDDENDVMSVKSLTSNISVKEKLCTMARKRRKSMAQQLNDA 600

Query: 601 DHDSSIPPGQRHLKKLNIILESSLKFSLEIDSITDSIENGDVDEKRAHSMESGFEELKRV 660
           DHDSSIPPGQRHLKKLNIILESSLKFSLEIDSITDSIENGDVDEKRAHSMESGFEELKRV
Sbjct: 601 DHDSSIPPGQRHLKKLNIILESSLKFSLEIDSITDSIENGDVDEKRAHSMESGFEELKRV 660

Query: 661 ITGGAPPRHVATPQRSMLDVLDNXXXXXXXXXXXXXXXXXXXXXXXXXXXTATDINXXXX 720
           ITGGAPPRHVATPQRSMLDVLDN                           TATDIN    
Sbjct: 661 ITGGAPPRHVATPQRSMLDVLDNPSSSRSKSKSRSSSKSRIRDKSKPSSPTATDINSSAS 720

Query: 721 XXXXXXPQIKFASSVKNVDGNAALGAIKSRHSLDSPGDXXXXXXXXXXRDTDQLSVPGLP 780
                 PQIKFASSVKNVDGNAALGAIKSRHSLDSPGD          RDTDQLSVPGLP
Sbjct: 721 ASRSRSPQIKFASSVKNVDGNAALGAIKSRHSLDSPGDQQQQHHHHHHRDTDQLSVPGLP 780

Query: 781 HLAPSKSYSVSSGXXXXXXXXXXXXXXXXXXXXXXXNSGKRIKKPVVTSAH 831
           HLAPSKSYSVSSG                       NSGKRIKKPVVTSAH
Sbjct: 781 HLAPSKSYSVSSGNKDSSLRKVSSSSSLRKVKSNDSNSGKRIKKPVVTSAH 831

>CAGL0M08954g 890764..893316 weakly similar to tr|Q99248
           Saccharomyces cerevisiae YOR019w, hypothetical start
          Length = 850

 Score =  410 bits (1054), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 270/730 (36%), Positives = 386/730 (52%), Gaps = 107/730 (14%)

Query: 67  NEKYLPCVSFNTVPRSRVSSPLDEEKREFPGVQI-SADYTMEEYYDDESGFTSDNNADYF 125
           N K  PCVSFNTVP     + LDE +++FPGVQ+   +YTMEEYYDDESG+ S++N +Y 
Sbjct: 76  NAKVRPCVSFNTVPLPSKHTLLDEYEQDFPGVQLFPQEYTMEEYYDDESGYVSEDNQNYM 135

Query: 126 SGNSYSS----RREGSASPGRYSSPPP--------------ASKRNIKIGKMFKISENGK 167
             NSY +     R    +  R SSPPP              +SK+   I KMFKI++NG+
Sbjct: 136 LHNSYITPEIVERLNKNATTRSSSPPPLDREYPSAGKQKKMSSKQQANITKMFKIAKNGR 195

Query: 168 IVREDYPTTPTDINDALVISRAYANWRQLWIKKKNQIDHRLEQKRDFFNYPTILFPPNKK 227
           IVREDYP+ PT +NDA +++R   +W   W  +++ I+ R E   + F YP +LFP   K
Sbjct: 196 IVREDYPSRPTLVNDAFILNRDLNDWHNTWRSRRHTIEQRKEDLSETFEYPQLLFPQQTK 255

Query: 228 KSSEGATPTIKFNPPIEDGFTPLTKSQKRKERVLSEKVGFPNTPRTILCHISGRKHTWVA 287
            S     P I      ED + PLTK Q++KE+++ +K+   + PR +LCHISG++HTWV 
Sbjct: 256 PSE----PVIMMG---ED-YKPLTKEQRKKEKIIHKKIESTSGPRVVLCHISGKRHTWVG 307

Query: 288 LDWALRTLIQNTDHIVVLANLPRLTKNNFEDNDSMSERKRMLMMMDDXXXXXXXXXXXXX 347
           LDW ++ L  + DHIVVLA++PR+          +S R+ +                   
Sbjct: 308 LDWTIKRLSNDGDHIVVLAHIPRM----------ISSRRLITSASASRSRSRTRSRSRDV 357

Query: 348 XXXXXXX---XXXALSLGPEESDNKLKHQNFIEWTSGYTQNEIERKLQDLFDYVTLIIPQ 404
                        A SLG + ++N  KH++F+EW SGY+Q ++E  ++++FDY+  I+P+
Sbjct: 358 NRKAYNKGDYEASAFSLGQDNNENLNKHEDFVEWASGYSQEDVETTMENIFDYIANILPE 417

Query: 405 DRSVKVTVEILIGKTKKTLLEAINIYLPDFFVSSTLRWERTDSLVRWKSNFLTDKLCTNF 464
           +RSVK+TVE+++G    T+++A N Y PD  V+STLRWERTD+LV WKSN L DKL T F
Sbjct: 418 ERSVKITVEVVVGAALHTIIDATNAYQPDLMVASTLRWERTDNLVLWKSNLLIDKLATVF 477

Query: 465 PIPTFIVPAKRMFDLEIDLQKEFKEPEVT---------KQKNTSG-------------PK 502
           P+P F+VPA+RMF  E  L++E K+ E++         K+ N +G             PK
Sbjct: 478 PLPLFVVPARRMFLFEHGLEEESKQIEISLEKENIEMEKENNVTGDIVESEADKKIVPPK 537

Query: 503 ------PGFSHSKSADASIPTISNIKRKQDNDYSIDSLCYAPEANGANNSSREEASDDEL 556
                 P       AD S     N+KR      S+ +   AP A        EE S  E 
Sbjct: 538 RIGTIGPPERRLVGAD-SFTAGFNMKRP-----SLGTSVSAPIAENV----FEEESGSET 587

Query: 557 NAFKDDENDVMSVKSLTSNISVKEKLCTMARKRRKSMAQQLNDADHDSSIPPGQRHLKKL 616
            +  D E   +S       ++V+EKL   AR  R   AQ L D D++ SI   +  +KK+
Sbjct: 588 GSDVDSELSDLSSDEGNDKLTVREKLHLKARSYRLQTAQYLKDLDNNKSISHEEIQIKKV 647

Query: 617 NIILESSLKFSLEIDSI-TDSIENGDVDEKRAHSMESGFEELKRVITGGAPPRHVATPQR 675
             I+  ++KFSL I+ + ++S ++ DV          G  +LKRVITGGA     +  ++
Sbjct: 648 ETIINQTIKFSLAIEDLGSESDDDDDV----------GLTKLKRVITGGAVLNPQSGSKK 697

Query: 676 SMLDVLDNXXXXXXXXXXXXXXXXXXXXXXXXXXXTATDINXXXXXXXXXXPQIKFASSV 735
           SML VLDN                           T + ++           QIKFASSV
Sbjct: 698 SMLSVLDN---------------PKTTRKKKSLSATTSGVSGNRVPRSS---QIKFASSV 739

Query: 736 KNVDGNAALG 745
           K+ DGN ALG
Sbjct: 740 KHKDGNNALG 749

>Scas_660.30
          Length = 774

 Score =  398 bits (1023), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 239/633 (37%), Positives = 364/633 (57%), Gaps = 91/633 (14%)

Query: 69  KYLPCVSFNTVP-RSRVSSPLDEEKREFPGVQISA--DYTMEEYYDDESGFTSDNNADYF 125
           +Y  CVSFNT+P ++   S LDE + +FPGVQ+ A  +YTM+EYYD+ESG+ SDN  D+ 
Sbjct: 44  RYKKCVSFNTIPVKTSKDSLLDEYEPDFPGVQLYAPDNYTMDEYYDNESGYISDN-PDFH 102

Query: 126 SGNSYSSRREGSASPGRYSSPPPASK--RNIKIGKMFKISENGKIVREDYPTTPTDINDA 183
             N Y +++    S  +   PPP +   + + +  +FKI+ENGKIVREDYP+ PT  N+A
Sbjct: 103 IHNKYITQK--GFSNVKEILPPPTTNGGKRVALSNLFKIAENGKIVREDYPSRPTLSNEA 160

Query: 184 LVISRAYANWRQLWIKKKNQIDHRLEQKRDFFNYPTILFPPNKKKSSEGATPTIKFNPPI 243
           +VI+RA  +W  LW K+K QID RLE+K + F Y + LF    K ++             
Sbjct: 161 VVINRAVLDWGSLWEKRKLQIDSRLEKKEEVFQYSSTLFSQKNKNNNIPKK--------- 211

Query: 244 EDGFTPLTKSQKRKERVLSEKVGFPNTPRTILCHISGRKHTWVALDWALRTLIQNTDHIV 303
           ED + PL+K QKRKE+VL E VGFP  PRTILC +SGR+HTWVALDW ++ L Q+TD +V
Sbjct: 212 EDPYMPLSKEQKRKEKVLREAVGFPTIPRTILCLLSGRRHTWVALDWTIKCLAQDTDQVV 271

Query: 304 VLANLPRLTKNNFEDNDSMSERKRMLMMMDDXXXXXXXXXXXXXXXXXXXXXXXALSLGP 363
           V+ANLP+                  ++ +                           S  P
Sbjct: 272 VVANLPK------------------MIDLSKSNKRGSRSRSRTRSQARSRSSEKLYSTLP 313

Query: 364 EESDNKLKHQNFIEWTSGYTQNEIERKLQDLFDYVTLIIPQD-RSVKVTVEILIGKTKKT 422
           E+ +         EW++GY+++ IE+KL+D+F Y+++++ ++ +S+K+TVE+++GKTKK 
Sbjct: 314 EDEE---------EWSAGYSKDVIEQKLRDIFRYISVLLTKNPKSIKITVELILGKTKKI 364

Query: 423 LLEAINIYLPDFFVSSTLRWERTDSLVRWKSNFLTDKLCTNFPIPTFIVPAKRMFDLEID 482
           L E IN Y PDF +SSTL+W+RT+SLV+WKS  LTDK+CT++P+P ++VPAKRMFD E  
Sbjct: 365 LCEVINAYTPDFIISSTLKWQRTESLVQWKSRKLTDKICTSYPVPVYVVPAKRMFDFERK 424

Query: 483 LQKEFKEPEVTKQKNTSGPKPGFSHSKSADASIPTISNIKRKQDNDYSIDSLCYAPEANG 542
           L K+F  P  T ++  S  K  F H K   A+      I                   + 
Sbjct: 425 LAKQFANPISTSEEELST-KNNFIHPKLIHANSEMSPAI------------------ISA 465

Query: 543 ANNSSREEASDDELNAFKDDENDVMS---------------VKSLTSNISVKEKLCTMAR 587
             N S E+    +L    DD++ V++               + S++S+ S++ KL   AR
Sbjct: 466 EQNYSSEDIYSPKLACIVDDKDSVIAEGNDDIDDDNADQLSINSVSSSSSLQTKLHRTAR 525

Query: 588 KRRKSMAQQLNDADHDSSIPPGQRHLKKLNIILESSLKFSLEIDSITDSIENGDVDEKRA 647
           K R+ MA+++++   D ++   ++ L KL+I++ESSL+FSLE+D++       D+D +  
Sbjct: 526 KHRQIMARKIDEITKDLTLDQAKKQLSKLDIVIESSLQFSLELDTMP------DLDMETR 579

Query: 648 HSMESGFEELKRVITGGAPPRHVATPQRSMLDV 680
           ++  +  + + + ++GG      A P RSMLDV
Sbjct: 580 NANLNNLKSIMKGVSGG------AKPMRSMLDV 606

>Kwal_47.18246
          Length = 773

 Score =  315 bits (807), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 206/621 (33%), Positives = 318/621 (51%), Gaps = 76/621 (12%)

Query: 70  YLPCVSFNTVPRSRVSSPLDEEKREFPGVQISADYTMEEYYDDESGFTSDNNADYF--SG 127
           ++P VSF+TVP   ++    E+  E      + +YT EE+YD+E       + D+   SG
Sbjct: 47  FVPGVSFDTVPL--LAGTACEDFDEGHCSDHTLEYTEEEFYDNEC------SPDFLRPSG 98

Query: 128 NS-----YSSRREGSASPGRYSSPPPASKRNIKIGKM--FKISENGKIVREDYPTTPTDI 180
           N      +S  R  S+SP R  S    S  +  +  +    +  +G+I R DYP+ PT +
Sbjct: 99  NDRLMVPFSHSR--SSSPLRGQSGTSMSLIDSTMNGLDGIHVGADGRITRTDYPSRPTIV 156

Query: 181 NDALVISRAYANWRQLWIKKKNQIDHRLEQKRDFFNYPTILFPPNKKKSSEGATPTIKFN 240
           NDALVI+R + ++  LW+K+K QID RL  +   F +P ILFPP K             N
Sbjct: 157 NDALVINRTHKDYSALWLKRKEQIDQRLRSREAHFVFPDILFPPEKVA-----------N 205

Query: 241 PPIEDGFTPLTKSQKRKERVLSEKVGFPNTPRTILCHISGRKHTWVALDWALRTLIQNTD 300
            P+ DG+TPL+K ++RK  ++ +K+G+PN+PRTILC+ISGRKHTWV+LDW L+   Q+ D
Sbjct: 206 LPLSDGYTPLSKEERRKALIIGKKIGYPNSPRTILCYISGRKHTWVSLDWLLKRFSQDVD 265

Query: 301 HIVVLANLPRLTKNNFEDNDSMSERKRMLMMMDDXXXXXXXXXXXXXXXXXXXXXXXALS 360
           H+V++ NLP+++ +                                            LS
Sbjct: 266 HLVIITNLPKMSNHRSRSRSRSRSTAPRSRS----------AAPSTHSSSGVSSIQRTLS 315

Query: 361 LGPEESDNKLKHQNFIEWTSGYTQNEIERKLQDLFDYVTLIIPQDRSVKVTVEILIGKTK 420
                  NK  H++++EW SGY  ++I+  L ++  YVT I+P  R+VKVTVEI+IGK +
Sbjct: 316 ADGHGDHNKHVHEHWLEWASGYDADQIKETLNNILRYVTTILPDHRAVKVTVEIVIGKLQ 375

Query: 421 KTLLEAINIYLPDFFVSSTLRWERTDSLVRWKSNFLTDKLCTNFPIPTFIVPAKRMFDLE 480
           K +++AIN+Y PD  V S+LR +  +SLVRWKSN + DK+C   PIP  +VP K+M +LE
Sbjct: 376 KIVVDAINVYGPDLIVLSSLRSKPDESLVRWKSNGVNDKICQTLPIPILLVPVKKMLELE 435

Query: 481 IDLQKEFKEPEVTKQKNTSGPKPGFSHSKSADASIPTISNIKRKQDNDYSIDSLCYAPEA 540
            ++  E  E    ++      +P     KSA   + + S+ K     +   DS      +
Sbjct: 436 NEVFNEICECSAGEKCTEDCKRPSMRQLKSAPQILKSYSSQKSSSSTNTGKDSSRTIDTS 495

Query: 541 NGAN-NSSREEASDDELNAFKDDENDVMSVKSLTSNISVKEKLCTMARKRRKSMAQQLND 599
           N  + +S    ++D++L    D E+ + +                     R+ +  ++ D
Sbjct: 496 NTTSLDSLMSSSADNDLKTDADLEDHLETC--------------------RREIKAKMLD 535

Query: 600 ADHDSSIPPGQRHLKKLNIILESSLKFSLEIDSITDSIENGDVDEKRAHSMESGFEELKR 659
            D+D+ +   ++ + KL+ I  +SL F  E+D              +  S ES FEELKR
Sbjct: 536 IDNDTRLSSEEKIILKLDSITNASLHFINELDD-------------KGRSTES-FEELKR 581

Query: 660 VITGGAPPRHVATPQRSMLDV 680
           VITG    R     ++SMLDV
Sbjct: 582 VITGDT-NRDTVRAKKSMLDV 601

>YOR019W (YOR019W) [4832] chr15 (368126..370318) Protein of unknown
           function [2193 bp, 730 aa]
          Length = 730

 Score =  305 bits (781), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 196/577 (33%), Positives = 299/577 (51%), Gaps = 108/577 (18%)

Query: 70  YLPCVSFNTVPRSRVSSPLDEEKREFPGVQISADYTMEEYYDDESGFTSDNNADYFSGNS 129
           + P V+F+TVP +   S +D+ +  F GV +   YTMEE YDDE+   S N   Y     
Sbjct: 44  FQPSVAFDTVPSTAGYSSIDDSREGFKGVPVPNYYTMEECYDDETDSFSPNLQYYLRDTF 103

Query: 130 YSS---------RREGSASPGRYSSPPPASKRNIKIGKMFKISENGKIVREDYPTTPTDI 180
            SS         + E S+ P R S      ++N  I K F +S+NGKIVR DYP+TP  +
Sbjct: 104 QSSPFLNTRKENKSESSSFPMRSSK---LLEKNSDIKKYFLVSKNGKIVRRDYPSTPVIV 160

Query: 181 NDALVISRAYANWRQLWIKKKNQIDHRLEQKRDFFNYPTILFPPNKKKSSEGATPTIKFN 240
           N+ L+I+R   NW +LW ++K QI+ RL  K+ +F YP ++F      S E   P  +  
Sbjct: 161 NETLMINRFEKNWIKLWRQRKLQINERLNDKKKWFTYPELIF------SEERIKPLYR-- 212

Query: 241 PPIEDGFTPLTKSQKRKERVLSEKVGFPNTPRTILCHISGRKHTWVALDWALRTLIQNTD 300
               D   P TK QKRK ++L +KVG+PN P+TI+CHI+G+KHTWVALDW +    +N D
Sbjct: 213 ---GDDSAPCTKEQKRKHKILQQKVGYPNNPKTIVCHINGKKHTWVALDWTVYKFARNLD 269

Query: 301 HIVVLANLPRLTKNNFEDNDSMSERKRMLMMMDDXXXXXXXXXXXXXXXXXXXXXXXALS 360
           HIVV+  LP++          +S RK+     DD                          
Sbjct: 270 HIVVITTLPKM----------ISNRKKT--AKDDT------------------------- 292

Query: 361 LGPEESDNKLKHQNFIEWTSGYTQNEIERKLQDLFDYVTLIIPQDR-SVKVTVEILIGKT 419
                           EW  GY +  I++KL D+FDY+  ++   + SVK+T+EI++GK 
Sbjct: 293 ----------------EWAPGYQKEVIDQKLNDIFDYILQLVKVVKISVKITLEIIVGKI 336

Query: 420 KKTLLEAINIYLPDFFVSSTLRWERTDSLVRWKSNFLTDKLCTNFPIPTFIVPAKRMFDL 479
           KK+L++ IN++ PDF V +TL+ ER ++L+ +KS  LTD    ++PIPTF+VP+KRM+  
Sbjct: 337 KKSLVDVINVHTPDFLVLATLKHERNENLITYKSKKLTDVFPVSYPIPTFVVPSKRMYSF 396

Query: 480 EIDLQKEFKEPEVTKQKNTSGPKPGFSHSKSADASIPTISNIKRKQDNDYSIDSLCYAPE 539
           E++LQ+E  E  V+K           +H K     + ++S+   K++    I S  +   
Sbjct: 397 ELNLQREVNEHYVSK-----------NHMKHEHTDVESMSSSMFKKNTISDISS--HISV 443

Query: 540 ANGANNSSREEASDDELNAFKDDENDVMSVKSLTSNISVKEKLCTMARKRRKSMA---QQ 596
            + A +  R+     + N               TSN S+  KL  +A+  R+ +    ++
Sbjct: 444 DSYAEDFKRQGYIKKQFN---------------TSNDSIPRKLTGLAQHSRRKITGDIEK 488

Query: 597 LNDADHDSSIPPGQRHLKKLNIILESSLKFSLEIDSI 633
           L D + D      +  LKK++II+  SLK SL I+++
Sbjct: 489 LQDDEKDRECTKEKLLLKKIDIIIRESLKSSLAIETL 525

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 22/30 (73%), Gaps = 4/30 (13%)

Query: 728 QIKFASSVKNVDGNAALGAIKS----RHSL 753
           QIKFA+SVK+ DG AALG  ++    RHS+
Sbjct: 584 QIKFATSVKHKDGRAALGKARNLPDIRHSI 613

>AEL233C [2273] [Homologous to ScYOR019W - SH; ScYDR475C - SH]
           (193752..196133) [2382 bp, 793 aa]
          Length = 793

 Score =  290 bits (743), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 201/630 (31%), Positives = 315/630 (50%), Gaps = 84/630 (13%)

Query: 70  YLPCVSFNTVPRSRVS------SPLDEEKREFPGVQISADYTMEEYYDDESGFTSDNNAD 123
           ++P +SF+TVP   +S        L E +R +     S DYT+EEYY++E    +  N D
Sbjct: 71  FVPTISFDTVPIQGISPEEDEQDALHEHQRAY---GTSLDYTLEEYYNNED---TSYNHD 124

Query: 124 YFSGNSYSSRRE--GSASPGRYSSPPPASKRNIKIGKMFKISENGKIVREDYPTTPTDIN 181
           Y SG  Y+       S SP RY S    +K        F +  +G+ VR DYP+  T ++
Sbjct: 125 YRSGGGYAGELSPLRSLSPSRYGSGAQLAK--------FDVLPDGRRVRIDYPSKSTLLS 176

Query: 182 DALVISRAYANWRQLWIKKKNQIDHR-LEQKRDFFNYPTILFPPNKKKSSEGATPTIKFN 240
           D+ V+++ +  WR  W  +K QI+ R LE+ + ++ YP+ILFP  K   S+         
Sbjct: 177 DSFVLNKTHREWRSKWKARKAQIERRKLEEPQRWYRYPSILFPETKVDLSD--------L 228

Query: 241 PPIEDGFTPLTKSQ----KRKERVLSEKVGFPNTPRTILCHISGRKHTWVALDWALRTLI 296
           P I D       +Q    KR  RV+   VGFP +PR +LCH+SGRKHTW A+DW L+  I
Sbjct: 229 PMINDEGVAYNSNQRANMKRIARVVRTPVGFPVSPRIVLCHVSGRKHTWAAVDWVLQNFI 288

Query: 297 QNTDHIVVLANLPRLTKNNFEDNDSMSERKRMLMMMDDXXXXXXXXXXXXXXXXXXXXXX 356
            ++DH+VV+ANLPRL          MS    M   +                        
Sbjct: 289 ADSDHLVVVANLPRL----------MSRFGYMSRSVSRSRSRSRSRSVRRTTGLNSTS-- 336

Query: 357 XALSLGPEESDNKLKHQNFIEWTSGYTQNEIERKLQDLFDYVTLIIPQDRSVKVTVEILI 416
              S G + S++  K+++  EW +GYT   IE  L  L +Y+T IIP+  ++KVTVE++I
Sbjct: 337 ---SFGSDVSESMTKNKDE-EWCNGYTVGSIETILDHLIEYITFIIPEKLAIKVTVEVMI 392

Query: 417 GKTKKTLLEAINIYLPDFFVSSTLRWERTDSLVRWKSNFLTDKLCTNFPIPTFIVPAKRM 476
           GKT++ L+EA+N++ PD  V+ST +++  D L+  +S  LT  L   +P+P F+VPAKRM
Sbjct: 393 GKTRQVLIEALNLHCPDLLVASTTKYKENDGLLDHRSKRLTTVLANYYPLPVFVVPAKRM 452

Query: 477 FDLEIDLQKEFKEPEVTKQKNTSGPKPGFSHSKSADASIPTISNIKRKQDN-DYSIDSLC 535
           F L + L+      +     N + P      S+  D+  P   ++K    +    + +  
Sbjct: 453 FLLGMQLESIVHGSDAC---NAAAPVSQQFSSEVGDSLAPFKPSLKTMHTSPAVMLHTES 509

Query: 536 YAPEANGANNSSREEASDDELNAFKDDENDVMSVKSLTSNISVKEKLCTMARKR---RKS 592
             PE     + S   + D EL+   D   +    + L      ++ +  +AR R   R+ 
Sbjct: 510 SVPEVEYGMDESEITSIDSELS---DGVTEYAGTELLQ-----QDPVGRVARMRETYRRR 561

Query: 593 MAQQLNDADHDSSIPPGQRHLKKLNIILESSLKFSLEIDSITDSIENGDVDEKRAHSMES 652
           + ++ +  D DS++   +RH  KL+ ++ +SLKF+ E++                +S   
Sbjct: 562 VQKRFSKIDSDSTLQADERHFNKLDAVINASLKFNKELE----------------NSKSP 605

Query: 653 GFEELKRVITGGAPPRHVATPQRSMLDVLD 682
              EL+R+ITGG   +H    ++SMLDVLD
Sbjct: 606 SILELQRIITGGE--KHTGFRKKSMLDVLD 633

>Scas_699.29
          Length = 716

 Score =  278 bits (712), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 217/705 (30%), Positives = 328/705 (46%), Gaps = 154/705 (21%)

Query: 72  PCVSFNTVPRSRVSSPLDEEKREFPGVQISADYTMEEYYDDESGFTSDNNADYFSGNSYS 131
           PCVSFNTVP S  SS  +    +F GV + +      YY +           Y S +   
Sbjct: 35  PCVSFNTVPSS--SSEKEYPDLDFEGVTMPSMKRQPFYYHE-----------YPSNSQLC 81

Query: 132 SRREGSASPGRYSSPPPASKRNIKIGKMFKISENGKIVREDYPTTPTDINDALVISRAYA 191
           S    S +P          KR   + +MFK+++ GKIVR DYP+ P   N+A+++++   
Sbjct: 82  S----SKNP----------KRQKSMNEMFKMAQGGKIVRVDYPSRPMVDNEAMIMTKKQP 127

Query: 192 NWRQLWIKKKNQIDHRLEQKRD-FFNYPTILFP-PNKKKSSEGATPTIK--------FNP 241
            WR+ W ++K  I+ R +   D  F Y  ILFP   K+K  +G+  T+K         + 
Sbjct: 128 LWRKKWRERKKIIEARRKCDGDSVFKYRFILFPHEEKQKEGKGSGGTLKKRYMGLSNNSS 187

Query: 242 PIEDGFTPLTKSQKRKERVLSEKVGFPNTPRTILCHISGRKHTWVALDWALR-------- 293
                     K QKR++ V++ K+G  N PRTI+CHISGR+HTWVALDW  +        
Sbjct: 188 HSSSKTDVKLKEQKRQKEVINLKIGDTNLPRTIVCHISGRRHTWVALDWLFKELVQDTDH 247

Query: 294 -TLIQNTDHIVVLANLPRLTKNNFEDNDSMSERKRMLMMMDDXXXXXXXXXXXXXXXXXX 352
             ++ N   +V  + +   TK   +D   + E                            
Sbjct: 248 VVILANLPRMVCRSKVAPDTKKIIQDEPKLLEE--------------------------- 280

Query: 353 XXXXXALSLGPEESDNKLKHQNFIEWTSGYTQNEIERKLQDLFDYVTLIIPQDRSVKVTV 412
                                   EWTSGY++N +  ++  + +Y++LI+P D+S+K+TV
Sbjct: 281 ------------------------EWTSGYSENLVASRIARILEYISLILPVDKSIKITV 316

Query: 413 EILIGKTKKTLLEAINIYLPDFFVSSTLRWERTDSLVRWKSNFLTDKLCTNFPIPTFIVP 472
           EI IGKTKK L++AINIY P+ FV  TL+W +T++L+ +KSN L D  C ++PIPTFIVP
Sbjct: 317 EIAIGKTKKVLIDAINIYTPNLFVFGTLKWSKTENLISYKSNILMDTFCVHYPIPTFIVP 376

Query: 473 AKRMFDLEIDLQKEFKEPEVTK--QKNTSGPKPGFSHSKSADASIPTISNIKRKQDNDYS 530
           A+RM   E+ LQ++F   E  K  +KN        +H    + +  +I    + Q     
Sbjct: 377 ARRMSKFELSLQEQFANCEQQKSFKKN--------NHVDKVNKNQQSIMLAVQSQ----- 423

Query: 531 IDSLCYAPEANGANNS--SREEASDDELNAFKDDENDVMSVKSLTSNISVKEKLCTMARK 588
            DSL    E++   +S  S E+ SDD     KDD   V +++S ++    +  LC +AR 
Sbjct: 424 -DSLTAGYESSTETDSLDSVEKTSDD-----KDDNESVDTLRSYSNQTGTRANLCNIARD 477

Query: 589 RRKSMAQQLNDADHD-SSIPPGQRHLKKLNIILESSLKFSLEIDSITDSIENGDVDEKRA 647
            R SM ++LN  + +   +   +R L KL+II+++S++  L+ D         ++DE+  
Sbjct: 478 YRHSMLKELNTLEANKKKLTNQERQLGKLDIIIKASIRLVLKTD---------EIDEQSI 528

Query: 648 HSMESGFEELKRVITGGAPPRHVATPQRSMLDVLDNXXXXXXXXXXXXXXXXXXXXXXXX 707
            +    +  LK  ITGG   R  + P RSMLDV                           
Sbjct: 529 ATNNKDYMNLKTTITGGK-SRSQSRP-RSMLDV----------------------NGYDP 564

Query: 708 XXXTATDINXXXXXXXXXXPQIKFASSVKNVDGNAALGAIKSRHS 752
              T                QI+FA +V   DG +ALG IK   S
Sbjct: 565 RAETKQSELGATLYQSRGSSQIRFAGNVNPKDGKSALGTIKKPQS 609

>CAGL0H08261g 810168..812372 weakly similar to tr|Q99248
           Saccharomyces cerevisiae YOR019w, hypothetical start
          Length = 734

 Score =  159 bits (401), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 126/384 (32%), Positives = 190/384 (49%), Gaps = 66/384 (17%)

Query: 378 WTSGYTQNEIERKLQDLFDYVTLIIPQDRSVKVTVEILIGKTKKTLLEAINIYLPDFFVS 437
           W SGYT +EI+  + DLF+Y+ +I P  +++KVT+EI I +TK  L++AIN+Y PDF + 
Sbjct: 287 WVSGYTFDEIDTIISDLFEYIKVIKPVHKALKVTIEISIERTKGALIDAINVYSPDFLIL 346

Query: 438 STLRWERTDSLVRWKSNFLTDKLCTNFPIPTFIVPAKRMFDLEIDLQKEFKEPEVTK--- 494
            TL+W+R ++LV ++ N + DKLCT FPIPTFIVPA+R+F LE    KE +E  +TK   
Sbjct: 347 GTLKWQRYENLVSYRGNNMVDKLCTTFPIPTFIVPARRLFMLE----KEIEEETLTKLIS 402

Query: 495 --QKNTSGPK------PGFSHSKSADASIPTISNIKRKQDNDYSIDSLCYAPEANGANNS 546
              K    P+      P      S D+      N ++  D  YSI +     +   +  S
Sbjct: 403 DNTKKAVTPENEEIEYPRSPKLVSTDSFGFWSKNEQKLLDESYSISTKDKLEKRQESFTS 462

Query: 547 SREEASDDELNAFKDDENDVMSVKSLTSNISVKEKLCTMARKRRKSMAQQLNDADHD-SS 605
                S+D L    DD+ D   ++S  S +S   KL ++A   RK+M   L + D++ S+
Sbjct: 463 LTTHESEDSLAIEDDDDRDSNLLESTESIVS---KLKSIAITNRKNMMADLEEFDNEHSN 519

Query: 606 IPPGQRHLKKLNIILESSLKFSLEIDSITDSIENGDVDEKRAHSMESGFEELKRVITGGA 665
           I   +  L K+++I++ SL  S  I ++T +++    +E R      GF  L++VITG  
Sbjct: 520 INTKENQLAKVSLIIKHSLNSSNTIKNLTQNLD----EENR------GFAVLQKVITGTG 569

Query: 666 PPRHVATPQRSMLDVLDNXXXXXXXXXXXXXXXXXXXXXXXXXXXTATDINXX---XXXX 722
                + P+ SM+D                                A  +N         
Sbjct: 570 TVE--SRPKFSMVD--------------------------------AVRVNGKIPGESSA 595

Query: 723 XXXXPQIKFASSVKNVDGNAALGA 746
                QIKFAS+VK  DG A LG 
Sbjct: 596 KKRRSQIKFASNVKPTDGTAGLGT 619

 Score =  151 bits (381), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 87/255 (34%), Positives = 142/255 (55%), Gaps = 30/255 (11%)

Query: 72  PCVSFNTVPRSRVSSPLDEEKREFPGVQISADYTMEEYYDDESGFTSDN----NADYFSG 127
           P VS++TVP+    S +++    FPGV+++      +      G T  +    N  +   
Sbjct: 36  PSVSYDTVPKYIGYSAIEDMDGGFPGVEVTKHTVPVKTDLSRKGATLGSQVFLNPRFLLH 95

Query: 128 NSYSS----------RREGSASPGRYSSPPPASKRNIKIGKMFKISENGKIVREDYPTTP 177
           N  S           +R   ASP   ++ P +  R+ K   +F  + +GKI+R DYPT P
Sbjct: 96  NHVSGDDDYEIERMKKRIFDASP--LANNPLSLTRSKK--SVFNYTADGKIIRSDYPTKP 151

Query: 178 TDINDALVISRAYANWRQLWIKKKNQIDHRLEQKRDFFNYPTILFPPNKKKSSEGATPTI 237
             +N  ++ SR   +W + W ++K++I++ +E K + F YP ILFP  K+K      P I
Sbjct: 152 VFVNKIIIRSRTNVHWDERWAQRKSKIEYNMEHKDEKFMYPDILFPEVKEK------PLI 205

Query: 238 KFNPPIEDGFTPLTKSQKRKERVLSEKVGFPNTPRTILCHISGRKHTWVALDWALRTLIQ 297
                + D F P+TK Q+R+ ++L+ K   P  PRT++C+ISGR+HTW  LDWA+R+L +
Sbjct: 206 -----MGDDFVPITKEQRRRNKILTIKQAHPTLPRTVVCYISGRRHTWAGLDWAVRSLAE 260

Query: 298 NTDHIVVLANLPRLT 312
           N DH+V++A +P++T
Sbjct: 261 N-DHLVIVATIPKMT 274

>KLLA0F02684g 242962..245301 some similarities with sgd|S0005545
           Saccharomyces cerevisiae YOR019w, hypothetical start
          Length = 779

 Score =  127 bits (318), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 89/265 (33%), Positives = 136/265 (51%), Gaps = 40/265 (15%)

Query: 67  NEKYLPCVSFNTVPRSRVSSPLDEEKREFPGVQISADYTMEEYYDDESGFTSDNNADYFS 126
            EK +P VS++TVP   VS+    E+  +     + DY ++ +YD      SD++ D   
Sbjct: 51  GEKLVPTVSWDTVPIEGVSN----EESGYDSDPHNLDYALDRFYD------SDDSHDDIR 100

Query: 127 GNSYSSRREGSASPG-----RYSSPPPASKRN-----IKIG------KMFKISENGKIVR 170
               SSR     +P      R SSP    + N     + +G      K+F    NG+I R
Sbjct: 101 HGRGSSRTHLGITPTLTDRVRGSSPMRPRQNNDFTFQLDVGGSSNNPKIF-FGPNGEIRR 159

Query: 171 EDYPTTPTDINDALVISRAYANWRQLWIKKKNQIDHRLEQK-RDFFNYPTILFPPNKKKS 229
            DYP+ P   N+AL+ ++ + +W+  W ++  +++ R E     +F +P ILFP  K   
Sbjct: 160 RDYPSRPVLFNNALIRTQYHKDWKHEWRQRVEKMEERKETGVSTYFKFPEILFPKVKVDL 219

Query: 230 SEGATPTIKFNPPIEDGFTPLTK----SQKRKERVLSEKVGFPNTPRTILCHISGRKHTW 285
           ++         P + D    + K    S KR  +V+   VG   TPRTIL HISGR+HTW
Sbjct: 220 TDA--------PLVNDNGEMIQKERRASIKRHLKVVRTPVGLVKTPRTILVHISGREHTW 271

Query: 286 VALDWALRTLIQNTDHIVVLANLPR 310
           VALDWA+  L ++ D+IV++AN+PR
Sbjct: 272 VALDWAMAELAEDIDYIVIIANIPR 296

 Score = 93.6 bits (231), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 133/308 (43%), Gaps = 59/308 (19%)

Query: 378 WTSGYTQNEIERKLQDLFDYVTLIIPQDRSVKVTVEILIGKTKKTLLEAINIYLPDFFV- 436
           W  G T  E+   LQ L +Y TLI+   + +K+TVEI+IG T + L++++N Y PDFFV 
Sbjct: 343 WCDGCTVGEVNDLLQRLIEYSTLIM-GGKKLKITVEIVIGSTSQILIDSLNAYAPDFFVI 401

Query: 437 SSTLRWERTDSLVRWKSNFLTDKLCTNFPIPTFIVPAKRMFDLEIDLQKE--FKEPEVTK 494
            S++    + S+V  KS  L   L   FPIP F V A+RM   E  LQ++  FK+  +  
Sbjct: 402 GSSIDKYGSGSVVVHKSRHLAPVLMQYFPIPVFFVAARRMGWFEKKLQRDILFKQRVLPS 461

Query: 495 QKNTSGPKPGFSHSKSADASIPTISNIKRKQDNDYSIDSLCYAPEANGANNSSREEASDD 554
            K+T      FS S +                   S  SL                    
Sbjct: 462 DKDTDLDVSSFSVSTTETDDTENEDTDDDDDVETTSNLSLG------------------- 502

Query: 555 ELNAFKDDENDVMSVKSLTSNISVKEKLCTMARKRRKSMAQQLNDADHDSSIPPGQRHLK 614
                 + E  V  ++ L  N       C + +K        L   D D+ +P  +++  
Sbjct: 503 ------NREKTVKQIQKLRHNYR-----CLVDKK--------LKLLDEDTGLPTPEQYYG 543

Query: 615 KLNIILESSLKFSLEIDSITDSIENGDVDEKRAHSMESGFEELKRVITGGAPPRHVATPQ 674
           K++ I+ ++L F+ E+++  DS +                 E+KR ITGG  PR     +
Sbjct: 544 KMDSIINATLNFNKELETWGDSAD---------------MAEIKRSITGGVRPR--VMKK 586

Query: 675 RSMLDVLD 682
           +SMLD  D
Sbjct: 587 KSMLDFSD 594

>CAGL0F07975g complement(782229..784541) similar to sp|P50089
           Saccharomyces cerevisiae YGR237c, start by similarity
          Length = 770

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 107/223 (47%), Gaps = 21/223 (9%)

Query: 272 RTILCHISGRKHTWVALDWALRTLIQNTDHIVVLANLPRLTKNNFEDNDSMSERKRMLMM 331
           RTI+C+ISGR++TW ++DW +  +  + DH+V+++ +P   K   E   +  +RK  L  
Sbjct: 316 RTIMCYISGRRYTWSSVDWYIENVAADGDHLVIVSRVPEFEK-ELETLCNQEKRKSKLQQ 374

Query: 332 MDDXXXXXXXXXXXXXXXXXXXXXXXALSLGPEESDNKLKHQNFIEWTSGYTQNEIERKL 391
            +                         LS  P  SD      + I + +   ++      
Sbjct: 375 RN----------SDRSDRISVYSESHTLSSTP-SSDPDAVTPSTIGFRAEAIRDRAREVC 423

Query: 392 QDLFDYVTLIIPQDRSVKVTVEILIG-KTKKTLLEAINIYLPDFFVSSTLRWERTDSLVR 450
           ++L DY    + +D+  K+TVEI+    TK  +  A  +Y P+F + ST+    T++ ++
Sbjct: 424 RELLDYYAYRL-KDKITKITVEIVKSDSTKDAITGAAGVYAPNFQIISTV---STNTQIK 479

Query: 451 WKSNF--LTDKLCTNFPIPTFIVPAKRMFDLEIDLQKEFKEPE 491
           +++    L   +  ++P+PTF++P +   D  + L K++  PE
Sbjct: 480 FRNGNVKLPFFVLKHYPMPTFLIPFE-FIDPSL-LDKDYLSPE 520

>KLLA0E15642g 1393066..1395366 weakly similar to sp|P50089
           Saccharomyces cerevisiae YGR237c singleton, start by
           similarity
          Length = 766

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 102/220 (46%), Gaps = 57/220 (25%)

Query: 272 RTILCHISGRKHTWVALDWALRTLIQNTDHIVVLANLPRLTK--NNFEDNDSMSERKRML 329
           RT++C ++GR+HTW  +DW ++   ++ DH+VV  NLP   +  N  + N+S SE     
Sbjct: 328 RTVVCFLNGRRHTWATVDWFIKEAARDGDHLVVATNLPMYEELINMLKKNES-SETGSTK 386

Query: 330 MMMDDXXXXXXXXXXXXXXXXXXXXXXXALSLGPEESDNKLKHQN---FIEW---TSGYT 383
             +++                                D K+K++     ++      G  
Sbjct: 387 TKLEEFTF-----------------------------DGKIKNKTPSAVVQLPFRQVGMI 417

Query: 384 QNEIER----KLQDLFDYVTLIIPQDRSVKVTVEILIGKTKKTLL-EAINIYLPDFFVSS 438
            NE+++    K +++ +Y      QD+ +K+T+E++   + K L+   +++Y P+F V S
Sbjct: 418 INELDQLTRYKCENMLNYYAAKC-QDKVMKITIELVKELSAKPLVTHVMDLYRPNFHVVS 476

Query: 439 TLRWERTDSLVRWKS------NFLTDKLCTNFPIPTFIVP 472
           T+    T+  +++++      NFL   L     +PT I+P
Sbjct: 477 TI---STNLSIKFRNGNVKLPNFLYRHLW----VPTVIIP 509

>YGR237C (YGR237C) [2185] chr7 complement(963302..965659) Protein of
           unknown function, has weak similarity to uncharacterized
           C. albicans Orf6.794p [2358 bp, 785 aa]
          Length = 785

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 86/203 (42%), Gaps = 24/203 (11%)

Query: 272 RTILCHISGRKHTWVALDWALRTLIQNTDHIVVLANLPRLTKNNFEDN-DSMSERKRMLM 330
           R + C+ISGR++TW ++DW +  L +N DH+V++  +P      FE   D+++ +++   
Sbjct: 337 RVVSCYISGRRYTWSSVDWYVENLTRNGDHLVIITTIPE-----FEAKIDTLAYKEKRRH 391

Query: 331 MMDDXXXXXXXXXXXXXXXXXXXXXXXALSLGPEESDNKLKHQNFIEWTSGYTQNEIERK 390
            ++                         LS G             IE       NE ++ 
Sbjct: 392 RLERMTSNTSESMTTASHSLIGPDLSSPLSTGIR-----------IEA----IHNEAKQT 436

Query: 391 LQDLFDYVTLIIPQDRSVKVTVEILI-GKTKKTLLEAINIYLPDFFVSSTLRWERTDSLV 449
             D+ +Y    +   + V++++E++    T+  ++ A ++Y P   V ST+         
Sbjct: 437 CSDILNYYARRLAT-KIVRISIEMVKENSTRSAIISATSLYRPSLQVISTVSANIQIKFR 495

Query: 450 RWKSNFLTDKLCTNFPIPTFIVP 472
             K   L   L  +F +P F+VP
Sbjct: 496 NGKVK-LPFFLMKHFAMPAFVVP 517

>Kwal_14.1028
          Length = 680

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 29/38 (76%)

Query: 272 RTILCHISGRKHTWVALDWALRTLIQNTDHIVVLANLP 309
           RTI+C ISGRKHTW A+DW ++ L ++ D++++   +P
Sbjct: 308 RTIICSISGRKHTWSAVDWYVKNLARDGDYLIIATRIP 345

>Scas_595.13
          Length = 766

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/224 (21%), Positives = 98/224 (43%), Gaps = 33/224 (14%)

Query: 255 KRKERVLSEKVGFPNTPRTILCHISGRKHTWVALDWALRTLIQNTDHIVVLANLPRLTKN 314
           K KER+ S++       RT+ C+ISGR+ TW  +DW +  + ++ DH++++  +P     
Sbjct: 320 KTKERLHSKEKEAITALRTVSCYISGRRFTWATVDWYIENIAKDGDHVIIMTCIPEF--- 376

Query: 315 NFEDNDSMSERKRMLMMMDDXXXXXXXXXXXXXXXXXXXXXXXALSLGPEESDNKLKHQN 374
                +++ E+       D                          S   +  ++K+    
Sbjct: 377 -----ETLVEKANYQAFRD--------RLNSDGTSPSISRSSKDSSFNKDGYESKISEGL 423

Query: 375 FIEWTSGYTQNEIERKLQDLFDYVTLIIPQDRSVKVTVEILIGKTKKTLLEAIN-IYLPD 433
           +IE        E   K + + +Y    + +++ VK+T+E++   + K  + AI  +Y P+
Sbjct: 424 YIEA----IYQEARTKCRQILNYYAKRL-ENKKVKITIEMVKDNSSKRAVNAIEALYRPN 478

Query: 434 FFVSSTLRWERTDSLVRWKSN-----FLTDKLCTNFPIPTFIVP 472
             + ST+    T+  +++++      F    +  +F IP FIVP
Sbjct: 479 LQLFSTV---STNIQIKFRNGNVKFPFF---IMKHFFIPVFIVP 516

>ADL147W [1594] [Homologous to ScYGR237C - SH]
           complement(431887..433767) [1881 bp, 626 aa]
          Length = 626

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 36/62 (58%)

Query: 271 PRTILCHISGRKHTWVALDWALRTLIQNTDHIVVLANLPRLTKNNFEDNDSMSERKRMLM 330
           PRT+ C++SGR+H+W A+D  +    ++ DH+V+ A LP   +     +   SER +  +
Sbjct: 245 PRTVACYLSGRRHSWSAVDAYINMFARSGDHLVIWAYLPMYDREITNLSSKTSERPKSSL 304

Query: 331 MM 332
            M
Sbjct: 305 DM 306

>Kwal_26.7496
          Length = 436

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 78/200 (39%), Gaps = 37/200 (18%)

Query: 422 TLLEAINIYLPDFFVSSTLRWERTDS--LVRWKSN---FLTDKLCTNFPIPTFIVPAKRM 476
           T +     +  DFF+++ +   R +S  + R+ SN   FL    C    + T   P   +
Sbjct: 67  TAISEFGWFYGDFFLTNYISSRRLNSQGIYRYLSNPERFLGVAGCWGAVLITHFSPYSMI 126

Query: 477 FDL-----EIDLQKEFKEPEVTKQKNTSGPKPGFSHSKSADASIPTISNIKRKQDNDYSI 531
                    I L K  +EP V K   TSG K G + +      I   S I  K +    I
Sbjct: 127 LAATWTIANIILVKLVEEPHVNKIYGTSGRKSGVAKTLLGFKPIRKFSEIMEKMELRL-I 185

Query: 532 DSLCYAPEANGANNSSREEASDDELNAFKDDENDVMSV--KSLTSNISVKEKLCTMARKR 589
             L        +N S   E S DE    +D  N+V+ V  +S T+N+S   +        
Sbjct: 186 GHLV-------SNESPFSETSLDE----RDQWNEVVEVALQSFTANLSPNCEF------- 227

Query: 590 RKSMAQQLNDADHDSSIPPG 609
                 ++ D + D+ I PG
Sbjct: 228 ------KVGDGNSDTFIIPG 241

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.130    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 26,118,914
Number of extensions: 1148195
Number of successful extensions: 3663
Number of sequences better than 10.0: 69
Number of HSP's gapped: 3743
Number of HSP's successfully gapped: 83
Length of query: 861
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 751
Effective length of database: 12,788,129
Effective search space: 9603884879
Effective search space used: 9603884879
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)