Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR302W (GPI11)2192169811e-137
Sklu_1122.12411886141e-80
Kwal_47.181962581886003e-78
CAGL0H01485g2171865772e-75
Scas_588.122152015391e-69
KLLA0C10252g2172035382e-69
AAL059W2171865182e-66
ACR241C79544652.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR302W
         (216 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR302W (GPI11) [1130] chr4 (1067723..1068382) Protein involved ...   382   e-137
Sklu_1122.1 YDR302W, Contig c1122 522-1247                            241   1e-80
Kwal_47.18196                                                         235   3e-78
CAGL0H01485g 146756..147409 similar to tr|Q06636 Saccharomyces c...   226   2e-75
Scas_588.12                                                           212   1e-69
KLLA0C10252g complement(878425..879078) similar to sgd|S0002710 ...   211   2e-69
AAL059W [128] [Homologous to ScYDR302W (GPI11) - SH] complement(...   204   2e-66
ACR241C [1288] [Homologous to ScYKR064W - SH] (784358..786745) [...    30   2.0  

>YDR302W (GPI11) [1130] chr4 (1067723..1068382) Protein involved in
           glycosylphosphatidylinositol (GPI) biosynthesis, with
           similarity to GPI-anchor biosynthesis protein PIG-F [660
           bp, 219 aa]
          Length = 219

 Score =  382 bits (981), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 192/216 (88%), Positives = 192/216 (88%)

Query: 1   MPAXXXXXXXXXXXXSFSDDTTLTTHQNREKKNVDHDRPPVYVRKTPLMTFPYHLVALLY 60
           MPA            SFSDDTTLTTHQNREKKNVDHDRPPVYVRKTPLMTFPYHLVALLY
Sbjct: 1   MPAKKRTRKTVKKTVSFSDDTTLTTHQNREKKNVDHDRPPVYVRKTPLMTFPYHLVALLY 60

Query: 61  YYVFVSSNFNTVKLLSFLIPTQVAYLVLQFNKCTVYGNKIIKINYSLTIICLGVTFLLSF 120
           YYVFVSSNFNTVKLLSFLIPTQVAYLVLQFNKCTVYGNKIIKINYSLTIICLGVTFLLSF
Sbjct: 61  YYVFVSSNFNTVKLLSFLIPTQVAYLVLQFNKCTVYGNKIIKINYSLTIICLGVTFLLSF 120

Query: 121 PTMLLTILFGAPLMDLLWETWLLSLHFAFLAYPAVYSVFNCDFKVGLWKKYFIFIVVGGW 180
           PTMLLTILFGAPLMDLLWETWLLSLHFAFLAYPAVYSVFNCDFKVGLWKKYFIFIVVGGW
Sbjct: 121 PTMLLTILFGAPLMDLLWETWLLSLHFAFLAYPAVYSVFNCDFKVGLWKKYFIFIVVGGW 180

Query: 181 ISCVVIPLDWDRDWQNWPIPIXXXXXXXXXXXXTIG 216
           ISCVVIPLDWDRDWQNWPIPI            TIG
Sbjct: 181 ISCVVIPLDWDRDWQNWPIPIVVGGYLGALVGYTIG 216

>Sklu_1122.1 YDR302W, Contig c1122 522-1247
          Length = 241

 Score =  241 bits (614), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  SFSDDTTLTTHQ--NREKKNVDHDRPPVYVRKTPLMTFPYHLVALLYYYVFVSSNFNTVK 73
           SFSDD +L   +  N +KK +DHD PPVYVR+T  +T P+HL+ LLYY++ +S N++ V 
Sbjct: 37  SFSDDESLNRARQLNHKKKRIDHDNPPVYVRRT-YLTIPFHLLPLLYYFIKISDNYDVVS 95

Query: 74  LLSFLIPTQVAYLVLQFNKCTVYGNKIIKINYSLTIICLGVTFLLSFPTMLLTILFGAPL 133
           LL + IP Q+ YLV QFNK TVYGNKI+K N  L  + LG   LLS P M++ +LFGA  
Sbjct: 96  LLWYSIPPQILYLVFQFNKSTVYGNKILKTNLGLLFVSLGACLLLSVPAMVIIVLFGAFF 155

Query: 134 MDLLWETWLLSLHFAFLAYPAVYSVFNCDFKVGLWKKYFIFIVVGGWISCVVIPLDWDRD 193
            +LL ETWLL+LH  FL++PAVYSVFNCDFKVG++KKYFI IV+G WISC+VIPLDWDRD
Sbjct: 156 TELLKETWLLALHCCFLSFPAVYSVFNCDFKVGVFKKYFISIVIGCWISCIVIPLDWDRD 215

Query: 194 WQNWPIPI 201
           WQNWPIPI
Sbjct: 216 WQNWPIPI 223

>Kwal_47.18196
          Length = 258

 Score =  235 bits (600), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 118/188 (62%), Positives = 143/188 (76%), Gaps = 3/188 (1%)

Query: 16  SFSDDTTLTTHQ--NREKKNVDHDRPPVYVRKTPLMTFPYHLVALLYYYVFVSSNFNTVK 73
           SFSDD +L+  Q  N +K   D D PPV+++KT L+T P HL+ALLYYY+ VS +F+TV 
Sbjct: 54  SFSDDESLSRSQISNNKKHRSDTDGPPVFLKKT-LLTVPVHLIALLYYYIKVSKDFDTVI 112

Query: 74  LLSFLIPTQVAYLVLQFNKCTVYGNKIIKINYSLTIICLGVTFLLSFPTMLLTILFGAPL 133
           LL  LIP QV YL++QFNK TVYG KI+KI  SL  I L  T LL+ P ML+ IL GAP 
Sbjct: 113 LLYALIPLQVLYLIIQFNKSTVYGRKILKIKLSLVPITLVATLLLTVPCMLIIILMGAPF 172

Query: 134 MDLLWETWLLSLHFAFLAYPAVYSVFNCDFKVGLWKKYFIFIVVGGWISCVVIPLDWDRD 193
             LL ETWLL+ H  FLA+PAVYSVFNC+FKVG++KKYFI I +G WISC+VIPLDWDRD
Sbjct: 173 AMLLQETWLLAAHCCFLAFPAVYSVFNCEFKVGIFKKYFISIAIGCWISCIVIPLDWDRD 232

Query: 194 WQNWPIPI 201
           WQ+WPIP+
Sbjct: 233 WQSWPIPL 240

>CAGL0H01485g 146756..147409 similar to tr|Q06636 Saccharomyces
           cerevisiae YDR302w GPI11, start by similarity
          Length = 217

 Score =  226 bits (577), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 147/186 (79%), Gaps = 1/186 (0%)

Query: 16  SFSDDTTLTTHQNREKKNVDHDRPPVYVRKTPLMTFPYHLVALLYYYVFVSSNFNTVKLL 75
           SFSDD T T H +  +K  + +RPPV++RKT  +T P+HL+AL+Y YV V +N+NT +LL
Sbjct: 15  SFSDDITQTQHNHHHRKKQNGERPPVFIRKT-WLTIPWHLIALVYIYVKVFNNYNTAELL 73

Query: 76  SFLIPTQVAYLVLQFNKCTVYGNKIIKINYSLTIICLGVTFLLSFPTMLLTILFGAPLMD 135
           + L+P Q+ Y + QFNK T+YGNK +K NYSL  I +    +LS P +++ ILFGAPL++
Sbjct: 74  ACLVPLQILYTIFQFNKATIYGNKRLKFNYSLAAISILACIVLSIPVVVIIILFGAPLLE 133

Query: 136 LLWETWLLSLHFAFLAYPAVYSVFNCDFKVGLWKKYFIFIVVGGWISCVVIPLDWDRDWQ 195
           LLWETWLL+LH +FLAYPAVYSV NCDFKVGLWK+YFI IVVG WISCVVIPLDWDRDWQ
Sbjct: 134 LLWETWLLALHCSFLAYPAVYSVLNCDFKVGLWKRYFILIVVGCWISCVVIPLDWDRDWQ 193

Query: 196 NWPIPI 201
            WPIPI
Sbjct: 194 AWPIPI 199

>Scas_588.12
          Length = 215

 Score =  212 bits (539), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 120/201 (59%), Positives = 146/201 (72%), Gaps = 2/201 (0%)

Query: 16  SFSDDTTLTTHQNREKKNVDHDRPPVYVRKTPLMTFPYHLVALLYYYVFVSSNFNTVKLL 75
           +FSDD T+   Q   KKNV H+ PPVYVRK  +M  P+HL+ LLY+Y++V+ ++ T KLL
Sbjct: 14  TFSDDNTMV-RQTHRKKNVGHEHPPVYVRKN-IMIIPWHLLVLLYWYLYVALDYPTDKLL 71

Query: 76  SFLIPTQVAYLVLQFNKCTVYGNKIIKINYSLTIICLGVTFLLSFPTMLLTILFGAPLMD 135
             LIPTQ+ YL+ QFN+ TVYGNKIIK+N  L  I +G T LLS P ++L ILFGAP ++
Sbjct: 72  YALIPTQLLYLIFQFNQYTVYGNKIIKLNVPLVFISMGCTILLSIPALVLIILFGAPFLE 131

Query: 136 LLWETWLLSLHFAFLAYPAVYSVFNCDFKVGLWKKYFIFIVVGGWISCVVIPLDWDRDWQ 195
            L E+ LL+LH  FLAYPA+YSVFNCDFKVGLWKKYFI IVVG W+SCVVIPLDWDR WQ
Sbjct: 132 KLKESLLLALHCCFLAYPAMYSVFNCDFKVGLWKKYFITIVVGAWLSCVVIPLDWDRPWQ 191

Query: 196 NWPIPIXXXXXXXXXXXXTIG 216
            WP+P             TIG
Sbjct: 192 AWPVPAIVGSYLGAFVGYTIG 212

>KLLA0C10252g complement(878425..879078) similar to sgd|S0002710
           Saccharomyces cerevisiae YDR302w GPI11 GPI11 - protein
           involved in glycosylphosphatidylinositol (GPI)
           biosynthesis, start by similarity
          Length = 217

 Score =  211 bits (538), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 107/203 (52%), Positives = 141/203 (69%), Gaps = 4/203 (1%)

Query: 16  SFSDDTTLTTHQ--NREKKNVDHDRPPVYVRKTPLMTFPYHLVALLYYYVFVSSNFNTVK 73
           SFSDD  LT     N  K ++D D PPVYVRK+  +  P+HL+ALLY+++   ++FN + 
Sbjct: 14  SFSDDQNLTNANLNNHRKGHIDDDTPPVYVRKSWTLI-PFHLLALLYWFL-KYTDFNLLA 71

Query: 74  LLSFLIPTQVAYLVLQFNKCTVYGNKIIKINYSLTIICLGVTFLLSFPTMLLTILFGAPL 133
           LL  +IPTQV YL+ +FNK T+YG K +++N+ L  I LG   LLS P + + +LFGAP 
Sbjct: 72  LLYIMIPTQVIYLIFRFNKNTIYGKKRLRLNWLLVFITLGACLLLSIPCLAIIVLFGAPF 131

Query: 134 MDLLWETWLLSLHFAFLAYPAVYSVFNCDFKVGLWKKYFIFIVVGGWISCVVIPLDWDRD 193
           ++LL E+WLL+LH  FL YPAVY VFNC+FKVG +KKYFI +V+G WISC VIPLDWDRD
Sbjct: 132 VELLKESWLLALHCCFLTYPAVYDVFNCNFKVGYFKKYFISVVIGCWISCFVIPLDWDRD 191

Query: 194 WQNWPIPIXXXXXXXXXXXXTIG 216
           WQ WP+P+            +IG
Sbjct: 192 WQAWPVPLIVGAYLGSFIGFSIG 214

>AAL059W [128] [Homologous to ScYDR302W (GPI11) - SH]
           complement(245111..245764) [654 bp, 217 aa]
          Length = 217

 Score =  204 bits (518), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 102/186 (54%), Positives = 127/186 (68%), Gaps = 1/186 (0%)

Query: 16  SFSDDTTLTTHQNREKKNVDHDRPPVYVRKTPLMTFPYHLVALLYYYVFVSSNFNTVKLL 75
           SFSDD  L+      K    H  PPVYVR+T   T P+HL+ L Y+++  S+ ++  K  
Sbjct: 15  SFSDDDALSRTGRLPKNLPQHGSPPVYVRRT-WQTIPFHLIVLSYWFIKHSNGYDVRKCT 73

Query: 76  SFLIPTQVAYLVLQFNKCTVYGNKIIKINYSLTIICLGVTFLLSFPTMLLTILFGAPLMD 135
             L+P QV YL LQFN  TVYGNKI+K+NY+L  +      LL+ P MLL +LFGAP ++
Sbjct: 74  WLLVPCQVLYLALQFNPATVYGNKILKLNYALLAVSGVTCILLTIPCMLLVVLFGAPFLE 133

Query: 136 LLWETWLLSLHFAFLAYPAVYSVFNCDFKVGLWKKYFIFIVVGGWISCVVIPLDWDRDWQ 195
           +L +TWLLSLH   L+YPAVYSV N DFKVG +KKYFI I VG WISC+ IPLDWDR WQ
Sbjct: 134 MLDKTWLLSLHCCVLSYPAVYSVLNSDFKVGFFKKYFISIAVGCWISCLAIPLDWDRPWQ 193

Query: 196 NWPIPI 201
            WPIP+
Sbjct: 194 EWPIPL 199

>ACR241C [1288] [Homologous to ScYKR064W - SH] (784358..786745)
           [2388 bp, 795 aa]
          Length = 795

 Score = 29.6 bits (65), Expect = 2.0,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 29/44 (65%), Gaps = 3/44 (6%)

Query: 64  FVSSNFNTVKLLSFLIPTQVAYLVLQFNKCTVYG---NKIIKIN 104
           F + N + + + + L+ T++ YL ++F+KC+V     N+I++++
Sbjct: 256 FSAKNGDLITVATILLITRLVYLAIRFDKCSVVNVKYNRILELD 299

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.330    0.144    0.483 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,746,053
Number of extensions: 280959
Number of successful extensions: 759
Number of sequences better than 10.0: 12
Number of HSP's gapped: 750
Number of HSP's successfully gapped: 12
Length of query: 216
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 119
Effective length of database: 13,238,163
Effective search space: 1575341397
Effective search space used: 1575341397
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 59 (27.3 bits)