Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR300C (PRO1)42842121630.0
Scas_588.1442341517880.0
KLLA0C10296g41841416280.0
CAGL0H01441g42741516140.0
Kwal_47.1818742141715830.0
AAL061C42041414420.0
YHR033W42341514420.0
CAGL0D03894g48546714020.0
Scas_690.3642442313320.0
KLLA0F02662g25392710.84
AGR021C38755701.3
ADR106W79837682.6
ADR126C69151664.1
YER052C (HOM3)52739656.0
Sklu_1606.139055647.4
YBR275C (RIF1)191660649.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR300C
         (421 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR300C (PRO1) [1128] chr4 complement(1061497..1062783) Glutamat...   837   0.0  
Scas_588.14                                                           693   0.0  
KLLA0C10296g 883644..884900 highly similar to sp|P32264 Saccharo...   631   0.0  
CAGL0H01441g complement(140740..142023) highly similar to sp|P32...   626   0.0  
Kwal_47.18187                                                         614   0.0  
AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - ...   560   0.0  
YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with simi...   560   0.0  
CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces c...   544   0.0  
Scas_690.36                                                           517   0.0  
KLLA0F02662g 241804..242565 some similarities with sp|Q8VEH3 Mus...    32   0.84 
AGR021C [4331] [Homologous to ScYGR012W - SH] (753763..754926) [...    32   1.3  
ADR106W [1847] [Homologous to ScYDL132W (CDC53) - SH] complement...    31   2.6  
ADR126C [1867] [Homologous to ScYKL072W (STB6) - SH; ScYMR053C (...    30   4.1  
YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate ...    30   6.0  
Sklu_1606.1 YGR012W, Contig c1606 981-2153                             29   7.4  
YBR275C (RIF1) [454] chr2 complement(751313..757063) Protein inv...    29   9.0  

>YDR300C (PRO1) [1128] chr4 complement(1061497..1062783) Glutamate
           5-kinase, carries out first step in proline biosynthesis
           pathway [1287 bp, 428 aa]
          Length = 428

 Score =  837 bits (2163), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/421 (97%), Positives = 410/421 (97%)

Query: 1   MKDANESKSYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRMGHKVIIVSSGGIA 60
           MKDANESKSYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRMGHKVIIVSSGGIA
Sbjct: 1   MKDANESKSYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRMGHKVIIVSSGGIA 60

Query: 61  VGLRTMRMNKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQY 120
           VGLRTMRMNKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQY
Sbjct: 61  VGLRTMRMNKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQY 120

Query: 121 KNAQNTINELLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALIHADYLFLLTDVDCL 180
           KNAQNTINELLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALIHADYLFLLTDVDCL
Sbjct: 121 KNAQNTINELLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALIHADYLFLLTDVDCL 180

Query: 181 YTDNPRTNPDAMPILVVPDLSKGLPGVNTAXXXXXXXXXXXMETKLVAADLATNAGVHTL 240
           YTDNPRTNPDAMPILVVPDLSKGLPGVNTA           METKLVAADLATNAGVHTL
Sbjct: 181 YTDNPRTNPDAMPILVVPDLSKGLPGVNTAGGSGSDVGTGGMETKLVAADLATNAGVHTL 240

Query: 241 IMKSDTPANIGRIVEYMQTLELDDENKVKQAYNGDLTDLQKREFEKLKALNVPLHTKFIA 300
           IMKSDTPANIGRIVEYMQTLELDDENKVKQAYNGDLTDLQKREFEKLKALNVPLHTKFIA
Sbjct: 241 IMKSDTPANIGRIVEYMQTLELDDENKVKQAYNGDLTDLQKREFEKLKALNVPLHTKFIA 300

Query: 301 NDNKHHLKNREFWILHGLVSKGAVVIDQGAYAALTRKNKAGLLPAGVIDVQGTFHELECV 360
           NDNKHHLKNREFWILHGLVSKGAVVIDQGAYAALTRKNKAGLLPAGVIDVQGTFHELECV
Sbjct: 301 NDNKHHLKNREFWILHGLVSKGAVVIDQGAYAALTRKNKAGLLPAGVIDVQGTFHELECV 360

Query: 361 DIKVGKKLPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSEYVAHR 420
           DIKVGKKLPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSEYVAHR
Sbjct: 361 DIKVGKKLPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSEYVAHR 420

Query: 421 E 421
           E
Sbjct: 421 E 421

>Scas_588.14
          Length = 423

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/415 (80%), Positives = 372/415 (89%), Gaps = 2/415 (0%)

Query: 7   SKSYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRMGHKVIIVSSGGIAVGLRTM 66
           SK YT+VIKLGSSSLVDEKTKEPKLAIMSL+VETVVKLRR+GHKVIIVSSGGIAVGLRT+
Sbjct: 4   SKCYTLVIKLGSSSLVDEKTKEPKLAIMSLLVETVVKLRRLGHKVIIVSSGGIAVGLRTL 63

Query: 67  RMNKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQYKNAQNT 126
            ++KRPKHLAEVQAIAA+GQGRLIGRWDLLFSQF QRIAQIL+TRNDI+DWTQYKNAQNT
Sbjct: 64  NLDKRPKHLAEVQAIAAVGQGRLIGRWDLLFSQFGQRIAQILITRNDIVDWTQYKNAQNT 123

Query: 127 INELLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALIHADYLFLLTDVDCLYTDNPR 186
           INELL MGV+PIVNENDTLS+ EIKFGDNDTLSAITSAL+ ADYLFLLTDVDCLYTDNPR
Sbjct: 124 INELLKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALVGADYLFLLTDVDCLYTDNPR 183

Query: 187 TNPDAMPILVVPDLSKGLPGVNTAXXXXXXXXXXXMETKLVAADLATNAGVHTLIMKSDT 246
           TNP+A PILVVPDL+KGLPGVNT+           METKL+AADLATNAGVHT+IMKSD 
Sbjct: 184 TNPEAKPILVVPDLAKGLPGVNTSSGSGSDVGTGGMETKLIAADLATNAGVHTIIMKSDI 243

Query: 247 PANIGRIVEYMQTLELDDENKVKQAYNGDLTDLQKREFEKLKALNVPLHTKFIANDNKHH 306
           P NI +IVEYMQ  +L D NK KQ Y GDL+ LQ +E   L++L+VPLHT FIANDN HH
Sbjct: 244 PGNILKIVEYMQAQDL-DTNK-KQKYQGDLSSLQDKELATLQSLHVPLHTTFIANDNLHH 301

Query: 307 LKNREFWILHGLVSKGAVVIDQGAYAALTRKNKAGLLPAGVIDVQGTFHELECVDIKVGK 366
           LKNREFWILHGLV++G+V+IDQGAY ALTRKNKAGLLP G+ID++GTFHELECVD+K+GK
Sbjct: 302 LKNREFWILHGLVTRGSVIIDQGAYNALTRKNKAGLLPVGIIDIEGTFHELECVDLKLGK 361

Query: 367 KLPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSEYVAHRE 421
           +LP+G LDP+ PLQTVG+ARCNYTS EL++IKGL S+QIEEELGY DSEY AHRE
Sbjct: 362 RLPNGELDPNTPLQTVGRARCNYTSLELSRIKGLQSEQIEEELGYADSEYAAHRE 416

>KLLA0C10296g 883644..884900 highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, start by similarity
          Length = 418

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/414 (75%), Positives = 352/414 (85%), Gaps = 5/414 (1%)

Query: 8   KSYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRMGHKVIIVSSGGIAVGLRTMR 67
           K + IVIKLGSSSLVDE+TKEPKL+IMSLIVETVVKLRR GHKVIIVSSGGIAVGL+TM 
Sbjct: 3   KQFVIVIKLGSSSLVDEETKEPKLSIMSLIVETVVKLRRRGHKVIIVSSGGIAVGLKTMN 62

Query: 68  MNKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQYKNAQNTI 127
           M  RPK L++VQAIAA+GQGRLIGRWD LFS+FDQRIAQIL+TRNDI+DWTQYKNAQNTI
Sbjct: 63  MKGRPKKLSKVQAIAAVGQGRLIGRWDSLFSEFDQRIAQILITRNDIVDWTQYKNAQNTI 122

Query: 128 NELLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALIHADYLFLLTDVDCLYTDNPRT 187
           +ELL+MGV+PIVNENDTLSV EIKFGDNDTLSAIT+AL  ADYLFLLTDVDCLYTDNPR 
Sbjct: 123 SELLSMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALTGADYLFLLTDVDCLYTDNPRA 182

Query: 188 NPDAMPILVVPDLSKGLPGVNTAXXXXXXXXXXXMETKLVAADLATNAGVHTLIMKSDTP 247
           NPDA PILVVPD+S+GLPGVNT            M+TKL+AA+LATNAGVHT+IMKSDTP
Sbjct: 183 NPDAKPILVVPDISQGLPGVNTDGGSGSDVGTGGMKTKLIAAELATNAGVHTIIMKSDTP 242

Query: 248 ANIGRIVEYMQTLELDDENKVKQAYNGDLTDLQKREFEKLKALNVPLHTKFIANDNKHHL 307
            NI +IV YMQ  + D  N++ Q    DL DLQ  E + L   +VPLHT+FIAN N HHL
Sbjct: 243 ENISKIVLYMQERD-DGVNELTQ----DLADLQLTEMQSLVNNHVPLHTRFIANSNHHHL 297

Query: 308 KNREFWILHGLVSKGAVVIDQGAYAALTRKNKAGLLPAGVIDVQGTFHELECVDIKVGKK 367
           KNR+FW+LHGLVS+GAV+ID GAY ALTRKNKAGLLPAGVI+VQG+FHE EC+DIK+G +
Sbjct: 298 KNRQFWMLHGLVSQGAVIIDIGAYEALTRKNKAGLLPAGVIEVQGSFHEHECIDIKLGVR 357

Query: 368 LPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSEYVAHRE 421
             DG LD    L+TVG+ARCNYTS+EL+KIKGL SDQIE+ LGY DSEYVAHRE
Sbjct: 358 DSDGNLDKSVALKTVGRARCNYTSTELSKIKGLQSDQIEDILGYADSEYVAHRE 411

>CAGL0H01441g complement(140740..142023) highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, hypothetical start
          Length = 427

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/415 (71%), Positives = 353/415 (85%), Gaps = 4/415 (0%)

Query: 8   KSYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRMGHKVIIVSSGGIAVGLRTMR 67
           K +TIVIKLG+SSLVDEKTKEP+LAIMSLIVETVVKLRR+GH V+IVSSG I VGL  + 
Sbjct: 9   KPFTIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKLRRLGHNVVIVSSGSIGVGLHILG 68

Query: 68  MNKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQYKNAQNTI 127
           M KRPKHL+EVQAIAAIGQ +LIGRWD LF+ F Q IAQILLTRNDILDW+QY+NAQNT+
Sbjct: 69  MEKRPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQSIAQILLTRNDILDWSQYRNAQNTV 128

Query: 128 NELLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALIHADYLFLLTDVDCLYTDNPRT 187
            ELL MGV+PI+NENDTLSV+EIKFGDNDTLSAIT+ LIHADYLFLLTDVDCLYT +PR+
Sbjct: 129 EELLKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRS 188

Query: 188 NPDAMPILVVPDLSKGLPGVNTAXXXXXXXXXXXMETKLVAADLATNAGVHTLIMKSDTP 247
           +PDA PIL+VPDLSKGLPGV+T+           M+TKLVAA+LATNAGVHT+IMKSD P
Sbjct: 189 DPDAKPILIVPDLSKGLPGVDTSSGSGSDVGTGGMQTKLVAAELATNAGVHTIIMKSDAP 248

Query: 248 ANIGRIVEYMQTL-ELDDENKVKQAYNGDLTDLQKREFEKLKALNVPLHTKFIANDNKHH 306
           +NI +IV+Y+Q+L +  ++NKV   + GDL  LQ  E+EKL  + VP HTKF+AN    H
Sbjct: 249 SNIYKIVKYIQSLHDTGEDNKV---FEGDLMKLQLEEYEKLDRMGVPFHTKFLANSISRH 305

Query: 307 LKNREFWILHGLVSKGAVVIDQGAYAALTRKNKAGLLPAGVIDVQGTFHELECVDIKVGK 366
           L+N+EFWILHGLV+ GAV+ID+GAY ALTRKNKAGLLP GVI+++G+FHE+ECVD+KVGK
Sbjct: 306 LRNKEFWILHGLVTSGAVIIDEGAYKALTRKNKAGLLPVGVIEIEGSFHEMECVDLKVGK 365

Query: 367 KLPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSEYVAHRE 421
           +LP+G LDPD+PL  VG+ARCNY S E++KIKG  SD+IE ELGY +SEY+AHRE
Sbjct: 366 RLPNGELDPDYPLTIVGRARCNYPSLEISKIKGQQSDEIENELGYCNSEYIAHRE 420

>Kwal_47.18187
          Length = 421

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/417 (70%), Positives = 348/417 (83%), Gaps = 8/417 (1%)

Query: 7   SKSYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRMGHKVIIVSSGGIAVGLRTM 66
           SK+YTIVIKLGSSSLVDEKTKEPKLA M+++VETVV+LRRMGH+V++VSSGGIAVGL+T+
Sbjct: 2   SKTYTIVIKLGSSSLVDEKTKEPKLATMAMVVETVVRLRRMGHRVVLVSSGGIAVGLKTL 61

Query: 67  RMNKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQYKNAQNT 126
            ++KRPKHLA+VQAIAA+GQGRLIGRWD LFSQF QRIAQIL+TRNDI+DWTQYKNAQNT
Sbjct: 62  NLDKRPKHLAQVQAIAAVGQGRLIGRWDALFSQFSQRIAQILITRNDIVDWTQYKNAQNT 121

Query: 127 INELLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALIHADYLFLLTDVDCLYTDNPR 186
           I+ELL MGV+PIVNENDTLSV EIKFGDNDTLSAIT+AL  ADYLFLLTDVDCLYTDNPR
Sbjct: 122 IHELLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALCGADYLFLLTDVDCLYTDNPR 181

Query: 187 TNPDAMPILVVP---DLSKGLPGVNTAXXXXXXXXXXXMETKLVAADLATNAGVHTLIMK 243
           TNP+A PILVVP    +S+G  GV T+           M TKL+AA+LATNAGV+T+IMK
Sbjct: 182 TNPNAKPILVVPATSQMSEGTLGVKTSSGSGSDVGTGGMTTKLIAAELATNAGVNTIIMK 241

Query: 244 SDTPANIGRIVEYMQTLELDDENKVKQAYNGDLTDLQKREFEKLKALNVPLHTKFIANDN 303
           S  P+NI ++V YMQ  E      +  A   ++  LQ++E  +L+   VPLHT+F+A+++
Sbjct: 242 SAEPSNISKVVSYMQNCE-----SITGAAADNVEHLQEQEMLRLQENCVPLHTRFVADES 296

Query: 304 KHHLKNREFWILHGLVSKGAVVIDQGAYAALTRKNKAGLLPAGVIDVQGTFHELECVDIK 363
           + HL NREFW+LHGLVSKGA+VIDQGAYAALTRKNKAGLLPAG+I+V+G FHE EC+D+K
Sbjct: 297 QMHLSNREFWMLHGLVSKGAIVIDQGAYAALTRKNKAGLLPAGLIEVEGNFHEHECIDLK 356

Query: 364 VGKKLPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSEYVAHR 420
           VG +L  G LDP  P+ T+G+ARCNYTS EL KIKGL SDQIE  LGY DSEYVAHR
Sbjct: 357 VGSRLATGELDPAMPVTTIGRARCNYTSVELCKIKGLQSDQIENVLGYADSEYVAHR 413

>AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - SH]
           (239518..240780) [1263 bp, 420 aa]
          Length = 420

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/414 (68%), Positives = 331/414 (79%), Gaps = 6/414 (1%)

Query: 8   KSYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRMGHKVIIVSSGGIAVGLRTMR 67
           + +TIV+KLGSSSLVDE T EPKL+IMS IVETVVKLRRMGHKV+IVSSG IAVGL+T+ 
Sbjct: 6   RKFTIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRRMGHKVVIVSSGCIAVGLKTVG 65

Query: 68  MNKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQYKNAQNTI 127
            ++RPK L+++QAIAA+GQGRLI RWD LF  F+++IAQILLTRNDI+DW+QYKNAQNT 
Sbjct: 66  TDRRPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQILLTRNDIVDWSQYKNAQNTF 125

Query: 128 NELLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALIHADYLFLLTDVDCLYTDNPRT 187
           +ELL MGV PIVNENDTLS+  +KFGDNDTLSAIT+ LI ADYLFL+TDVDCLYTDNPRT
Sbjct: 126 HELLAMGVTPIVNENDTLSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRT 185

Query: 188 NPDAMPILVVPDLSKGLPGVNTAXXXXXXXXXXXMETKLVAADLATNAGVHTLIMKSDTP 247
           NPDA PILVVPDLS+GLPGVNT+           M TK++AADLATNAGVHT+IMKS+ P
Sbjct: 186 NPDAKPILVVPDLSQGLPGVNTSSGSGSGVGTGGMATKILAADLATNAGVHTIIMKSERP 245

Query: 248 ANIGRIVEYMQTLELDDENKVKQAYNGDLTDLQKREFEKLKALNVPLHTKFIANDNKHHL 307
            ++ RIVE+M+  E         A + D   LQ  E   L+   VPLHT+FIAN  +  L
Sbjct: 246 VDMVRIVEFMEWREQ------CTAVSADAETLQTDELNLLQEHGVPLHTRFIANVWQPSL 299

Query: 308 KNREFWILHGLVSKGAVVIDQGAYAALTRKNKAGLLPAGVIDVQGTFHELECVDIKVGKK 367
             REFWILHGLVS G V+ID+GAY ALTRKNKAGLLPAGVI V+G+FHELE VD+K+G +
Sbjct: 300 NKREFWILHGLVSCGTVIIDKGAYKALTRKNKAGLLPAGVIAVEGSFHELEAVDLKIGVR 359

Query: 368 LPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSEYVAHRE 421
             DG+LD   PLQTVG+ARCNY+S E+ KIKGL S QIE  LGY DSEY+AHRE
Sbjct: 360 KADGSLDESEPLQTVGRARCNYSSVEVDKIKGLQSGQIETVLGYIDSEYIAHRE 413

>YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with
           similarity to Pro1p [1272 bp, 423 aa]
          Length = 423

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/415 (64%), Positives = 330/415 (79%), Gaps = 1/415 (0%)

Query: 7   SKSYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRMGHKVIIVSSGGIAVGLRTM 66
           +K+YTIVIKLGSSSLVDE TKEPKL+IM+LIVETV  L+RMGHKVIIVSSGGIAVGL  +
Sbjct: 2   TKAYTIVIKLGSSSLVDESTKEPKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDAL 61

Query: 67  RMNKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQYKNAQNT 126
            +  +PK L+EVQAIAA+GQGRLI RW++LFSQ+ ++ AQILLTRNDIL W QY NA+NT
Sbjct: 62  NIPHKPKQLSEVQAIAAVGQGRLIARWNMLFSQYGEQTAQILLTRNDILRWNQYNNARNT 121

Query: 127 INELLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALIHADYLFLLTDVDCLYTDNPR 186
           INELL MGVIPIVNENDTLS+ EI+FGDNDTLSAIT+AL+ AD+LFLLTDVDCLYTDNPR
Sbjct: 122 INELLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALVGADFLFLLTDVDCLYTDNPR 181

Query: 187 TNPDAMPILVVPDLSKGLPGVNTAXXXXXXXXXXXMETKLVAADLATNAGVHTLIMKSDT 246
           TNPDA PI++VP+LS+GLPGVNT+           M TKL+AADLA+NAG+ T++MKSD 
Sbjct: 182 TNPDARPIVLVPELSEGLPGVNTSSGSGSEVGTGGMRTKLIAADLASNAGIETIVMKSDR 241

Query: 247 PANIGRIVEYMQTLELDDENKVKQAYNGDLTDLQKREFEKLKALNVPLHTKFIANDNKHH 306
           P  + +IV+Y+Q         +         DLQ  E E+L+  +VP+HTKF+ANDNKH 
Sbjct: 242 PEYVPKIVDYIQH-HFRPPRHIGNGTQQQFLDLQDTELEQLRRYDVPMHTKFLANDNKHK 300

Query: 307 LKNREFWILHGLVSKGAVVIDQGAYAALTRKNKAGLLPAGVIDVQGTFHELECVDIKVGK 366
           LKNREFWILHGL++KGA++ID+ +Y  L  K+ A L P  VI+V+  FHELECVD+K+G+
Sbjct: 301 LKNREFWILHGLITKGAIIIDENSYDKLLSKDMASLTPNAVIEVRDNFHELECVDLKIGQ 360

Query: 367 KLPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSEYVAHRE 421
           +LP+G LD   P+Q+VG  R NYTS EL KIKGL S++I + LGY+ SEYVAHRE
Sbjct: 361 RLPNGELDISKPIQSVGCVRSNYTSLELAKIKGLPSEKIHDVLGYSVSEYVAHRE 415

>CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces
           cerevisiae YDR300c PRO1 or sp|P38690 Saccharomyces
           cerevisiae YHR033w, hypothetical start
          Length = 485

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/467 (58%), Positives = 341/467 (73%), Gaps = 54/467 (11%)

Query: 9   SYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRMGHKVIIVSSGGIAVGLRTMRM 68
           S TIVIKLG+SSLVDEKT+EPKL+IM+ +VETV++L+R GHKV+IVSSGGIAVGL  M M
Sbjct: 2   SQTIVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHKVVIVSSGGIAVGLNAMEM 61

Query: 69  NKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQYKNAQNTIN 128
           +K+P  LAE+QAIAAIGQGRLIGRW +LF Q+ ++IAQIL+TRNDIL WTQYKNAQNTI 
Sbjct: 62  DKKPTDLAEIQAIAAIGQGRLIGRWSMLFQQYGEKIAQILITRNDILGWTQYKNAQNTIL 121

Query: 129 ELLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALIHADYLFLLTDVDCLYTDNPRTN 188
           +LL MGV+PIVNENDTLS+ EIKFGDNDTLSAIT+AL+ AD+LFLLTDVDCLYT+NPRTN
Sbjct: 122 QLLEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTN 181

Query: 189 PDAMPILVVPDLSKGLPGVNTAXXXX-XXXXXXXMETKLVAADLATNAGVHTLIMKSDTP 247
           PDA PI++VP++ +G+PGV+T+            M TKL+AADLATNAGV+T+IMKSD P
Sbjct: 182 PDAKPIVIVPNMDQGVPGVDTSNADAGSSVGTGGMRTKLIAADLATNAGVNTIIMKSDAP 241

Query: 248 ANIGRIVEYMQTLE---LDDENKVKQAYNG--------------------------DLTD 278
           +N+  IV+Y+       L D+NK  +  +                           DL  
Sbjct: 242 SNVKHIVDYLVKYPKKVLYDDNKSSREQSSEPLSLDQLKNHPYGKGGVISPPKSEEDLLS 301

Query: 279 LQKREFEKLKALNVPLHTKFIANDNKHHLKNREFWILHGLVSKGAVVIDQGAYAALTRKN 338
           LQ  E +++K  NVPLHT F+A D  HHLKNREFWILHGLV+KG ++ID+ AY  LT ++
Sbjct: 302 LQDAELKEIKERNVPLHTVFLAKDIDHHLKNREFWILHGLVTKGVLIIDEDAYNTLTNES 361

Query: 339 ------------------------KAGLLPAGVIDVQGTFHELECVDIKVGKKLPDGTLD 374
                                     GLLP  VI+V+G+FHELECVDIKVGK+LP+G LD
Sbjct: 362 GDEEHVSEAYVSEVEDDEMSEVDQDHGLLPKDVIEVKGSFHELECVDIKVGKRLPNGKLD 421

Query: 375 PDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSEYVAHRE 421
           PD PL+ VG+ARCN+TS EL +IKGL  D++++ LGY+ SEYVAH++
Sbjct: 422 PDAPLEYVGRARCNFTSVELNRIKGLPVDRVQDVLGYDVSEYVAHKD 468

>Scas_690.36
          Length = 424

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/423 (62%), Positives = 318/423 (75%), Gaps = 16/423 (3%)

Query: 7   SKSYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRMGHKVIIVSSGGIAVGLRTM 66
           +KS TIVIKLGSSSLVDE T+EPKL+ M+ IVE V  L+R+GHKV+IVSSGGIAVGL  M
Sbjct: 2   TKSNTIVIKLGSSSLVDEVTREPKLSTMTQIVEIVSCLKRLGHKVVIVSSGGIAVGLDAM 61

Query: 67  RMNKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQYKNAQNT 126
            + K+P  L+E+QAIAAIGQG+LIGRW++LF Q++++IAQILLTR DI  WTQ+KNAQNT
Sbjct: 62  NLKKKPSQLSEIQAIAAIGQGKLIGRWEMLFRQYNEQIAQILLTRKDIFGWTQFKNAQNT 121

Query: 127 INELLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALIHADYLFLLTDVDCLYTDNPR 186
           IN LL MGV+PIVNENDTLSV EIKFGDNDTLSAITSAL++ADYLFLLTDVDCLYTDNP+
Sbjct: 122 INALLKMGVVPIVNENDTLSVSEIKFGDNDTLSAITSALVNADYLFLLTDVDCLYTDNPK 181

Query: 187 TNPDAMPILVVPDL-----SKGLPGVNTAXXXXXXXXXXXMETKLVAADLATNAGVHTLI 241
            N DA PIL V D+     SK L    +            M TK+ AADLATN G+HT+I
Sbjct: 182 VNKDAKPILTVFDMHEDSISKVLDTCPSLSDSGSNIGTGGMRTKITAADLATNVGIHTII 241

Query: 242 MKSDTPANIGRIVEYMQTLELDDENKVKQAYNGDLTDLQKREFEKLKALNVPLHTKFIAN 301
           M S TPANI +I+EYM+T  L  +  V    N DL      E + L A +VPLHTKFIAN
Sbjct: 242 MSSQTPANILKIIEYMETSNLKVDGGV--CSNNDL------ELKNLIAHDVPLHTKFIAN 293

Query: 302 DNKH-HLKNREFWILHGLVSKGAVVIDQGAYAALTRKNK--AGLLPAGVIDVQGTFHELE 358
           +N   +LKNREFWILHGLV+KG+++ID+ +Y  L RK +   GLLP  +ID +  FHELE
Sbjct: 294 ENSETYLKNREFWILHGLVTKGSIIIDKNSYKDLLRKKEKCKGLLPISIIDTEDQFHELE 353

Query: 359 CVDIKVGKKLPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSEYVA 418
           CV++KVG++LP+G ++    L+ VG+ARCNYTS E+ KIKGL SDQI E LGY DS YV 
Sbjct: 354 CVELKVGERLPNGKVNRKAGLKVVGRARCNYTSYEINKIKGLKSDQIFETLGYGDSAYVV 413

Query: 419 HRE 421
           H E
Sbjct: 414 HNE 416

>KLLA0F02662g 241804..242565 some similarities with sp|Q8VEH3 Mus
           musculus Hypothetical 21.4 kDa protein, hypothetical
           start
          Length = 253

 Score = 32.0 bits (71), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 43/92 (46%), Gaps = 6/92 (6%)

Query: 48  GHKVIIVSSGGIAVGLRTMRMNKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQI 107
           G + ++ +   + V ++ +++   P H   ++     GQ R    WD  F Q D  +  I
Sbjct: 45  GEEFVVDTIPTLGVNIKDVKL---PNH-TNLKVYDLAGQTRFQKLWDRCFQQVDLLVFMI 100

Query: 108 LLTRNDILDWTQYKNAQNTINELLNMGVIPIV 139
            L+  D+ +W Q KN  + +    N+  +PI+
Sbjct: 101 DLS--DLTNWEQAKNKLHDVIIATNLEHVPIL 130

>AGR021C [4331] [Homologous to ScYGR012W - SH] (753763..754926)
           [1164 bp, 387 aa]
          Length = 387

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 1/55 (1%)

Query: 357 LECVDIKVGKKLPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGY 411
           LEC+   V K  P   +DPD  +    KA C   + E    KG+ +DQ E E  +
Sbjct: 146 LECLGAHVKKVKPASIVDPDQYVNAAKKA-CKLLNEEGHGNKGIFADQFENEANW 199

>ADR106W [1847] [Homologous to ScYDL132W (CDC53) - SH]
           complement(894781..897177) [2397 bp, 798 aa]
          Length = 798

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 130 LLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALI 166
           L  M ++ + NENDTLS  +I+ G N T   I  +++
Sbjct: 622 LFQMAILLMFNENDTLSFEQIQEGTNLTTQHIILSML 658

>ADR126C [1867] [Homologous to ScYKL072W (STB6) - SH; ScYMR053C
           (STB2) - SH] (929234..931309) [2076 bp, 691 aa]
          Length = 691

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (58%), Gaps = 5/51 (9%)

Query: 365 GKKLPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSE 415
           GK LP GTL  DF   T  K       SE T ++G+++ Q E+EL ++DSE
Sbjct: 386 GKGLPQGTLWNDF---TTAKYEYGSRVSE-TTVRGVNTTQ-EDELIHSDSE 431

>YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate
           kinase (L-aspartate 4-P-transferase), catalyzes the
           first step in the common pathway for methionine and
           threonine biosynthesis [1584 bp, 527 aa]
          Length = 527

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 24/39 (61%)

Query: 153 GDNDTLSAITSALIHADYLFLLTDVDCLYTDNPRTNPDA 191
           G  D  +A+ +  ++AD L +  +VD ++T +PR  P+A
Sbjct: 231 GYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPEA 269

>Sklu_1606.1 YGR012W, Contig c1606 981-2153
          Length = 390

 Score = 29.3 bits (64), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 27/55 (49%)

Query: 357 LECVDIKVGKKLPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGY 411
           LE +  +V K  P   +DP+  +    KA      +E  ++KG+ +DQ E E  +
Sbjct: 146 LESLGAEVNKVKPASIVDPNQYVNASKKACDELNQNETAEVKGVFADQFENEANW 200

>YBR275C (RIF1) [454] chr2 complement(751313..757063) Protein
           involved in telomere length regulation and
           transcriptional silencing, interacts with Rap1p [5751
           bp, 1916 aa]
          Length = 1916

 Score = 29.3 bits (64), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 6/60 (10%)

Query: 293 PLHTKFIANDNKHHLKNREFWILHGLVSKGAVVIDQGAYAALTRKNKAGLLPAGVIDVQG 352
           P++  ++   +  HL+N  F +LH L+        + A  AL RK K  + P  VI  +G
Sbjct: 651 PIYEDYVFKYDSIHLQNVLFTVLHLLIG------GKNADVALERKYKKHIHPMSVIASEG 704

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.135    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,434,097
Number of extensions: 577061
Number of successful extensions: 1669
Number of sequences better than 10.0: 17
Number of HSP's gapped: 1681
Number of HSP's successfully gapped: 17
Length of query: 421
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 317
Effective length of database: 12,995,837
Effective search space: 4119680329
Effective search space used: 4119680329
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)