Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR275W (BSC2)2352329491e-131
AEL259W26532623.9
Scas_718.215989598.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR275W
         (232 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR275W (BSC2) [1105] chr4 (1012244..1012951) Protein of unknown...   370   e-131
AEL259W [2247] [Homologous to ScYPR167C (MET16) - SH] complement...    28   3.9  
Scas_718.2                                                             27   8.7  

>YDR275W (BSC2) [1105] chr4 (1012244..1012951) Protein of unknown
           function [708 bp, 235 aa]
          Length = 235

 Score =  370 bits (949), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 198/232 (85%), Positives = 198/232 (85%)

Query: 1   MFFFPKLRKLIGSTVIDHDTKNSSGKEEIMSNSRLALVIINHAFDKVLSLTWHCGILSEI 60
           MFFFPKLRKLIGSTVIDHDTKNSSGKEEIMSNSRLALVIINHAFDKVLSLTWHCGILSEI
Sbjct: 1   MFFFPKLRKLIGSTVIDHDTKNSSGKEEIMSNSRLALVIINHAFDKVLSLTWHCGILSEI 60

Query: 61  RSGLMLMFGIFQLMCSXXXXXXXXXXXXXXXXXXXXYMCRLLDYGCKLFHYNRSSLPVAD 120
           RSGLMLMFGIFQLMCS                    YMCRLLDYGCKLFHYNRSSLPVAD
Sbjct: 61  RSGLMLMFGIFQLMCSLGVIVLLLPIIILDAIDLFLYMCRLLDYGCKLFHYNRSSLPVAD 120

Query: 121 GKEKTSGPISGKEEIVIDEEIINMLNESSESLINHTTAGLEYDISSGSVNKSRRLNSTST 180
           GKEKTSGPISGKEEIVIDEEIINMLNESSESLINHTTAGLEYDISSGSVNKSRRLNSTST
Sbjct: 121 GKEKTSGPISGKEEIVIDEEIINMLNESSESLINHTTAGLEYDISSGSVNKSRRLNSTST 180

Query: 181 VTFVKQNKLVNXXXXXXXXXXXXXXFLSNPNYDKISLIEKSFTSRFEVACEQ 232
           VTFVKQNKLVN              FLSNPNYDKISLIEKSFTSRFEVACEQ
Sbjct: 181 VTFVKQNKLVNERREDAYYEEEDDDFLSNPNYDKISLIEKSFTSRFEVACEQ 232

>AEL259W [2247] [Homologous to ScYPR167C (MET16) - SH]
           complement(151093..151890) [798 bp, 265 aa]
          Length = 265

 Score = 28.5 bits (62), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 18/32 (56%)

Query: 101 LLDYGCKLFHYNRSSLPVADGKEKTSGPISGK 132
           LL+YG K      S+LPV DG  + SG   GK
Sbjct: 213 LLNYGYKSIGDYHSTLPVVDGAGERSGRWKGK 244

>Scas_718.2
          Length = 159

 Score = 27.3 bits (59), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 39/89 (43%), Gaps = 26/89 (29%)

Query: 105 GCKLFHYNRSSLPVADGKEKTS-------------------GPISGKEEIVIDEEIINML 145
           GC  F YN   +P    +++T                     P  GK  ++IDE  + +L
Sbjct: 63  GCHGFQYNLDLIPADQSQQETKKNLDDEFAENNDKSVVYVMPPDGGK--VIIDENSLKIL 120

Query: 146 NESSESLINHTTA--GLEYDISSGSVNKS 172
           N   ++++N+TT   G ++ I  G++  S
Sbjct: 121 N---DTVLNYTTELIGSQFKIEDGNLKSS 146

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,232,438
Number of extensions: 218148
Number of successful extensions: 740
Number of sequences better than 10.0: 8
Number of HSP's gapped: 739
Number of HSP's successfully gapped: 8
Length of query: 232
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 134
Effective length of database: 13,203,545
Effective search space: 1769275030
Effective search space used: 1769275030
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)