Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR273W (DON1)36535917200.0
YOR042W (CUE5)411541732e-13
CAGL0L09933g4081401652e-12
Scas_699.45450561633e-12
KLLA0F15994g427561572e-11
Kwal_55.21587464771431e-09
ACR083C375501421e-09
CAGL0M08580g197691168e-07
Scas_615.8d581521012e-04
CAGL0E02321g70434701.3
Kwal_55.2167134585681.5
CAGL0J09042g36351672.0
Kwal_56.236384922166673.3
Kwal_27.970346057636.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR273W
         (359 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the p...   667   0.0  
YOR042W (CUE5) [4853] chr15 (408424..409659) Protein containing ...    71   2e-13
CAGL0L09933g 1067488..1068714 similar to tr|Q08412 Saccharomyces...    68   2e-12
Scas_699.45                                                            67   3e-12
KLLA0F15994g complement(1484383..1485666) weakly similar to sgd|...    65   2e-11
Kwal_55.21587                                                          60   1e-09
ACR083C [1130] [Homologous to ScYOR042W - SH; ScYDR273W (DON1) -...    59   1e-09
CAGL0M08580g complement(855443..856036) weakly similar to tr|Q08...    49   8e-07
Scas_615.8d                                                            44   2e-04
CAGL0E02321g 222466..224580 some similarities with sp|Q08108 Sac...    32   1.3  
Kwal_55.21671                                                          31   1.5  
CAGL0J09042g 890705..891796 similar to tr|Q12063 Saccharomyces c...    30   2.0  
Kwal_56.23638                                                          30   3.3  
Kwal_27.9703                                                           29   6.7  

>YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the
           prospore membrane [1098 bp, 365 aa]
          Length = 365

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/359 (93%), Positives = 334/359 (93%)

Query: 1   MGKKNRKGKENNAAKTSFLKVENIKNTNSGLELPSQDYTNVEEKESSPKTDFPLITKEHV 60
           MGKKNRKGKENNAAKTSFLKVENIKNTNSGLELPSQDYTNVEEKESSPKTDFPLITKEHV
Sbjct: 1   MGKKNRKGKENNAAKTSFLKVENIKNTNSGLELPSQDYTNVEEKESSPKTDFPLITKEHV 60

Query: 61  NTKTDSNILDYPTIGDLVSSVEKLCVLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSL 120
           NTKTDSNILDYPTIGDLVSSVEKLCVLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSL
Sbjct: 61  NTKTDSNILDYPTIGDLVSSVEKLCVLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSL 120

Query: 121 LYYSSPEENTDFALPMKPISVEDYSKINVSEILQREIFDDIEDEFSGQGINGSMVISKIE 180
           LYYSSPEENTDFALPMKPISVEDYSKINVSEILQREIFDDIEDEFSGQGINGSMVISKIE
Sbjct: 121 LYYSSPEENTDFALPMKPISVEDYSKINVSEILQREIFDDIEDEFSGQGINGSMVISKIE 180

Query: 181 SELSSLAEHIGNISTPGSNREVAESTRNVAVAEGHNTILSNEDSILXXXXXXXXXXXXXX 240
           SELSSLAEHIGNISTPGSNREVAESTRNVAVAEGHNTILSNEDSIL              
Sbjct: 181 SELSSLAEHIGNISTPGSNREVAESTRNVAVAEGHNTILSNEDSILKGKEKGKEEEKEKG 240

Query: 241 XXXXVNSLKGAAVKVVAKSLKNNRIPVTVKRNEPSNNLFDVLNCDXXXXXXXQDVETNTS 300
               VNSLKGAAVKVVAKSLKNNRIPVTVKRNEPSNNLFDVLNCD       QDVETNTS
Sbjct: 241 EEKGVNSLKGAAVKVVAKSLKNNRIPVTVKRNEPSNNLFDVLNCDESEEEEEQDVETNTS 300

Query: 301 NQERKNQGGNTEVPEAQRDSADRLPAKDDGGYKSAFGTDSCGLFAADAKDEKKQVHPSR 359
           NQERKNQGGNTEVPEAQRDSADRLPAKDDGGYKSAFGTDSCGLFAADAKDEKKQVHPSR
Sbjct: 301 NQERKNQGGNTEVPEAQRDSADRLPAKDDGGYKSAFGTDSCGLFAADAKDEKKQVHPSR 359

>YOR042W (CUE5) [4853] chr15 (408424..409659) Protein containing a
           CUE domain, has low similarity to uncharacterized C.
           albicans Orf6.1738p [1236 bp, 411 aa]
          Length = 411

 Score = 71.2 bits (173), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 41/54 (75%)

Query: 86  VLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSLLYYSSPEENTDFALPMKPI 139
           +L+ELK AFP +++  IKA++IASQGVL PAFN+LL+ S PE   D  LP +P+
Sbjct: 101 ILQELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSDPESGKDIELPTQPV 154

>CAGL0L09933g 1067488..1068714 similar to tr|Q08412 Saccharomyces
           cerevisiae YOR042w, hypothetical start
          Length = 408

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 76/140 (54%), Gaps = 7/140 (5%)

Query: 1   MGKKNRKGKENNAAKTSFLKVENIKNTNSGLELPSQDYTNVEEKESSPKTDFPLITKEHV 60
           MGKK++K ++  A     L+ E  ++ +S  + P ++   V++ +   K +     KE V
Sbjct: 1   MGKKSQKAEK--AEDKPVLEKETGEDLDSKQQEPIEEPVEVKQDKDEAKEEDLEEVKEDV 58

Query: 61  NTKTDSNILDYPTIGDLVSSVEKLCVLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSL 120
                 +I +  T       VE   +L +LK AFP +++  +KA++IASQG L+PAFN+L
Sbjct: 59  GDSAKKDITEDTT----TKKVENPLLL-QLKEAFPNIEEQYVKAVIIASQGALDPAFNAL 113

Query: 121 LYYSSPEENTDFALPMKPIS 140
           L+ S PE   D  LP +P+ 
Sbjct: 114 LFLSDPESGKDIELPREPVQ 133

>Scas_699.45
          Length = 450

 Score = 67.4 bits (163), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%)

Query: 86  VLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSLLYYSSPEENTDFALPMKPISV 141
           +LK+LK AFP +++  +K +LIASQG L+PAF +LL+ S P  + D  LP KPI+ 
Sbjct: 114 ILKQLKEAFPNIEEKYVKTVLIASQGALDPAFEALLFLSDPNSSKDIELPTKPIAA 169

>KLLA0F15994g complement(1484383..1485666) weakly similar to
           sgd|S0005568 Saccharomyces cerevisiae YOR042w, start by
           similarity
          Length = 427

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 41/56 (73%)

Query: 86  VLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSLLYYSSPEENTDFALPMKPISV 141
           +LK+LK AFP +++  +KA+LIASQG L+PAFN+LL+ S P+   +  LP +P+  
Sbjct: 94  MLKQLKEAFPNIEEKYVKAVLIASQGQLDPAFNALLFISDPDFEKEAPLPTRPVQA 149

>Kwal_55.21587
          Length = 464

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 44/77 (57%), Gaps = 4/77 (5%)

Query: 86  VLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSLLYYSSP----EENTDFALPMKPISV 141
           +L +L  AFP +D   +KA+LIASQG L+PAFN+LL+ S P    E     A+P    S 
Sbjct: 116 ILAQLTEAFPGIDAKYVKAVLIASQGALDPAFNALLFLSDPSFEAEATVPTAVPQSSQSG 175

Query: 142 EDYSKINVSEILQREIF 158
              S   VS++ Q EI 
Sbjct: 176 NSRSPTAVSQLQQDEIL 192

>ACR083C [1130] [Homologous to ScYOR042W - SH; ScYDR273W (DON1) -
           SH] (505794..506921) [1128 bp, 375 aa]
          Length = 375

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 38/50 (76%)

Query: 85  CVLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSLLYYSSPEENTDFAL 134
            +L ELK AFP V++ ++KA++IASQG+L+PAF++LL+ S P    + AL
Sbjct: 101 SILSELKAAFPNVEEKIVKAVIIASQGILDPAFSALLFLSDPTFEEEAAL 150

>CAGL0M08580g complement(855443..856036) weakly similar to tr|Q08412
           Saccharomyces cerevisiae YOR042w, hypothetical start
          Length = 197

 Score = 49.3 bits (116), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 42/69 (60%), Gaps = 2/69 (2%)

Query: 69  LDYPTIGDLVSSVEKLCVLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSLLYYSSPEE 128
           L +  I  L + VE+    ++L  AFP VD  +I+AIL+A++G L PAFN+LL  +   E
Sbjct: 13  LVFADIKQLNTEVEQNVHYEKLVKAFPTVDKLIIRAILLAARGDLAPAFNALLSLTG--E 70

Query: 129 NTDFALPMK 137
           +    LPM+
Sbjct: 71  DIQLGLPMR 79

>Scas_615.8d
          Length = 581

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 34/52 (65%)

Query: 73  TIGDLVSSVEKLCVLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSLLYYS 124
           T+ +L   ++    + EL  AFP VD  +IK++L AS+G + PAF++LL+ +
Sbjct: 270 TLAELSEILDTHSNIPELAKAFPSVDINVIKSLLFASEGEVLPAFHALLFLT 321

>CAGL0E02321g 222466..224580 some similarities with sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3 phospholipase B,
           hypothetical start
          Length = 704

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%)

Query: 67  NILDYPTIGDLVSSVEKLCVLKELKIAFPEVDDT 100
           N L +P    LV + E+  VL+  KIAFP + DT
Sbjct: 445 NKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDT 478

>Kwal_55.21671
          Length = 345

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 8/85 (9%)

Query: 60  VNTKTDSNILDYP---TIGDLVSSVEKLCVLKELKIAFPEVDDTLIKAILIASQGVLEPA 116
           ++ K  S IL +P   T  DL+ SV+K  V         E+D  LI   L  S   LE  
Sbjct: 1   MSIKKKSLILIHPAVTTTPDLLESVKKDSVFA----GSEELDQFLINK-LNDSSVTLESE 55

Query: 117 FNSLLYYSSPEENTDFALPMKPISV 141
              ++YY +PE++T+   P K I V
Sbjct: 56  VYDVIYYVTPEKDTEIKFPTKLIGV 80

>CAGL0J09042g 890705..891796 similar to tr|Q12063 Saccharomyces
           cerevisiae YDL193w, hypothetical start
          Length = 363

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 56  TKEHVNTKTDSNILDYPTIGDLVSSVEKLCVLKELKIAFPEVDDTLIKAIL 106
           ++EH++    S+I   PT+ ++V S+ +LC  KE K++  E+   L+ ++L
Sbjct: 252 SREHISITVLSHIDGRPTVVNVVKSIIQLC--KESKMSVGEISMELVNSVL 300

>Kwal_56.23638
          Length = 4922

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 70/166 (42%), Gaps = 40/166 (24%)

Query: 49   KTDFPLITKEHVNTKTDS-NILDYPTIGDLVSSVE--KLCVLKELKIAFPEVDDTLIKAI 105
            K +FP +  EH+ T  D  NIL     G LV +++  +  +L E+ +A    DD++++ +
Sbjct: 1452 KANFPSVAVEHIETLKDKLNILFEWCDGPLVQALQDGEYFLLDEISLA----DDSVLERL 1507

Query: 106  LIASQGVLEPAFNSLLY-------YSSPEENTDFALPMKPISVEDYSKINVSEILQ---- 154
                  VLEP  + LL        +    E   F   M P    DY K  +S  L+    
Sbjct: 1508 ----NSVLEPERSLLLAEKGGPDSFIQASEGFQFFATMNPGG--DYGKKELSPALRNRFT 1561

Query: 155  ------REIFDDIEDEFSGQGINGSMVISKIESELSSLAEHIGNIS 194
                   E FDD++           +V SK+  ELS+L   I   S
Sbjct: 1562 EIWVPSMEDFDDVQ----------MIVSSKLMPELSALTSPIVEFS 1597

>Kwal_27.9703
          Length = 460

 Score = 28.9 bits (63), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%)

Query: 69  LDYPTIGDLVSSVEKLCVLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSLLYYSS 125
           LD P +   + + E   VL+EL   FP++D  L++ +  A +  +    + LL  SS
Sbjct: 404 LDIPRLAQEIEAKENARVLEELHAMFPDMDQELLRDVSAAKKYRIGACVDVLLTLSS 460

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.307    0.127    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,688,886
Number of extensions: 515739
Number of successful extensions: 1553
Number of sequences better than 10.0: 37
Number of HSP's gapped: 1550
Number of HSP's successfully gapped: 37
Length of query: 359
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 256
Effective length of database: 13,030,455
Effective search space: 3335796480
Effective search space used: 3335796480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 62 (28.5 bits)