Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR272W (GLO2)27427014600.0
CAGL0I00924g2742719841e-135
Scas_699.442822719511e-130
Kwal_55.215822842719431e-129
Sklu_1159.12822719391e-128
YOR040W (GLO4)2852719111e-124
KLLA0F16016g2832738541e-115
ACR084C2932728491e-115
KLLA0F23529g609101700.81
Kwal_23.386734768661.8
KLLA0C02871g26335624.8
YGL207W (SPT16)103599619.3
YDR496C (PUF6)65694619.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR272W
         (270 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR272W (GLO2) [1103] chr4 (1009002..1009826) Glyoxalase-II [825...   566   0.0  
CAGL0I00924g complement(75399..76223) similar to sp|Q05584 Sacch...   383   e-135
Scas_699.44                                                           370   e-130
Kwal_55.21582                                                         367   e-129
Sklu_1159.1 YOR040W, Contig c1159 273-1121                            366   e-128
YOR040W (GLO4) [4852] chr15 (407063..407920) Glyoxalase-II [858 ...   355   e-124
KLLA0F16016g complement(1486406..1487257) similar to sp|Q12320 S...   333   e-115
ACR084C [1131] [Homologous to ScYOR040W (GLO4) - SH; ScYDR272W (...   331   e-115
KLLA0F23529g 2200946..2202775 highly similar to sp|P06208 Saccha...    32   0.81 
Kwal_23.3867                                                           30   1.8  
KLLA0C02871g complement(257493..258284) similar to sp|P36528 Sac...    28   4.8  
YGL207W (SPT16) [1789] chr7 (98971..102078) Essential nuclear pr...    28   9.3  
YDR496C (PUF6) [1311] chr4 complement(1441421..1443391) Protein ...    28   9.6  

>YDR272W (GLO2) [1103] chr4 (1009002..1009826) Glyoxalase-II [825
           bp, 274 aa]
          Length = 274

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/270 (100%), Positives = 270/270 (100%)

Query: 1   MQVKSIKMRWESGGVNYCYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHH 60
           MQVKSIKMRWESGGVNYCYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHH
Sbjct: 1   MQVKSIKMRWESGGVNYCYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHH 60

Query: 61  HYDHADGNADILKYLKEKNPTSKVEVIGGSKDCPKVTIIPENLKKLHLGDLEITCIRTPC 120
           HYDHADGNADILKYLKEKNPTSKVEVIGGSKDCPKVTIIPENLKKLHLGDLEITCIRTPC
Sbjct: 61  HYDHADGNADILKYLKEKNPTSKVEVIGGSKDCPKVTIIPENLKKLHLGDLEITCIRTPC 120

Query: 121 HTRDSICYYVKDPTTDERCIFTGDTLFTAGCGRFFEGTGEEMDIALNNSILETVGRQNWS 180
           HTRDSICYYVKDPTTDERCIFTGDTLFTAGCGRFFEGTGEEMDIALNNSILETVGRQNWS
Sbjct: 121 HTRDSICYYVKDPTTDERCIFTGDTLFTAGCGRFFEGTGEEMDIALNNSILETVGRQNWS 180

Query: 181 KTRVYPGHEYTSDNVKFVRKIYPQVGENKALDELEQFCSKHEVTAGRFTLKDEVEFNPFM 240
           KTRVYPGHEYTSDNVKFVRKIYPQVGENKALDELEQFCSKHEVTAGRFTLKDEVEFNPFM
Sbjct: 181 KTRVYPGHEYTSDNVKFVRKIYPQVGENKALDELEQFCSKHEVTAGRFTLKDEVEFNPFM 240

Query: 241 RLEDPKVQKAAGDTNNSWDRAQIMDKLRAM 270
           RLEDPKVQKAAGDTNNSWDRAQIMDKLRAM
Sbjct: 241 RLEDPKVQKAAGDTNNSWDRAQIMDKLRAM 270

>CAGL0I00924g complement(75399..76223) similar to sp|Q05584
           Saccharomyces cerevisiae YDR272w GLO2 glyoxalase II,
           start by similarity
          Length = 274

 Score =  383 bits (984), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 178/271 (65%), Positives = 211/271 (77%), Gaps = 2/271 (0%)

Query: 1   MQVKSIKMRWESGGVNYCYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHH 60
           M VK IKMRW +GGVNY YL+S+     SWLIDPAEP EV PEL+E E+ SV A+VNTHH
Sbjct: 1   MHVKPIKMRWHTGGVNYSYLVSNQDQTTSWLIDPAEPHEVWPELSESERESVVALVNTHH 60

Query: 61  HYDHADGNADILKYLKEKNPTSKVEVIGGSKDCPKVTIIPENLKKLHLGDLEITCIRTPC 120
           HYDHA GN  +LK  KE      ++VIGGS++C  VT+IP + +KL +G+L++TCIRTPC
Sbjct: 61  HYDHAGGNTSLLKQFKE-TVGKPLQVIGGSEECDNVTLIPTHSQKLKIGNLDVTCIRTPC 119

Query: 121 HTRDSICYYVKDPTTDERCIFTGDTLFTAGCGRFFEGTGEEMDIALNNSILETVGRQNWS 180
           HT+DS+CYY++DP TDERCIFTGDTLFTAGCGRFFEGTGEEMD ALN  ILE VG+ NWS
Sbjct: 120 HTQDSVCYYIRDPETDERCIFTGDTLFTAGCGRFFEGTGEEMDAALNKYILEGVGKNNWS 179

Query: 181 KTRVYPGHEYTSDNVKFVR-KIYPQVGENKALDELEQFCSKHEVTAGRFTLKDEVEFNPF 239
            T VYPGHEYT  NVKFVR KIYP    N   DELE+FC++HEVT G+FTL DE+ FNPF
Sbjct: 180 STLVYPGHEYTKSNVKFVRSKIYPTTNVNSRFDELERFCNEHEVTTGKFTLADELLFNPF 239

Query: 240 MRLEDPKVQKAAGDTNNSWDRAQIMDKLRAM 270
           M+L+DP V+ A GD+ N W  A +MDKLR M
Sbjct: 240 MKLDDPIVRAAVGDSENQWTSAAVMDKLRKM 270

>Scas_699.44
          Length = 282

 Score =  370 bits (951), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 167/271 (61%), Positives = 210/271 (77%), Gaps = 1/271 (0%)

Query: 1   MQVKSIKMRWESGGVNYCYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHH 60
           M VK IKMRW +GGVNY YLLS    + SWLIDPAE  EV+P L   E++++ AIVNTHH
Sbjct: 8   MYVKPIKMRWSTGGVNYSYLLSSQDKEHSWLIDPAESDEVIPHLDPQERLNIRAIVNTHH 67

Query: 61  HYDHADGNADILKYLKEKNPTSKVEVIGGSKDCPKVTIIPENLKKLHLGDLEITCIRTPC 120
           HYDH+DGN  ++  LK+      V++I GSK  P V+ IP +L+K  LG+LE+ C+RTPC
Sbjct: 68  HYDHSDGNISMINELKQDGNQHIVKIIAGSKSSPGVSEIPTHLQKYQLGNLEVVCLRTPC 127

Query: 121 HTRDSICYYVKDPTTDERCIFTGDTLFTAGCGRFFEGTGEEMDIALNNSILETVGRQNWS 180
           HT+DSICYYVKD  T+E+C+FTGDTLFT GCGRFFEG G+EMD ALN +ILE VG  NW+
Sbjct: 128 HTQDSICYYVKDSDTNEQCLFTGDTLFTGGCGRFFEGNGQEMDQALNKTILEGVGEPNWN 187

Query: 181 KTRVYPGHEYTSDNVKFVRK-IYPQVGENKALDELEQFCSKHEVTAGRFTLKDEVEFNPF 239
            TRVYPGHEYT DNVKF+RK +Y ++G+N+ALD+LE+FC  HEVT G FTL DE++FNPF
Sbjct: 188 MTRVYPGHEYTKDNVKFIRKFVYQELGDNEALDKLEKFCKSHEVTTGEFTLDDELKFNPF 247

Query: 240 MRLEDPKVQKAAGDTNNSWDRAQIMDKLRAM 270
           MRL+DP V+KA GD    W+R+++M+ LR M
Sbjct: 248 MRLDDPIVRKAVGDAEEKWERSKVMETLRKM 278

>Kwal_55.21582
          Length = 284

 Score =  367 bits (943), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 172/271 (63%), Positives = 207/271 (76%), Gaps = 2/271 (0%)

Query: 1   MQVKSIKMRWESGGVNYCYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHH 60
           M VK+IKMRW +GGVNYCYLLS     KSWLIDPAEP EV+  L  +E  +V+A+VNTHH
Sbjct: 11  MHVKAIKMRWLTGGVNYCYLLSTQDKTKSWLIDPAEPLEVMTALKAEEANTVQAVVNTHH 70

Query: 61  HYDHADGNADILKYLKEKNPTSKVEVIGGSKDCPKVTIIPENLKKLHLGDLEITCIRTPC 120
           HYDH+ GN+ I+  L+ K   S ++VI GS   P  T IP+NL++  LGDL+I CIRTPC
Sbjct: 71  HYDHSGGNSAIVGELR-KMGVSHLDVICGSNTSPGATKIPKNLQEYSLGDLKIKCIRTPC 129

Query: 121 HTRDSICYYVKDPTTDERCIFTGDTLFTAGCGRFFEGTGEEMDIALNNSILETVGRQNWS 180
           HT+DS+CYYV DP T E+CIFTGDTLFTAGCGRFFEGTGEEMD+ALN SIL+ VG  NW 
Sbjct: 130 HTQDSVCYYVSDPNTGEKCIFTGDTLFTAGCGRFFEGTGEEMDVALNRSILDGVGEPNWD 189

Query: 181 KTRVYPGHEYTSDNVKFVRK-IYPQVGENKALDELEQFCSKHEVTAGRFTLKDEVEFNPF 239
            T+VYPGHEYT  NVKFVRK +Y   GEN +LD LE  C+KH+VT G FT+ DE+ +NPF
Sbjct: 190 ITKVYPGHEYTKSNVKFVRKAVYKTPGENSSLDRLEHVCNKHDVTTGMFTIHDELAYNPF 249

Query: 240 MRLEDPKVQKAAGDTNNSWDRAQIMDKLRAM 270
           MRL+DP V+ A  D+N S  RAQ+MD+LR M
Sbjct: 250 MRLDDPTVRDAIKDSNGSLSRAQVMDQLRKM 280

>Sklu_1159.1 YOR040W, Contig c1159 273-1121
          Length = 282

 Score =  366 bits (939), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 175/271 (64%), Positives = 208/271 (76%), Gaps = 2/271 (0%)

Query: 1   MQVKSIKMRWESGGVNYCYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHH 60
           M VK+IKMRW +GGVNY YLLS     KSWLIDPAEP EVLP+LT+ E  S+EA+VNTHH
Sbjct: 9   MHVKAIKMRWLTGGVNYSYLLSTQDKTKSWLIDPAEPLEVLPKLTDKEIGSIEAVVNTHH 68

Query: 61  HYDHADGNADILKYLKEKNPTSKVEVIGGSKDCPKVTIIPENLKKLHLGDLEITCIRTPC 120
           HYDH+ GN  ++  LK K   + V VI GS   P  T +P++L+K  LGDLE+ CIRTPC
Sbjct: 69  HYDHSGGNIPVIAALK-KAGQNAVSVICGSHTSPGATEVPQDLQKYKLGDLEVLCIRTPC 127

Query: 121 HTRDSICYYVKDPTTDERCIFTGDTLFTAGCGRFFEGTGEEMDIALNNSILETVGRQNWS 180
           HT+DS+CY+VKD  T ERCIFTGDTLFTAGCGRFFEGTGEEMD ALN ++LE  G +NWS
Sbjct: 128 HTQDSVCYFVKDFDTGERCIFTGDTLFTAGCGRFFEGTGEEMDRALNRNLLEHTGEENWS 187

Query: 181 KTRVYPGHEYTSDNVKFVR-KIYPQVGENKALDELEQFCSKHEVTAGRFTLKDEVEFNPF 239
            T+VYPGHEYT  NV+FVR  IY   GENKA D+LE FC K+EVT G FTLKDE++FNPF
Sbjct: 188 TTKVYPGHEYTKSNVEFVRAAIYKTPGENKAFDKLEHFCDKNEVTTGCFTLKDELDFNPF 247

Query: 240 MRLEDPKVQKAAGDTNNSWDRAQIMDKLRAM 270
           MRL  P V+K+ GD   +W +A++MDKLR M
Sbjct: 248 MRLNCPMVRKSVGDAQGAWPKARVMDKLRQM 278

>YOR040W (GLO4) [4852] chr15 (407063..407920) Glyoxalase-II [858 bp,
           285 aa]
          Length = 285

 Score =  355 bits (911), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 159/271 (58%), Positives = 204/271 (75%), Gaps = 1/271 (0%)

Query: 1   MQVKSIKMRWESGGVNYCYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHH 60
           M VK IKMRW +GGVNY YLLS    + SWLIDPAEP EV P+L+ +EK S++AIVNTHH
Sbjct: 11  MHVKPIKMRWLTGGVNYSYLLSTEDRRNSWLIDPAEPLEVSPKLSAEEKKSIDAIVNTHH 70

Query: 61  HYDHADGNADILKYLKEKNPTSKVEVIGGSKDCPKVTIIPENLKKLHLGDLEITCIRTPC 120
           HYDH+ GN  +   L ++N    +++IGGSK  P VT +P+NL++ HLG+L +TCIRTPC
Sbjct: 71  HYDHSGGNLALYSILCQENSGHDIKIIGGSKSSPGVTEVPDNLQQYHLGNLRVTCIRTPC 130

Query: 121 HTRDSICYYVKDPTTDERCIFTGDTLFTAGCGRFFEGTGEEMDIALNNSILETVGRQNWS 180
           HT+DSICYY+KD  T E+CIFTGDTLF AGCGRFFEGTG +MD+ALN  +L  VG  NW+
Sbjct: 131 HTKDSICYYIKDLETGEQCIFTGDTLFIAGCGRFFEGTGRDMDMALNQIMLRAVGETNWN 190

Query: 181 KTRVYPGHEYTSDNVKFVR-KIYPQVGENKALDELEQFCSKHEVTAGRFTLKDEVEFNPF 239
           K ++YPGHEYT  NV F+R KIY  +G+NK  D LEQ+C  +E T G FTL+DE+ +NPF
Sbjct: 191 KVKIYPGHEYTKGNVSFIRAKIYSDIGQNKEFDALEQYCKSNECTTGHFTLRDELGYNPF 250

Query: 240 MRLEDPKVQKAAGDTNNSWDRAQIMDKLRAM 270
           MRL+D  V+ A GDT  ++ R+ +M +LR +
Sbjct: 251 MRLDDRAVRLAVGDTAGTYPRSVVMQELRKL 281

>KLLA0F16016g complement(1486406..1487257) similar to sp|Q12320
           Saccharomyces cerevisiae YOR040w GLO4 glyoxalase II
           (hydroxyacylglutathione hydrolase), start by similarity
          Length = 283

 Score =  333 bits (854), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 162/273 (59%), Positives = 193/273 (70%), Gaps = 5/273 (1%)

Query: 1   MQVKSIKMRWESGGVNYCYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHH 60
           M VK+IKMRW +GGVNY YLLS    KKSWLIDPAE  EV+ +L  DE  S+EA+VNTHH
Sbjct: 9   MHVKAIKMRWLTGGVNYSYLLSTQDKKKSWLIDPAETLEVMNDLGSDEAKSIEALVNTHH 68

Query: 61  HYDHADGNADILKYLKEK-NPTSKVEVIGGSKDCPKVTIIPENLKKLHLGDLEITCIRTP 119
           HYDHA GN   L  L EK N  S+V  I GS+  P    IP+NL +  LG+L+I CIRTP
Sbjct: 69  HYDHAGGNVSTLAALNEKGNNISRV--IAGSQRSPIANDIPDNLHEYTLGNLKILCIRTP 126

Query: 120 CHTRDSICYYVKDPTTDERCIFTGDTLFTAGCGRFFEGTGEEMDIALNNSILETVG-RQN 178
           CHT+DS CYYV+DP T E+ IFTGDTLFT GCGRFFEGT EEMD ALN  +L   G   N
Sbjct: 127 CHTQDSTCYYVRDPETKEQAIFTGDTLFTGGCGRFFEGTAEEMDDALNFRLLGNTGDTSN 186

Query: 179 WSKTRVYPGHEYTSDNVKFVRK-IYPQVGENKALDELEQFCSKHEVTAGRFTLKDEVEFN 237
           W   +VYPGHEYT+ NV F+R  IY +  +N   ++LE F  +HEVT G FT+ DE+ FN
Sbjct: 187 WKNVKVYPGHEYTAGNVSFIRNYIYLKKSDNDHFNKLESFTKEHEVTTGHFTIADELSFN 246

Query: 238 PFMRLEDPKVQKAAGDTNNSWDRAQIMDKLRAM 270
           PFMRL+DP V++  GD+   W RAQ+MDKLR M
Sbjct: 247 PFMRLDDPIVRRQVGDSQGCWTRAQVMDKLRNM 279

>ACR084C [1131] [Homologous to ScYOR040W (GLO4) - SH; ScYDR272W
           (GLO2) - SH] (507338..508219) [882 bp, 293 aa]
          Length = 293

 Score =  331 bits (849), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 160/272 (58%), Positives = 197/272 (72%), Gaps = 6/272 (2%)

Query: 1   MQVKSIKMRWESGGVNYCYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHH 60
           M VK+IKMRW +GGVNY YL+S    K SWLIDPAE  EVLP L+ DEK S+ AIVNTHH
Sbjct: 22  MHVKAIKMRWLTGGVNYSYLVSTQDKKASWLIDPAEALEVLPALSHDEKQSIRAIVNTHH 81

Query: 61  HYDHADGNADILKYLKEKNPTSKVEVIGGSKDCPKVTIIPENLKKLHLGD-LEITCIRTP 119
           HYDHA GN  I   LK +     V VI GS   P  T IPE+L+K  LGD +E+ CIRTP
Sbjct: 82  HYDHAGGNLAIRAALKREG--VAVPVIAGSTTSPVSTDIPEHLQKYTLGDSVEVLCIRTP 139

Query: 120 CHTRDSICYYVKDPTTDERCIFTGDTLFTAGCGRFFEGTGEEMDIALNNSILETVGRQNW 179
           CHT+DSICY+++D  T ++ +FTGDTLFTAGCGRFFEGT EEMD ALN+ +LE V  Q+ 
Sbjct: 140 CHTQDSICYFMRDTKTGQQALFTGDTLFTAGCGRFFEGTAEEMDAALNSRLLEHV--QDH 197

Query: 180 SKTRVYPGHEYTSDNVKFVRK-IYPQVGENKALDELEQFCSKHEVTAGRFTLKDEVEFNP 238
           + T+VYPGHEYT  NV F+R  IY   G+N A D LE F + + VT G+FTL+DE E+NP
Sbjct: 198 AATKVYPGHEYTKGNVHFIRSAIYMSEGDNPAFDRLESFANANAVTTGQFTLQDETEYNP 257

Query: 239 FMRLEDPKVQKAAGDTNNSWDRAQIMDKLRAM 270
           FMRL+DP +++  GD + +W RA +M KLR+M
Sbjct: 258 FMRLDDPTIRRRVGDLHRTWARADVMAKLRSM 289

>KLLA0F23529g 2200946..2202775 highly similar to sp|P06208
           Saccharomyces cerevisiae YNL104c LEU4
           2-isopropylmalalate synthase, start by similarity
          Length = 609

 Score = 31.6 bits (70), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 41/101 (40%), Gaps = 14/101 (13%)

Query: 107 HLGDLEITCIRTPCH------TRDSICYYVKDPTTDERCIF-----TGDT-LFTAGCGRF 154
           H+ + E  CI T  H         S    +      E C+F     TG+  L T     +
Sbjct: 260 HISEREKVCISTHAHNDRGCGVAASELGILAGADRVEGCLFGNGERTGNVDLVTVALNMY 319

Query: 155 FEGTGEEMDIALNNSILETVGRQNWSKTRVYPGHEYTSDNV 195
            +G   E+D++  NS++E V R N  K  V P   Y  D V
Sbjct: 320 TQGVSPELDLSDINSVIEVVERCN--KIAVSPRAPYGGDLV 358

>Kwal_23.3867
          Length = 347

 Score = 30.0 bits (66), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 4/68 (5%)

Query: 174 VGRQNWSKTRVYPGHEYTSDNVKFVR--KIYPQVGENKALDELEQFCSKHEVTAGRFTLK 231
           +GR+ W K  V    E T   +K V   K+Y  V  N  +D +E+ CS H+      T  
Sbjct: 251 LGRKTWKK--VVATLENTRLLIKSVSSAKVYKTVDLNDVVDSVEEVCSHHDTGFAVITYD 308

Query: 232 DEVEFNPF 239
           + ++F   
Sbjct: 309 ERLKFRAL 316

>KLLA0C02871g complement(257493..258284) similar to sp|P36528
           Saccharomyces cerevisiae YNL252c MRPL17 ribosomal
           protein of the large subunit (YmL30), mitochondrial
           singleton, start by similarity
          Length = 263

 Score = 28.5 bits (62), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 18/35 (51%)

Query: 216 QFCSKHEVTAGRFTLKDEVEFNPFMRLEDPKVQKA 250
           QF  K  + AG F LKDE     F  L   +++KA
Sbjct: 213 QFLIKSHIIAGEFKLKDEKSIKEFAWLTKDEIKKA 247

>YGL207W (SPT16) [1789] chr7 (98971..102078) Essential nuclear
           protein required for gene activation and also
           chromatin-mediated repression, interacts with Pob3p to
           form the CP complex [3108 bp, 1035 aa]
          Length = 1035

 Score = 28.1 bits (61), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 41/99 (41%), Gaps = 11/99 (11%)

Query: 16  NYCYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHHHYDHADGNADILKYL 75
           NY   L+D+       +D  EPP  L   T+  K  +    N     ++   ++   K  
Sbjct: 411 NYALQLADTVQIP---LDETEPPRFLTNYTK-AKSQISFYFNNEEEDNNKKKSSPATKVP 466

Query: 76  KEKNPTSKV-------EVIGGSKDCPKVTIIPENLKKLH 107
            + +  SK+       E  GG++D  K  I  EN KKLH
Sbjct: 467 SKPDRNSKILRTKLRGEARGGAEDAQKEQIRKENQKKLH 505

>YDR496C (PUF6) [1311] chr4 complement(1441421..1443391) Protein
           containing four Pumilio-family (Puf) RNA binding
           domains, has high similarity to uncharacterized C.
           albicans Orf6.4654p [1971 bp, 656 aa]
          Length = 656

 Score = 28.1 bits (61), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 175 GRQNWSKTRVYPGHEYTSDNVKFVRKIYPQVGENKALDE-LEQFCSKHEVTAGRFTLKDE 233
           G+ N  + +V P        V F  K+Y ++ ++  L E +    S   + A   TLKD+
Sbjct: 563 GKWNNKEKKVIPLKNVQGLGVPFAEKLYDEIIDSSNLLEWINNADSSFTIVALYETLKDQ 622

Query: 234 VEFNPFMRLEDPKVQKAAGDTNNSWDRAQIMDKL 267
            E  PF  L+D +  ++   T+ S   +Q++ KL
Sbjct: 623 KEGKPF--LKDLRGVQSKITTDESNKGSQLLAKL 654

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,182,775
Number of extensions: 466935
Number of successful extensions: 1253
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1237
Number of HSP's successfully gapped: 22
Length of query: 270
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 170
Effective length of database: 13,134,309
Effective search space: 2232832530
Effective search space used: 2232832530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)