Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR270W (CCC2)100498750070.0
CAGL0M08602g101296823680.0
Scas_615.994292422900.0
KLLA0F07447g97596722890.0
Kwal_55.2157598998621730.0
ACR086C81079013721e-176
KLLA0D04092g11529437642e-85
YBR295W (PCA1)12166887645e-85
AGL041C12339887566e-84
Kwal_47.175228995422601e-22
AGL085C9095412601e-22
Scas_710.419045952547e-22
YGL008C (PMA1)9185702521e-21
YPL036W (PMA2)9475962483e-21
Scas_688.19135412422e-20
KLLA0A09031g8995392385e-20
CAGL0A00495g9025702271e-18
Scas_707.48*7416372101e-16
CAGL0J01870g9462202039e-16
AEL301W9575971949e-15
Kwal_14.14989391821912e-14
KLLA0A03157g9381571714e-12
YGL167C (PMR1)9501501715e-12
CAGL0I04312g9511511681e-11
YGL006W (PMC1)11731811681e-11
AFL011W12421861681e-11
CAGL0A00517g11221771653e-11
Kwal_47.1754712402531619e-11
KLLA0A08910g12801771591e-10
KLLA0E14630g10821991502e-09
KLLA0F20658g10821911465e-09
CAGL0K12034g10871911421e-08
Kwal_23.316011001901393e-08
YDR039C (ENA2)10911911393e-08
YDR038C (ENA5)10911911393e-08
AGL097C10961901367e-08
YDR040C (ENA1)10911911351e-07
Scas_297.18001491286e-07
Scas_569.0d468831053e-04
AFR567W1449128980.002
CAGL0L01419g121439960.004
KLLA0E22352g120682900.017
YEL031W (SPF1)121567880.031
KLLA0B08217g1439108880.033
Scas_665.30143972860.058
Scas_583.14*87558820.17
YOR291W147272820.18
Kwal_26.92071469114810.19
CAGL0M11308g145250810.19
KLLA0A04015g1343216810.23
YMR162C (DNF3)165641810.25
AFR354C121053800.26
YER166W (DNF1)1571115790.36
KLLA0C08393g114852760.84
YDR440W (DOT1)58293750.90
CAGL0L00715g114463751.0
Sklu_2193.1114352741.4
YBL022C (PIM1)113330731.7
CAGL0G06270g1328141731.8
Kwal_23.5789113364732.1
Scas_704.38116152722.2
YBR275C (RIF1)1916112722.6
Scas_89.127151703.0
Scas_710.22112031713.5
Kwal_14.2103109931695.6
CAGL0F07777g50443686.2
Sklu_2420.877083686.6
Scas_505.4102561686.8
CAGL0H04477g162648686.8
Scas_669.3163845686.8
AFL191W157548688.3
YBR148W (YSW1)609150678.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR270W
         (987 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...  1933   0.0  
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...   916   0.0  
Scas_615.9                                                            886   0.0  
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...   886   0.0  
Kwal_55.21575                                                         841   0.0  
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...   533   e-176
KLLA0D04092g complement(344666..348124) some similarities with s...   298   2e-85
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...   298   5e-85
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...   295   6e-84
Kwal_47.17522                                                         104   1e-22
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...   104   1e-22
Scas_710.41                                                           102   7e-22
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...   101   1e-21
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...   100   3e-21
Scas_688.1                                                             98   2e-20
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    96   5e-20
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    92   1e-18
Scas_707.48*                                                           86   1e-16
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    83   9e-16
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    79   9e-15
Kwal_14.1498                                                           78   2e-14
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    70   4e-12
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    70   5e-12
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    69   1e-11
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    69   1e-11
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    69   1e-11
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    68   3e-11
Kwal_47.17547                                                          67   9e-11
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    66   1e-10
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    62   2e-09
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    61   5e-09
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    59   1e-08
Kwal_23.3160                                                           58   3e-08
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    58   3e-08
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    58   3e-08
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    57   7e-08
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    57   1e-07
Scas_297.1                                                             54   6e-07
Scas_569.0d                                                            45   3e-04
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    42   0.002
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    42   0.004
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    39   0.017
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    39   0.031
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    39   0.033
Scas_665.30                                                            38   0.058
Scas_583.14*                                                           36   0.17 
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    36   0.18 
Kwal_26.9207                                                           36   0.19 
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    36   0.19 
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    36   0.23 
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...    36   0.25 
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    35   0.26 
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...    35   0.36 
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...    34   0.84 
YDR440W (DOT1) [1261] chr4 (1342481..1344229) Histone H3 methylt...    33   0.90 
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    33   1.0  
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement          33   1.4  
YBL022C (PIM1) [173] chr2 complement(177839..181240) Serine prot...    33   1.7  
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    33   1.8  
Kwal_23.5789                                                           33   2.1  
Scas_704.38                                                            32   2.2  
YBR275C (RIF1) [454] chr2 complement(751313..757063) Protein inv...    32   2.6  
Scas_89.1                                                              32   3.0  
Scas_710.22                                                            32   3.5  
Kwal_14.2103                                                           31   5.6  
CAGL0F07777g complement(758205..759719) similar to sp|P47771 Sac...    31   6.2  
Sklu_2420.8 YPL164C, Contig c2420 15797-18109                          31   6.6  
Scas_505.4                                                             31   6.8  
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...    31   6.8  
Scas_669.3                                                             31   6.8  
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...    31   8.3  
YBR148W (YSW1) [333] chr2 (537832..539661) Protein of unknown fu...    30   8.8  

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score = 1933 bits (5007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 957/987 (96%), Positives = 957/987 (96%)

Query: 1   MREVILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNEVTADSIKEIIE 60
           MREVILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNEVTADSIKEIIE
Sbjct: 1   MREVILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNEVTADSIKEIIE 60

Query: 61  DCGFDCEILRDSEITAISTKEGLLSVQGMTCGSCVSTVTKQXXXXXXXXXXXXXXXXXXC 120
           DCGFDCEILRDSEITAISTKEGLLSVQGMTCGSCVSTVTKQ                  C
Sbjct: 61  DCGFDCEILRDSEITAISTKEGLLSVQGMTCGSCVSTVTKQVEGIEGVESVVVSLVTEEC 120

Query: 121 HVIYEPSKTTLETAREMIEDCGFDSNIIMDGNGNADMTEKTVILKVTKAFEDESPLILSS 180
           HVIYEPSKTTLETAREMIEDCGFDSNIIMDGNGNADMTEKTVILKVTKAFEDESPLILSS
Sbjct: 121 HVIYEPSKTTLETAREMIEDCGFDSNIIMDGNGNADMTEKTVILKVTKAFEDESPLILSS 180

Query: 181 VSERFQFLLDLGVKSIEISDDMHTLTIKYCCNELGIRDLLRHLERTGYKFTVFSNLDNTT 240
           VSERFQFLLDLGVKSIEISDDMHTLTIKYCCNELGIRDLLRHLERTGYKFTVFSNLDNTT
Sbjct: 181 VSERFQFLLDLGVKSIEISDDMHTLTIKYCCNELGIRDLLRHLERTGYKFTVFSNLDNTT 240

Query: 241 QLRLLSKEDEIRFWKKNSIKSTLLAIICMLLYMIVPMMWPTIVQDRIFPYKETSFVRGLF 300
           QLRLLSKEDEIRFWKKNSIKSTLLAIICMLLYMIVPMMWPTIVQDRIFPYKETSFVRGLF
Sbjct: 241 QLRLLSKEDEIRFWKKNSIKSTLLAIICMLLYMIVPMMWPTIVQDRIFPYKETSFVRGLF 300

Query: 301 YRDILGVILASYIQFSVGFYFYKAAWASLKHGSGTMDTLVCVSTTCAYTFSVFSLVHNMF 360
           YRDILGVILASYIQFSVGFYFYKAAWASLKHGSGTMDTLVCVSTTCAYTFSVFSLVHNMF
Sbjct: 301 YRDILGVILASYIQFSVGFYFYKAAWASLKHGSGTMDTLVCVSTTCAYTFSVFSLVHNMF 360

Query: 361 HPSSTGKLPRIVFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVER 420
           HPSSTGKLPRIVFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVER
Sbjct: 361 HPSSTGKLPRIVFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVER 420

Query: 421 NETKEIPIELLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPKKTGFPVIA 480
           NETKEIPIELLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPKKTGFPVIA
Sbjct: 421 NETKEIPIELLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPKKTGFPVIA 480

Query: 481 GSVNGPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVL 540
           GSVNGPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVL
Sbjct: 481 GSVNGPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVL 540

Query: 541 TFFIWCFILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTG 600
           TFFIWCFILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTG
Sbjct: 541 TFFIWCFILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTG 600

Query: 601 VGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDEDEVLAC 660
           VGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDEDEVLAC
Sbjct: 601 VGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDEDEVLAC 660

Query: 661 IKATESISDHPVSKAIIRYCDGLNCNKALNAVVLESEYVLGKGIVSKCQVNGNTYDICIG 720
           IKATESISDHPVSKAIIRYCDGLNCNKALNAVVLESEYVLGKGIVSKCQVNGNTYDICIG
Sbjct: 661 IKATESISDHPVSKAIIRYCDGLNCNKALNAVVLESEYVLGKGIVSKCQVNGNTYDICIG 720

Query: 721 NEALILEDALKKSGFINSNVDQGNTVSYVSVNGHVFGLFEINDEVKHDSYATVQYLQRNG 780
           NEALILEDALKKSGFINSNVDQGNTVSYVSVNGHVFGLFEINDEVKHDSYATVQYLQRNG
Sbjct: 721 NEALILEDALKKSGFINSNVDQGNTVSYVSVNGHVFGLFEINDEVKHDSYATVQYLQRNG 780

Query: 781 YETYMITGDNNSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGI 840
           YETYMITGDNNSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGI
Sbjct: 781 YETYMITGDNNSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGI 840

Query: 841 NDAPALALSDLGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKL 900
           NDAPALALSDLGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKL
Sbjct: 841 NDAPALALSDLGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKL 900

Query: 901 NLFWALCYNIFMIPIAMGVLIPWGITLPPMLAGLAMAFXXXXXXXXXXXXKKWTPPDIES 960
           NLFWALCYNIFMIPIAMGVLIPWGITLPPMLAGLAMAF            KKWTPPDIES
Sbjct: 901 NLFWALCYNIFMIPIAMGVLIPWGITLPPMLAGLAMAFSSVSVVLSSLMLKKWTPPDIES 960

Query: 961 HGISDFKSKFSIGNFWSRLFSTRAIAG 987
           HGISDFKSKFSIGNFWSRLFSTRAIAG
Sbjct: 961 HGISDFKSKFSIGNFWSRLFSTRAIAG 987

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score =  916 bits (2368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/968 (48%), Positives = 658/968 (67%), Gaps = 16/968 (1%)

Query: 1   MREVILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNEVTADSIKEIIE 60
           M+EV+L V GMTC++C N +  Q+ AL+GV+ CD+SLVT+EC+V  ++ V  D I E +E
Sbjct: 1   MKEVVLIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVVSEDSVATDGIIEAVE 60

Query: 61  DCGFDCEILRDSEITAISTKEGLLSVQGMTCGSCVSTVTKQXXXXXXXXXXXXXXXXXXC 120
           DCGFDCE++R+  + A +   G + ++GMTC SCV+TVTKQ                  C
Sbjct: 61  DCGFDCELIREKSM-APALCRGFIGIKGMTCSSCVATVTKQLEAIEGVSDVDVSLMTEEC 119

Query: 121 HVIYEPSKTTLETAREMIEDCGFDSNIIM-DGNGNADMTEKTVILKVTKAFEDESPLILS 179
            V+++P    +E  +E I+DCGFD  +   +  G AD   K V L++   F  +    L 
Sbjct: 120 TVVFDPQLVAIEDIKETIDDCGFDGTVSSSEPVGGADSRAKYVDLRLL-GFNSKDDNELD 178

Query: 180 SVSERFQ-FLLD-LGVKSIEISDDMHTLTIKYCCNELGIRDLLRHLERTGYKFTVFSNLD 237
            ++++ + F  D  G+  + ++ + + L++ +    +GIR ++  LE  G    V  + D
Sbjct: 179 QLTDKLRGFKQDNAGILDMALNTEDYCLSVHFDTQIIGIRKIIDILESLGINAVVDVSFD 238

Query: 238 NTTQLRLLSKEDEIRFWKKNSIKSTLLAIICMLLYMIVPMMWPTIVQDRIFPYKETSFVR 297
             TQL LL+K  EIR+WK   +KS ++A + M+LYM +P ++P++++D+IFPY     V 
Sbjct: 239 KHTQLNLLTKASEIRYWKSACVKSCIVAFVTMVLYMGLPALFPSLMKDKIFPYSSVGAVN 298

Query: 298 GLFYRDILGVILASYIQFSVGFYFYKAAWASLKHGSGTMDTLVCVSTTCAYTFSVFSLVH 357
           GL+YRDI+G  LASY+QF +G  FYK+AWASLKH +GTMDTLVC STTCAY FS++S+  
Sbjct: 299 GLYYRDIIGFFLASYVQFVIGATFYKSAWASLKHYAGTMDTLVCFSTTCAYLFSLYSMTE 358

Query: 358 NMFHPSSTGKLPRIVFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISD 417
            +  P ++GKLP+++FDTS+MI++YISIGKYLE  AKS+TSTALSKLI LTPS C I+  
Sbjct: 359 CIVSPPASGKLPKVIFDTSVMIVAYISIGKYLENKAKSKTSTALSKLISLTPSSCIIVDK 418

Query: 418 VERNETKEIPIELLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPKKTGFP 477
            + + T+EI IELL+V DI  +KPG KIP+DGI+T+G SE+DESLMTGE+ LV K+ G  
Sbjct: 419 DDDSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKGISEVDESLMTGETNLVVKEIGSV 478

Query: 478 VIAGSVNGPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILIL 537
           V  G++NG G  YF  T+VG++TKLANIIKVMK AQL KA IQ Y DY+ASIFVP +LIL
Sbjct: 479 VTGGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLIL 538

Query: 538 AVLTFFIWCFILNISA-NPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIM 596
           ++LTF +W  +         ++    T    F++CLQ ATSVVIVACPCALGLATPTAIM
Sbjct: 539 SLLTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATPTAIM 598

Query: 597 VGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDEDE 656
           VGTGV ++NGVLIKGG+VLEKFN + TFVFDKTGTLTTG M V++F+ ++  + N+    
Sbjct: 599 VGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQFVGNAEMIKNL---F 655

Query: 657 VLACIKATESISDHPVSKAIIRYCDGL--NCNKALNAVVLESEYVLGKGIVSKCQVNGNT 714
            L CI+  E++SDHPVSKA+++YC  L     +  + ++ + + + GKGI    +    T
Sbjct: 656 YLECIERAEALSDHPVSKAVVKYCRDLLGESFEGTSMIIEDEQLITGKGIKCTVKAADKT 715

Query: 715 YDICIGNEALILEDALKKSGFINSNVDQGN-TVSYVSVNGHVFGLFEINDEVKHDSYATV 773
             I +GN++L+ ED+L +  F       G  TV+Y++++  V G FE+ DEVK D+   +
Sbjct: 716 LRITVGNKSLMDEDSLGE--FWQMYGRAGPCTVTYLAIDDKVCGRFELLDEVKSDAKDVI 773

Query: 774 QYLQRNGYETYMITGDNNSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQDKEGNNKV 833
           +YL+ N YE +M+TGD + +A +VA  V I   NVYS+V+P GK   V+ +  +E    +
Sbjct: 774 RYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVYSEVTPDGKSQTVEYL--REEGRVI 831

Query: 834 AVVGDGINDAPALALSDLGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLK 893
           A +GDGIND+ AL  SDLGIAIS+GTE+AIEAA IVIL   D +  +L+G+ NA+D+S++
Sbjct: 832 AFIGDGINDSLALVTSDLGIAISSGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIR 891

Query: 894 TFKRIKLNLFWALCYNIFMIPIAMGVLIPWGITLPPMLAGLAMAFXXXXXXXXXXXXKKW 953
           TF+R+KLNLFWALCYN+FM+PIAMG+L+PWGITL PM+AGLAMAF            K W
Sbjct: 892 TFRRVKLNLFWALCYNVFMLPIAMGILVPWGITLHPMVAGLAMAFSSVSVVVNSLMLKWW 951

Query: 954 TPPDIESH 961
             P++ S 
Sbjct: 952 KAPELTSK 959

>Scas_615.9
          Length = 942

 Score =  886 bits (2290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/924 (50%), Positives = 621/924 (67%), Gaps = 36/924 (3%)

Query: 81  EGLLSVQGMTCGSCVSTVTKQXXXXXXXXXXXXXXXXXXCHVIYEPSKTTLETAREMIED 140
           +G L+VQGMTC +C S +  Q                  CHV ++  K +LE  RE +ED
Sbjct: 12  KGTLAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLELIRETVED 71

Query: 141 CGFDSNIIMD---GNGNADMTEKTVILKVTKAFEDESPLILS------SVSERFQFLLDL 191
           CGFD+ ++     G+ +AD+  +TV  KV ++  D S    +      S+ +  +     
Sbjct: 72  CGFDAQVLTSTPMGSADADIV-RTVTFKVLRSNYDVSSGFSAESGDSVSMEDTEKVGKQD 130

Query: 192 GVKSIEISDDMHTLTIKYCCNELGIRDLLRHLERTGYKFTVFSN----LDNTTQLRLLSK 247
           G+ S+E + +++T  I Y  N++GIRDL+      GY  TV S+    + + TQL LLSK
Sbjct: 131 GILSLEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATVESSNIISVSSATQLALLSK 190

Query: 248 EDEIRFWKKNSIKSTLLAIICMLLYMIVPMMWPTIVQDRIFPYKETSFVRGLFYRDILGV 307
            DEI+FWK   +K+ + AI+ M LYM +PM++P ++++  FP+KET FV GLFYRDI+G 
Sbjct: 191 WDEIQFWKFTCLKACVCAIVAMALYMWIPMIFPNLIKNNHFPFKETFFVHGLFYRDIIGW 250

Query: 308 ILASYIQFSVGFYFYKAAWASLKHGSGTMDTLVCVSTTCAYTFSVFSLVHNMFHPSSTGK 367
            +A+Y QF +G YFYKAAW+S+KHGSGTMDTL+ +ST+CAY FS+FS++H M       +
Sbjct: 251 AIATYSQFRLGIYFYKAAWSSMKHGSGTMDTLIALSTSCAYLFSIFSIIHTMVLSRGNEE 310

Query: 368 ---LPRIVFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVERNETK 424
              LP +VFDTS+M+I++IS GK LE  AK+QTS++LSKLIQLTPS C I+ D    ++ 
Sbjct: 311 SPMLPNVVFDTSVMLIAFISFGKLLENKAKAQTSSSLSKLIQLTPSKCIILQDKNNIQSS 370

Query: 425 EIPIE--LLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPKKTGFPVIAGS 482
            I IE  LLQ NDI+EIKPGMKIPADGII +GESEIDESLMTGESILV K+ G  VIAGS
Sbjct: 371 HIEIETNLLQRNDIIEIKPGMKIPADGIIIQGESEIDESLMTGESILVHKQKGSQVIAGS 430

Query: 483 VNGPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVLTF 542
           +NGPGHFYF+   +G++TKLA II+ MK AQL+KAPIQ  ADYLASIFVP IL L+++TF
Sbjct: 431 LNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVPTILCLSIITF 490

Query: 543 FIWCFILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVG 602
             W  + N+   PPV FT N     F+   Q A SV++VACPCALGLATPTAIMVGTG+G
Sbjct: 491 ITWITLSNLLTKPPVIFTNNNNG-KFYTSFQIAISVIVVACPCALGLATPTAIMVGTGIG 549

Query: 603 AQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDEDEVLACIK 662
           AQ+GVLIKGG++LE+FN+IT  VFDKTGT+TTG M V++F+  SN     D+  VL CI 
Sbjct: 550 AQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRFIPYSN-----DDLPVLPCIM 604

Query: 663 ATESISDHPVSKAIIRYCDGLNCNKALNAVVLESEYVLGKGIVSKCQVNGNTYDICIGNE 722
           A +SIS+HPV+KAI+ YC   + +     +V +SE ++GKG+  +C+  G  Y + +G++
Sbjct: 605 AAQSISEHPVAKAIVNYCGESSQDCDAGVIVTKSEIIIGKGVRCECEYQGRNYTVTVGHK 664

Query: 723 ALILEDALKKSGFINSNVDQGNTVSYVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYE 782
           AL+ +     +   + N     T SYVS+N  + G FEI D VK D    +QYLQ   Y+
Sbjct: 665 ALMTDSMFDSN---SDNTSDDFTKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLHYD 721

Query: 783 TYMITGDNNSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQ-DKEGNNKVAVVGDGIN 841
            YM+TGD++ AA +VA++VGI+  NVYS V+P+GKC++V+ +Q D  G   VA VGDGIN
Sbjct: 722 IYMVTGDSHGAAMKVAQQVGIAANNVYSGVTPSGKCEIVESLQADSVGG--VAFVGDGIN 779

Query: 842 DAPALALSDLGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKLN 901
           D+P L  SD+G+A+STGT+IA+EAADIV+L  +     SL+GL  A+DIS  TF R+K N
Sbjct: 780 DSPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQDERESLKGLIYALDISAMTFSRVKWN 839

Query: 902 LFWALCYNIFMIPIAMGVLIPWGITLPPMLAGLAMAFXXXXXXXXXXXXKKWTPPDI-ES 960
           LFWAL YNIFMIPIAMG+L+PWGIT+ PM+AGLAMA             K W PP I + 
Sbjct: 840 LFWALGYNIFMIPIAMGILVPWGITIHPMVAGLAMALSSVFVVLNSLRLKSWKPPVIGDE 899

Query: 961 HGISD----FKSKFSIGNFWSRLF 980
           H +S      K    I + W +LF
Sbjct: 900 HPLSSDYYHHKGTSWIRSGWRKLF 923

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 46/65 (70%), Gaps = 1/65 (1%)

Query: 6  LAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNE-VTADSIKEIIEDCGF 64
          LAV GMTCSACT+ I  Q+  L GV   ++SLVT+EC V +  E V+ + I+E +EDCGF
Sbjct: 15 LAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLELIRETVEDCGF 74

Query: 65 DCEIL 69
          D ++L
Sbjct: 75 DAQVL 79

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score =  886 bits (2289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/967 (48%), Positives = 652/967 (67%), Gaps = 40/967 (4%)

Query: 3   EVILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDN-EVTADSIKEIIED 61
           + +++V GMTC AC  T+ TQ+  + GVT+C++SL+T EC V +D    T   I E I++
Sbjct: 5   QALISVQGMTCGACVKTVQTQVGNVDGVTECEVSLLTEECHVLFDKGRTTTSEILETIDE 64

Query: 62  CGFDCEILR----DSEITAISTKEGLLSVQGMTCGSCVSTVTKQXXXXXXXXXXXXXXXX 117
           CGFD  ++     D ++T      G+L V GMTCG+CV TVT Q                
Sbjct: 65  CGFDGSLISEEPLDYDVTTTEQISGILLVSGMTCGACVKTVTGQVLKLSGVLECDVSLVT 124

Query: 118 XXCHVIYEPSKTTLETAREMIEDCGFDSNIIMDGNGNADMTEKTVILKVTKAF-EDESPL 176
             C V ++P  T++    E I+DCGFD+ +I + + +    EK + LK+     E +   
Sbjct: 125 EECKVKFDPHFTSMAEIAECIDDCGFDAKVISENSSSVPSNEKRLCLKIFGMLSESDRAD 184

Query: 177 ILSSVSERFQFLLDLGVKSIEISDDMHTLTIKYCCNELGIRDLLRHLERTGYKFTVFSNL 236
           I S VSE        GV SI+ S      T+ +  NE+G RD++  +E  G++  + + L
Sbjct: 185 IESKVSEL------KGVISIDTSLQSEEATVIHDANEIGNRDIIDCIEEMGFQTFISNTL 238

Query: 237 DNTTQLRLLSKEDEIRFWKKNSIKSTLLAIICMLLYMIVPMMWPTIVQDRIFPYKETSFV 296
           DN+TQL LLSK  EI+FWKKN I+  + +I+ M LYM VPM++P ++    FP+ +T  +
Sbjct: 239 DNSTQLSLLSKTKEIQFWKKNCIRGGISSILIMGLYMCVPMLFPAVLTH--FPFVQTPII 296

Query: 297 RGLFYRDILGVILASYIQFSVGFYFYKAAWASLKHGSGTMDTLVCVSTTCAYTFSVFSLV 356
            GLFYRDI+G+I+ +Y+Q  VG YFYKAAW SLKHGSGTMDTL+ +ST CAY FS +S++
Sbjct: 297 -GLFYRDIIGIIITTYVQIYVGSYFYKAAWISLKHGSGTMDTLIGLSTVCAYIFSCYSII 355

Query: 357 HNMFHPSSTGKLPRIVFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIIS 416
            +++H S+  K+P+++FDT++M++++IS+GK LE  AKS+TSTA+SKLI LTPS CSI+ 
Sbjct: 356 SSIYHKST--KMPKVIFDTAVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCSIV- 412

Query: 417 DVERNETKEIPIELLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPKKTGF 476
            +    T+EI +ELLQ NDIVE+ PGMKIPADG++ R E+E+DESL+TGES+LV K  G 
Sbjct: 413 -LPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKIVGS 471

Query: 477 PVIAGSVNGPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILI 536
            VI GSVNGPGHFYFR   VGE+TKLANII  MK+AQLSKAPIQ YAD +A IFVP ++ 
Sbjct: 472 QVIGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVIS 531

Query: 537 LAVLTFFIWCFILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIM 596
           L+ +TF  W  +      PP+ F  N++   FF+C+Q + SV+IVACPCALGLA PTAIM
Sbjct: 532 LSAITFITWMLVSYTMKTPPLIF--NSENGKFFMCMQMSISVIIVACPCALGLAAPTAIM 589

Query: 597 VGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDEDE 656
           VGTGVGA +GVLIKGG+VLEK +++ TF+FDKTGTLTTG M V+ F+  ++ V ++    
Sbjct: 590 VGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSVENFINYNSDVSDLHWKM 649

Query: 657 VLACIKATESISDHPVSKAIIRYCDG-LNCNKALNAVVLESEYVLGKGIVSKCQV-NGNT 714
           +  C    ESI +HPV+KAI+ Y D  +N +   +  +   E ++GKGI   C + + NT
Sbjct: 650 ISLC----ESIGEHPVAKAIVNYADSHVNKSSIFDLDLSNEEVLIGKGI--SCNITDKNT 703

Query: 715 ---YDICIGNEALILEDALKKSGFINSNVDQGNTVSYVSVNGHVFGLFEINDEVKHDSYA 771
              + I IGN+ L  +++L  S   +S +    T SYVS++G + G FEI+D VK D++ 
Sbjct: 704 SKIHTITIGNKKLFPDESL--SDIASSTL----TESYVSIDGSLVGKFEISDRVKEDAHF 757

Query: 772 TVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQDKEGNN 831
            V+YLQ  G +  M+TGD + +A +VA+++GIS  +V+S+V+P  K D+V ++Q+  G  
Sbjct: 758 VVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISANDVFSEVTPEQKRDIVIQLQNN-GTE 816

Query: 832 KVAVVGDGINDAPALALSDLGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDIS 891
           +VA VGDGIND+PAL  +DLGI+IS+GT+IAIEAADIVIL  ++ N NSL+GL  A+DI+
Sbjct: 817 RVAFVGDGINDSPALVEADLGISISSGTDIAIEAADIVILDSDNKN-NSLKGLVYALDIA 875

Query: 892 LKTFKRIKLNLFWALCYNIFMIPIAMGVLIPWGITLPPMLAGLAMAFXXXXXXXXXXXXK 951
            KTF R+KLN FWA+CYN FMIPIAMG+L PWGITL PML+  AMA             K
Sbjct: 876 RKTFYRVKLNFFWAVCYNTFMIPIAMGLLAPWGITLHPMLSSAAMALSSVSVVCSSLMLK 935

Query: 952 KWTPPDI 958
           +WTPP +
Sbjct: 936 RWTPPSL 942

>Kwal_55.21575
          Length = 989

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/986 (44%), Positives = 634/986 (64%), Gaps = 42/986 (4%)

Query: 2   REVILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNEVT-ADSIKEIIE 60
           R  +L V GMTC AC  TI +QL+ +KGV +  +SL+T EC+V ++ E T  +++K  I 
Sbjct: 5   RIAVLLVEGMTCGACVATIESQLKRIKGVDEVTVSLITGECEVRFEKEDTDEETLKGAII 64

Query: 61  DCGFDCEILRDSEITA----ISTKEGLLSVQGMTCGSCVSTVTKQXXXXXXXXXXXXXXX 116
           DCGF   +LR  ++ A       K  +LSVQ MTCG+CV+T+T                 
Sbjct: 65  DCGFSATVLRVQDVEAGQIARQRKTAVLSVQHMTCGACVATITNNLEAQEGVLEVAVSLA 124

Query: 117 XXXCHVIYEPSKTTLETAREMIEDCGFDSNIIMDGNGNADMTEKTVILKVT-KAFEDESP 175
              C V ++P+  T    + +I+D GF++ II D       T  + + K T K       
Sbjct: 125 TEECRVEFDPAVVTAAELKGIIDDSGFEAEIINDDAERP--TRGSTVRKATLKVLGMTCG 182

Query: 176 LILSSVSERFQFLLDLGVKSIEISDDMHTLTIKYCCNELGIRDLLRHLERTGYKFTVFSN 235
             +S+V        + GV SI++S       ++Y    +G+R +   +E  G++    ++
Sbjct: 183 ACVSTVESALS--QEPGVVSIQVSLATEEAQLEYNPAVIGVRAIASKIEDLGFESAPVNS 240

Query: 236 LDNTTQLRLLSKEDEIRFWKKNSIKSTLLAIICMLLYMIVPMMWPTIVQDRIFPYKETSF 295
            ++  Q+ LL+K  EI FWK+  ++S    ++ +LLY   P+  P      +F YK+T  
Sbjct: 241 FNSVAQVNLLAKVREINFWKRTCVQSCCFMVLMLLLYKAGPLWIPA---RNLFFYKQTG- 296

Query: 296 VRGLFYRDILGVILASYIQFSVGFYFYKAAWASLKHGSGTMDTLVCVSTTCAYTFSVFSL 355
           + GLFYRDI+G I+  Y+QF VG++FY A W S++HGSG+MDT+V +ST C++ FS++S+
Sbjct: 297 IPGLFYRDIIGFIITCYVQFWVGWHFYPAGWKSIRHGSGSMDTVVLLSTLCSFAFSLYSI 356

Query: 356 VHNMFHPSSTGKLPRIVFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSII 415
             N+   S   ++P ++FD S+M+I +IS+GK LE  AKS+T+ +LSKL+ L PS C+II
Sbjct: 357 AMNVAKKSE--RMPNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAPSTCTII 414

Query: 416 SDVERNETKEIPIELLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPKKTG 475
              E  + +EIP+E LQV D VEIKPG KIP DG+I  GESE+DESL+TGES++VP+  G
Sbjct: 415 ---ENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESLMVPRYKG 471

Query: 476 FPVIAGSVNGPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGIL 535
           FPVIAGS+NGP  F    T+VG++TKLA II+ MK+AQLSKAPIQ YADYLAS FVP +L
Sbjct: 472 FPVIAGSINGPNRFLLTATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVL 531

Query: 536 ILAVLTFFIWCFILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAI 595
           +LA++TF  W  +  + +NPP  F  ++    FFICL+   SV++VACPCALGLA PTAI
Sbjct: 532 VLAMITFVTWTILSRVLSNPPSIF--DSPNGKFFICLEMTISVIVVACPCALGLAAPTAI 589

Query: 596 MVGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDED 655
           MVGTG+GA++GVLIKGG++LEK +S+ TF+FDKTGTLTTG M V++F+       N+  +
Sbjct: 590 MVGTGLGAKHGVLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQFVP-MGVRDNLTTE 648

Query: 656 EVLACIKATESISDHPVSKAIIRYCDGL--NCNKALNAVVLESEYVLGKGIVSKCQVNGN 713
           E+L CI A+E++S+HPV KAI+ + D L  +C++   AVV +S+ +LG G++  C+++G 
Sbjct: 649 ELL-CINASEAVSEHPVGKAIVEFTDSLIEDCDR--TAVVTKSKTILGGGLICDCELDGK 705

Query: 714 TYDICIGNEALILEDALKKSGFINSNVDQGNTVSYVSVNGHVFGLFEINDEVKHDSYATV 773
            Y + IGN  ++ + +L        + D  +T++YV +NG + G FEI+D +K D+   V
Sbjct: 706 AYHVVIGNRNVMQDMSL--------SADASSTLAYVKINGELVGRFEISDFIKKDAAEVV 757

Query: 774 QYLQRNGYETYMITGDNNSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQDKEGNNKV 833
           QYL   G+   M+TGDN+ +A +VA E+GI   NVYS+++P  K  LV+ +QD  G   V
Sbjct: 758 QYLTEKGHRVCMVTGDNHKSAMKVALELGIEANNVYSELTPADKNQLVQDLQDG-GRKNV 816

Query: 834 AVVGDGINDAPALALSDLGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLK 893
           A +GDGIND+PAL  SDLG++ISTGT+IA+EAAD++IL  ++ N  SLR L  A+DI+ K
Sbjct: 817 AFIGDGINDSPALVTSDLGVSISTGTDIAMEAADVIILNRSENNHVSLRELIYALDIAQK 876

Query: 894 TFKRIKLNLFWALCYNIFMIPIAMGVLIPWGITLPPMLAGLAMAFXXXXXXXXXXXXKKW 953
           TF+R+K+N FWA+CYN+FM+PIAMGVL+PW IT+ P++A   MA               W
Sbjct: 877 TFRRVKINFFWAICYNLFMLPIAMGVLVPWEITMDPIVAVACMAASSVSVVGNSLLLNLW 936

Query: 954 TPPDIESHGISDFKSKFSIGNFWSRL 979
            PP +      D   K    + WSR+
Sbjct: 937 KPPKL------DVSPKSQKPSAWSRI 956

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (54%), Gaps = 1/66 (1%)

Query: 1   MREVILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNEVTA-DSIKEII 59
           +R+  L V GMTC AC +T+ + L    GV    +SL T E Q+ Y+  V    +I   I
Sbjct: 169 VRKATLKVLGMTCGACVSTVESALSQEPGVVSIQVSLATEEAQLEYNPAVIGVRAIASKI 228

Query: 60  EDCGFD 65
           ED GF+
Sbjct: 229 EDLGFE 234

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH]
           (511968..514400) [2433 bp, 810 aa]
          Length = 810

 Score =  533 bits (1372), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 307/790 (38%), Positives = 475/790 (60%), Gaps = 46/790 (5%)

Query: 192 GVKSIEISDDMHTLTIKYCCNELGIRDLLRHLERTGYKFTVFSNLDNTTQLRLLSKEDEI 251
           GV + E+S       ++Y    +G+R ++  +E  G++  V        Q+R L++ +E 
Sbjct: 48  GVVNAEVSLVTEECRVEYERKRVGLRQIVETIEDCGFEARV-GGCAREEQVRRLARAEET 106

Query: 252 RFWKKNSIKSTLLAIICMLLYMIVPMMWPTIVQDRIFPYKETSFVRGLFYRDILGVILAS 311
             W++ + ++   A + M LYM+ P+      ++ + P      + GLF+RD+ G+ +AS
Sbjct: 107 AQWRRRAAQAWAAAAVMMGLYMVAPL------EEALGPTP----LAGLFWRDVAGLAVAS 156

Query: 312 YIQFSVGFYFYKAAWASLKHGSGTMDTLVCVSTTCAYTFSVFSLVHNMFHPSSTGKLPRI 371
            +  + G  F +    +L+HG GTMDTLV +S+   Y FSV ++   ++  S+    P  
Sbjct: 157 GVLATAGRPFLRG-LGALRHGRGTMDTLVALSSGVTYLFSVATICRGVWLGSA--DPPST 213

Query: 372 VFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVERNETKEIPIELL 431
             DT++M++++I +GK LE+ A+++ + +L++++   PS+C+I    E    +E+ +ELL
Sbjct: 214 FLDTTVMLVAFICVGKLLESRARARAADSLARMVSSAPSMCTI---RESGSDREVEVELL 270

Query: 432 QVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPKKTGFPVIAGSVNGPGHFYF 491
           Q  D+V ++PG K+PADG +  GE+E+DESLMTGES LVPK  G  V+ GSVNG   F +
Sbjct: 271 QAGDVVVMRPGTKLPADGTVLEGEAEVDESLMTGESTLVPKYPGSRVLCGSVNGAAGFLY 330

Query: 492 RTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVLTFFIWCFILNI 551
           R   VGEET+LA I+  MK+AQL+KAPIQ YAD+LAS F+P +LILA+LTF  W  I  +
Sbjct: 331 RADLVGEETRLAGIVAAMKQAQLAKAPIQRYADFLASWFIPSVLILALLTFVCWMLICTL 390

Query: 552 SANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKG 611
            A PP  F     ++  ++C + A +V++VACPC LGLA PTAIMVGTG+GA+ G+L KG
Sbjct: 391 LATPPSIF---NNSNRLYVCSRIAITVIVVACPCPLGLAAPTAIMVGTGLGAERGLLFKG 447

Query: 612 GEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDEDEVLACIKATESISDHP 671
           G+V+E   ++   +FDKTGTLTTG + V  F  +S  +    +   L C  A E +S+HP
Sbjct: 448 GDVIETAAAVQAILFDKTGTLTTGKLTVHNFTSESKAL--TPDQWALVC--AAERLSEHP 503

Query: 672 VSKAIIRYCDGLNCNKAL-NAVVLESEYVLGKGIVSKCQVNGNTYDICIGNEALILEDAL 730
           +++AI+ Y +     +A+   VVL  E ++G G+    Q++G  + I IG+  L+ E   
Sbjct: 504 IARAIVTYAEPYASPEAVARIVVLNHEVLVGLGVRCVLQLDGVEHRITIGSARLLPERPS 563

Query: 731 KKSGFINSNVDQGNTVSYVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDN 790
           K S         G+T S+V+VN  + G F+++D ++ D+Y  VQ L   G+   M+TGDN
Sbjct: 564 KFS---------GSTASFVAVNDVLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDN 614

Query: 791 NSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSD 850
           + AA  V+  +GI   NV+S+  P GKCD++++++ K   + VA +GDGIND+ ALA SD
Sbjct: 615 HEAAMHVSHALGIPLNNVFSERLPEGKCDVLRQLRQK--YDYVAFIGDGINDSVALAESD 672

Query: 851 LGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKLNLFWALCYNI 910
           LGI++S  ++I  +AA IV+L  +  +   L  +  AID++  TF R+KLN+FWA+ YN 
Sbjct: 673 LGISLSGNSDIVADAAGIVVL--DHSSAPPLTRILYAIDLARATFNRVKLNIFWAVLYNS 730

Query: 911 FMIPIAMGVLIPWGITLPPMLAGLAMAFXXXXXXXXXXXXKKWTPPDIESHGISDFKSKF 970
            M+P++MGVLIPWGI LPPM A   MA              +W P       +     K 
Sbjct: 731 LMLPVSMGVLIPWGIQLPPMAAAAGMAMSSVSVVTSSLLLARWRP-------VPAASRKA 783

Query: 971 SIGNFWSRLF 980
           ++G+ W   F
Sbjct: 784 AVGS-WRNFF 792

 Score = 69.7 bits (169), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 51/81 (62%), Gaps = 4/81 (4%)

Query: 5   ILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNE-VTADSIKEIIEDCG 63
           +L+V GMTC+AC  T++  +RA+ GV   ++SLVT EC+V Y+ + V    I E IEDCG
Sbjct: 24  VLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEECRVEYERKRVGLRQIVETIEDCG 83

Query: 64  FDCEI---LRDSEITAISTKE 81
           F+  +    R+ ++  ++  E
Sbjct: 84  FEARVGGCAREEQVRRLARAE 104

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 40/89 (44%), Gaps = 1/89 (1%)

Query: 59  IEDCGFDCEILRDSEITAISTKEGLLSVQGMTCGSCVSTVTKQXXXXXXXXXXXXXXXXX 118
           +E  G + E+ R    +   T   +LSV+GMTC +CV TV +                  
Sbjct: 1   MEVTGLEAEMARMGNGSMAGTT-AVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTE 59

Query: 119 XCHVIYEPSKTTLETAREMIEDCGFDSNI 147
            C V YE  +  L    E IEDCGF++ +
Sbjct: 60  ECRVEYERKRVGLRQIVETIEDCGFEARV 88

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score =  298 bits (764), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 267/943 (28%), Positives = 452/943 (47%), Gaps = 123/943 (13%)

Query: 85   SVQGMTCGSCVSTVTKQXXXXXXXXXXXXXXXXXX-CHVIYEPSKTTLETAREMIEDCGF 143
            S+ G+TC +C S++T                       ++    ++ L+  +E +EDCGF
Sbjct: 192  SIGGITCAACASSITNAVSDLDFVSDVAVNVVSKVGVFILDSDDQSKLDQLKETVEDCGF 251

Query: 144  DSNIIMDGNGNADMTE--------KTVILKVTKAFEDESPLILSSVSERFQFLLDLGVKS 195
                + +  G+  +T         + V +K+   F    P+         + LLD+    
Sbjct: 252  ----VYEAVGSPTLTNHISVKSPARHVTVKIEGMFCSNCPV------RTIKSLLDIANAE 301

Query: 196  IEISDDMHTLTIK-------YCCN-ELGI--RDLLRHL-------ERTGYKFTVFSNLDN 238
            + I D+   LT+K       Y  N E GI  R++   +       E    K  +   +  
Sbjct: 302  L-IIDNTDELTLKHPYIKFTYIPNVERGITIRNIFSKITEELTTEEHKDIKVVIVKEVTL 360

Query: 239  TTQLRLLSKEDEIRFWK--KNSIKSTLLAIICMLLYMIVPMMWPTIVQDRIFPYKETSFV 296
               L+ ++K++    W   K  I  T++AI      ++   + P+  + R +   E ++V
Sbjct: 361  EEHLKEMAKKET---WSIAKRLIAVTVMAIPTFAFGIVGMALLPSSNKFREW-VDEPTWV 416

Query: 297  RGLFYRDILGVILASYIQFSVGFYFYKAA----WASLKHGS---------GTMDTLVCVS 343
              +     +  I+++ + F V   F++ A    ++  KH +         G+M+ L+ + 
Sbjct: 417  GNVSRVVWILFIISTPVYFFVADIFHRKAVKEIYSLWKHSNNWKRRLFRFGSMNLLMSLG 476

Query: 344  TTCAYTFSVFSLVHNMFHPSSTGK------LPRIVFDTSIMIISYISIGKYLETLAKSQT 397
            TT AY  S+  L      P  T        L    FD+ + +  ++ IG+ LE+LAK++T
Sbjct: 477  TTVAYFASIALLGIAASRPRDTSDSRMHKGLSTTYFDSVVFLTFFLLIGRLLESLAKTKT 536

Query: 398  STALSKLIQLTPSVCSIISDV--ERNETKEIPIELLQVNDIVEIKPGMKIPADGIITRGE 455
            ++A+S L        +++  V  +  E + + I+ L++ D ++I PG   P D II  GE
Sbjct: 537  ASAISNLSSFKQETATLMQKVGDQYQEVETVQIQYLELGDYIKISPGQSPPLDSIILEGE 596

Query: 456  SEIDESLMTGESILVPKKTGFPVIAGSVN-GPGHFYFRTTTVGEETKLANIIKVMKEAQL 514
            +E DES +TGESI + +  G  + AG+VN G      + ++   E+ L  I+  +++ QL
Sbjct: 597  TEFDESALTGESIPMVRLRGDQIFAGTVNVGSSSVIAKVSSFDGESLLDQIVNTVRDGQL 656

Query: 515  SKAPIQGYADYLASIFVPGILILAVLTFFIWCFILNISANPPVAFTANTKADNFFICLQT 574
            ++API+  AD L   FVP I+ LA+LT+ +W   L +S   P  +            L+ 
Sbjct: 657  NRAPIERLADILTGYFVPIIIFLAILTWVVW-LSLGLSGKLPEHYLDTDIGGWPVWSLEF 715

Query: 575  ATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIK-GGEVLEKFNSITTFVFDKTGTLT 633
            A SV ++ACPC +GLA PTA+ VG+G+ A+ G+L + GG   ++   I    FDKTGTLT
Sbjct: 716  AISVFVIACPCGIGLAAPTALFVGSGMAAKFGILCRGGGAAFQEGCKIAIVCFDKTGTLT 775

Query: 634  TGFMVVKKFLKDSNWVGNVDEDEVLACI-----KATESISDHPVSKAIIRYCDGLNCNKA 688
             G       +K +N+  ++  DE LA I     +  ES S HP++  + ++ D     K 
Sbjct: 776  LG-----NEMKVTNY--SLHGDEKLAKIGIEVTRDMESGSRHPLAIGVKKFIDNTFGKKT 828

Query: 689  LNAVVLESEYVLGKGIVSKCQVNG-------------NTYDICIGNEALILE-------D 728
                V +   + G G+  +  ++              +     +GNE L+ +       +
Sbjct: 829  GTVKVPDPVEITGGGLKGEIIIDNDLSLPDARIWKEVDPEMAIVGNERLLRDYKCHLTSE 888

Query: 729  ALKKSGFINSNVDQGNTVSYVSVNGH-VFG--------LFEINDEVKHDSYATVQYLQRN 779
             LK    +     +G ++   ++     FG        +    DE++ ++   ++ L+R+
Sbjct: 889  QLK---LLAEWKARGKSLMVTAIKSRSYFGNDNFYPVMMCAAKDEIRPEAKDVIKELRRS 945

Query: 780  GYETYMITGDNNSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQDK----EGNNK-VA 834
            G E +MI+GDN   A+ VA+E+ I  +NV ++V P  K   VK IQ       G++K VA
Sbjct: 946  GIECWMISGDNEVTARAVAQELDI--DNVIAEVLPEEKAAKVKWIQHNNIGANGHHKVVA 1003

Query: 835  VVGDGINDAPALALSDLGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKT 894
            +VGDGINDAPALA +D+GIA+++G+E+A+ + D V+L       N+L  L   + +S   
Sbjct: 1004 MVGDGINDAPALAAADVGIALASGSELAMTSCDFVLLSP----INTLVSLLALLKLSKTV 1059

Query: 895  FKRIKLNLFWALCYNIFMIPIAMGVLIPWGIT-LPPMLAGLAM 936
            F RIK N  WAL YN+  +PIA GV+ P+  T L P+ A  AM
Sbjct: 1060 FNRIKFNFTWALVYNMLALPIAAGVIYPYHNTRLSPVWASAAM 1102

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 52/99 (52%), Gaps = 7/99 (7%)

Query: 3   EVILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQ--VTYDNEVTADSIKEIIE 60
           +V  ++ G+TC+AC ++I   +  L  V+   +++V+      +  D++   D +KE +E
Sbjct: 188 KVTASIGGITCAACASSITNAVSDLDFVSDVAVNVVSKVGVFILDSDDQSKLDQLKETVE 247

Query: 61  DCGFDCEILRDSEIT-AISTKEGL----LSVQGMTCGSC 94
           DCGF  E +    +T  IS K       + ++GM C +C
Sbjct: 248 DCGFVYEAVGSPTLTNHISVKSPARHVTVKIEGMFCSNC 286

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transporting
            ATPase, involved in resistance to cadmium [3651 bp, 1216
            aa]
          Length = 1216

 Score =  298 bits (764), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 216/688 (31%), Positives = 352/688 (51%), Gaps = 68/688 (9%)

Query: 261  STLLAIICMLLYMIVPMMWPTIVQDRIFPYKETSFVRGLFYRDILGVILASYIQFSVGFY 320
            +T L+II  L   I+ M W   ++++I     +             ++LA+ IQF +   
Sbjct: 564  TTALSII--LTIPILVMAWAPQLREKISTISAS-------------MVLATIIQFVIAGP 608

Query: 321  FYKAAWASLKHGSG-TMDTLVCVSTTCAYTFSVFSLVHNMF-HPSSTGKLPRIVFDTSIM 378
            FY  A  SL       MD L+ +ST+ AY FS+ S  + +   P ST +     F+TS +
Sbjct: 609  FYLNALKSLIFSRLIEMDLLIVLSTSAAYIFSIVSFGYFVVGRPLSTEQF----FETSSL 664

Query: 379  IISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVE 438
            +++ I +G+++  LA+ +   ++S  ++   +  +I+ D    ET EI I LLQ  DI +
Sbjct: 665  LVTLIMVGRFVSELARHRAVKSIS--VRSLQASSAILVDKTGKET-EINIRLLQYGDIFK 721

Query: 439  IKPGMKIPADGIITRGESEIDESLMTGESILVPKKTGFPVIAGSVNGPGHFYFRTTTVGE 498
            + P  +IP DG +  G SE+DE+L+TGES+ VPKK    V+AGSVNG G  + + + +  
Sbjct: 722  VLPDSRIPTDGTVISGSSEVDEALITGESMPVPKKCQSIVVAGSVNGTGTLFVKLSKLPG 781

Query: 499  ETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVLTFFIWCFILNISANPPVA 558
               ++ I  ++ EA+L+K  IQ  AD +AS FVP I+ + V+TF +W  +        + 
Sbjct: 782  NNTISTIATMVDEAKLTKPKIQNIADKIASYFVPTIIGITVVTFCVWIAV-------GIR 834

Query: 559  FTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKF 618
                +++D     +  A +V+IV+CPC +GLA P   ++ +GV A+ GV+ K  E +E  
Sbjct: 835  VEKQSRSDAVIQAIIYAITVLIVSCPCVIGLAVPIVFVIASGVAAKRGVIFKSAESIEVA 894

Query: 619  NSITTFVFDKTGTLTTG-FMVVKKFLKDSNWVGNVDEDEVLACIKATESISDHPVSKAII 677
            ++ +  VFDKTGTLT G   VV + ++     G+    + L  +  TE I  HPVS AI 
Sbjct: 895  HNTSHVVFDKTGTLTEGKLTVVHETVR-----GDRHNSQSLL-LGLTEGIK-HPVSMAIA 947

Query: 678  RYC--DGLNCNKALNAVVLESEYVLGKGIVSKCQVNGNTYDICIGNEALILEDALKKSGF 735
             Y    G++     N   +  + V G          GN   +   N+             
Sbjct: 948  SYLKEKGVSAQNVSNTKAVTGKRVEGTSYSGLKLQGGNCRWLGHNNDP-----------D 996

Query: 736  INSNVDQGNTVSYVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAK 795
            +   ++QG +V   SVNG V  ++ + D ++ D+ +T+  L++ G   ++++GD++ A +
Sbjct: 997  VRKALEQGYSVFCFSVNGSVTAVYALEDSLRADAVSTINLLRQRGISLHILSGDDDGAVR 1056

Query: 796  RVAREVGISFENVYSDVSPTGKCDLVKKIQ-----DKEGNNKVAVV---GDGINDAPALA 847
             +A  +GI   N+ S  +P  K + +K I      D    +K  VV   GDG NDA  L 
Sbjct: 1057 SMAARLGIESSNIRSHATPAEKSEYIKDIVEGRNCDSSSQSKRPVVVFCGDGTNDAIGLT 1116

Query: 848  LSDLGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKLNLFWALC 907
             + +G+ I+ G+E+A  AAD+V+L         L  +   I +S K   R+KLN  W+  
Sbjct: 1117 QATIGVHINEGSEVAKLAADVVML------KPKLNNILTMITVSQKAMFRVKLNFLWSFT 1170

Query: 908  YNIFMIPIAMGVLIPWGITLPPMLAGLA 935
            YN+F I +A G  + + I  PP  AGL 
Sbjct: 1171 YNLFAILLAAGAFVDFHI--PPEYAGLG 1196

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 3   EVILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNEVTADSIKEIIE 60
            ++L+V GM+C+ C + +     ALK V     SL+ ++ +   D  +   S+K++I+
Sbjct: 411 HIVLSVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLD--LAQGSVKDVIK 466

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score =  295 bits (756), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 273/988 (27%), Positives = 473/988 (47%), Gaps = 110/988 (11%)

Query: 29   GVTKCDISLVTNECQVTYDNEVTADSIKEIIEDCGFDCEILRDSEITAISTKEGLLSVQG 88
             V +  + L   +  V   N++ A S+ + + D  F  +++    +      +    + G
Sbjct: 232  AVDENGMELTPGKLSVLLSNKLYAQSVADALRDNNFQAQLVDMKPVVNELKYKITAIIGG 291

Query: 89   MTCGSCVSTVTKQXXXXXXXXXXXXXXXXXXCHVIYE-PSKTTLETAREMIEDCGFDSNI 147
            +TC SC +++T                       I +  ++  +   R+++E+CGF+  +
Sbjct: 292  ITCASCCNSITAAASKLDFIADVAVNAVTKTAIFISDVNNERAINCLRDVVEECGFEFEL 351

Query: 148  I---MDGNGNADMTEKTVI-LKVTKAFEDESPLILSSVSERFQFLLDLGVKSIEISDDMH 203
            +        ++  TE+ V+ +++   +    P  + +  E +    ++ V  +      H
Sbjct: 352  VGVPQSTIHSSVQTERRVVTIEIDGMYCQSCPQRVVASLENYN-KANIEVTQVPTLKSPH 410

Query: 204  TLTIKYCCNELG---IRDLLRHLE------RTGYKFTVF----SNLDNTTQLRLLSKEDE 250
             LT  Y  N+     IR L+ H+        + Y+ +V     S LD  ++L+ L+ E E
Sbjct: 411  -LTFSYVPNQSNGTTIRALVEHVRTSILPANSSYQISVKVVEGSLLD--SKLKDLN-ERE 466

Query: 251  IRFWKKNSIKSTLLAIICMLLYMIVPMMWPTIVQDRIFPYKETS-FVRGLFYRDILGVIL 309
             +   +  I + ++AI   +  +I   + P   + R   + E   +V+ +     + +IL
Sbjct: 467  QKSIMRCLIFAAIVAIPTFVFGIIGMSLLPG--EHRFRKWLEKPLWVKNVPRVIWILLIL 524

Query: 310  ASYIQFSVGFYF-------------YKAAWASLKHGSGTMDTLVCVSTTCAYTFSVFSLV 356
            ++ + FSV   F             Y+ +W +     G+M+ LV + T+ AY  S+  L+
Sbjct: 525  STPVYFSVAEQFHAKACRELHFLWAYQKSWTARLFKFGSMNLLVSLGTSVAYFASILLLI 584

Query: 357  HNM------FHPSSTGKLPRIVFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQLTPS 410
             +        H  S    P   FD+ + +  ++ IG+ LE+L+KS+    L  L  L   
Sbjct: 585  LSALKKDANHHKGS----PDTYFDSVVFLTLFLLIGRLLESLSKSKMVKTLESLTSLKQR 640

Query: 411  VCSII-SDVERNETKEIPI--ELLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGES 467
               ++ +D  R+  KE  +  E+L++ D + IKPG     D +I +GE+E DES +TGES
Sbjct: 641  TGILMQADGARDFKKETSVSAEMLELGDHILIKPGASPAVDALIVQGETEFDESSLTGES 700

Query: 468  ILVPKKTGFPVIAGSVN-GPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYL 526
              +    G  + AG+VN G      + +T    + L ++I  +++ QL  API+  AD L
Sbjct: 701  RPITHFPGDQIFAGTVNVGQCAVIAKVSTAPGNSLLDHVISAVRDGQLRGAPIERIADVL 760

Query: 527  ASIFVPGILILAVLTFFIWCFILNISANPPVAFTANTKADNF-----FICLQTATSVVIV 581
               FVP I++LA+LT+ IW  IL  +        +  K D       F  L+ A +V ++
Sbjct: 761  TGYFVPFIVLLAILTWAIW-LILGFAG-----VLSQEKLDGSVGGWPFWSLEFAIAVFVI 814

Query: 582  ACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNS-ITTFVFDKTGTLTTGF---- 636
            ACPC +GLA PTA+ VG  + A+ G+L +GG    +  S +TT  FDKTGTLT G     
Sbjct: 815  ACPCGIGLAAPTALFVGANIAAKYGILARGGSAAFQMGSKVTTVCFDKTGTLTKGCAPEV 874

Query: 637  --MVVKKFLKDSNWVGNVDEDEVLACIKATESISDHPVSKAIIRYCDGLNCNKALNAVVL 694
                +    +    +G V  +  LA        S HP+S ++  +          +  VL
Sbjct: 875  TDYAIYPDPRIHKILGKVLHEFGLA--------SKHPLSHSMKCFALKTLGEDLSDINVL 926

Query: 695  ESEYVLGKGIV-----SKCQVNGN-----TYDICIGNEALILEDALK----KSGFINSNV 740
            E + + GKG+      S  Q +G        ++ +GNE  + E+  +    +   + S  
Sbjct: 927  EIKEIPGKGMTGVIEPSPAQPSGFRDELVPSEVIVGNEKFMAENGCQLSPDQESLLYSWK 986

Query: 741  DQGNTVSYVSVN---GHVFGLF------EINDEVKHDSYATVQYLQRNGYETYMITGDNN 791
             +G ++  + +N   G     F       + DE++ ++   VQ L   G E +MI+GDN+
Sbjct: 987  IEGRSIIIIGMNFPEGAATQCFIPTLFLAVRDELRPEAKEVVQALHERGIECWMISGDNS 1046

Query: 792  SAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQDKEGNN-KVAVVGDGINDAPALALSD 850
             AA  VA EVGI  ++V +DV P GK + ++ I++  G    +A+VGDG+NDAPA+A +D
Sbjct: 1047 LAANAVALEVGI--KHVIADVLPEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIAAAD 1104

Query: 851  LGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKLNLFWALCYNI 910
            +GI++++G+++A+ + D V+L       N L G+   + +S K F+R+K N  WAL YNI
Sbjct: 1105 VGISLASGSDLAMISCDFVLLS----KKNPLTGIVVLLQLSKKVFRRVKFNFVWALVYNI 1160

Query: 911  FMIPIAMGVLIPWGIT-LPPMLAGLAMA 937
              +PIA GVL P+  T L P+ A +AMA
Sbjct: 1161 ICVPIAAGVLYPYKETRLSPVWASIAMA 1188

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 52/98 (53%), Gaps = 7/98 (7%)

Query: 8   VHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYD--NEVTADSIKEIIEDCGFD 65
           + G+TC++C N+I      L  +    ++ VT       D  NE   + +++++E+CGF+
Sbjct: 289 IGGITCASCCNSITAAASKLDFIADVAVNAVTKTAIFISDVNNERAINCLRDVVEECGFE 348

Query: 66  CEILRDSEIT---AISTKEGLLSVQ--GMTCGSCVSTV 98
            E++   + T   ++ T+  +++++  GM C SC   V
Sbjct: 349 FELVGVPQSTIHSSVQTERRVVTIEIDGMYCQSCPQRV 386

>Kwal_47.17522
          Length = 899

 Score =  104 bits (260), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 129/542 (23%), Positives = 219/542 (40%), Gaps = 91/542 (16%)

Query: 425 EIPIELLQVNDIVEIKPGMKIPADGIITRGES--EIDESLMTGESILVPKKTGFPVIAGS 482
           EIP   +   DI++++ G+ I ADG +   E   +ID+S +TGES+ V K  G    + S
Sbjct: 171 EIPANEVVPGDIMQLEDGVVICADGRLVTEECFLQIDQSAITGESLAVDKHYGDTTFSSS 230

Query: 483 VNGPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQG-YADYLASIFVPGILILAVLT 541
               G  +   T  G+ T +     ++ +A    A  QG + + L  I    ++++ V  
Sbjct: 231 TVKRGEGFMIVTATGDNTFVGRAAALVNQA----AGDQGHFTEVLNGIGTILLVLVIVTL 286

Query: 542 FFIW--CFILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGT 599
             +W  CF                + D     L+    + I+  P  L     T + VG 
Sbjct: 287 LLVWTACFY---------------RTDRIVRILRYTLGITIIGVPVGLPAVVTTTMAVGA 331

Query: 600 GVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDEDEVL- 658
              A+   +++    +E    +     DKTGTLT      K  L +   V  V+ D+++ 
Sbjct: 332 AYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKN----KLSLHEPYTVEGVEPDDLML 387

Query: 659 -ACIKATESIS-----DHPVSKAIIRYCDGLNCNKALNAVVLESEYVLGKGIVSKCQVNG 712
            AC+ A+         D    K++I+Y    N       +       + K + +  +   
Sbjct: 388 TACLAASRKKKGLDAIDKAFLKSLIQYPRAKNALTKYKVLDFHPFDPVSKKVTAVVESPE 447

Query: 713 NTYDICIGNEALILEDALKKSGFINSNVDQG--NTVSYVSVNG---------------HV 755
               IC+    L +   +++   I  +V +   N V+ ++  G                +
Sbjct: 448 GERIICVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVARKRGEGHWEI 507

Query: 756 FGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGIS----------- 804
            G+    D  + D+  TV   +R G    M+TGD    AK   R++G+            
Sbjct: 508 LGVMPCMDPPRDDTAQTVHEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGL 567

Query: 805 --------------FENV--YSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALAL 848
                          EN   +++V P  K  +V+ +Q +     VA+ GDG+NDAP+L  
Sbjct: 568 GGGGDMPGSELADFVENADGFAEVFPQHKYSVVEILQQR--GYLVAMTGDGVNDAPSLKK 625

Query: 849 SDLGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKLNLFWALCY 908
           +D GIA+   T+ A  AADIV L           GL+  ID +LKT ++I   ++  + Y
Sbjct: 626 ADTGIAVEGATDAARSAADIVFLA---------PGLSAIID-ALKTSRQIFHRMYSYVVY 675

Query: 909 NI 910
            I
Sbjct: 676 RI 677

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score =  104 bits (260), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 127/541 (23%), Positives = 224/541 (41%), Gaps = 89/541 (16%)

Query: 425 EIPIELLQVNDIVEIKPGMKIPADG-IITRG-ESEIDESLMTGESILVPKKTGFPVIAGS 482
           EIP   +   DI++++ G+ IPADG I+T G   +ID+S +TGES+ V K+ G    + S
Sbjct: 171 EIPANEVVPGDILQLEDGVIIPADGRIVTEGCFVQIDQSAITGESLAVDKRYGDATFSSS 230

Query: 483 VNGPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASI--FVPGILILAVL 540
               G  +   T  G+ T +     ++ +A         + + L  I   +  ++IL +L
Sbjct: 231 TVKRGEGFMIVTATGDSTFVGRAAALVNKASAGSG---HFTEVLNGIGTILLILVILTLL 287

Query: 541 TFFIWCFILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTG 600
             ++ CF  +I               +    L+   ++ +V  P  L     T + VG  
Sbjct: 288 VVYVACFYRSI---------------DIVTILRYTLAITVVGVPVGLPAVVTTTMAVGAA 332

Query: 601 VGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDEDEVL-- 658
             A+   +++    +E    +     DKTGTLT      K  L +   V  V+ D+++  
Sbjct: 333 YLAKKKAIVQKLSAIESLAGVEILCSDKTGTLTKN----KLSLHEPYTVEGVEADDLMLT 388

Query: 659 ACIKATESIS-----DHPVSKAIIRYCDGLNCNKALNAVVLESEYVLGKGIVSKCQVNGN 713
           AC+ A+         D    K++I Y            +       + K + +  +    
Sbjct: 389 ACLAASRKKKGLDAIDKAFLKSLINYPRAKAALTKYKVLEFHPFDPVSKKVTAIVESPEG 448

Query: 714 TYDICIGNEALILEDALKKSGFINSNVDQG--NTVSYVSVNGH---------------VF 756
              +C+    L +   ++++  I  +V +   N V+ ++  G+               + 
Sbjct: 449 ERIVCVKGAPLFVLKTVEENHLIPEDVKENYENKVAELASRGYRALGVARKRGEGHWEIL 508

Query: 757 GLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGIS------------ 804
           G+    D  + D+  TV   +  G    M+TGD    AK   R++G+             
Sbjct: 509 GVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLG 568

Query: 805 -------------FENV--YSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALS 849
                         EN   +++V P  K ++V+ +Q +     VA+ GDG+NDAP+L  +
Sbjct: 569 GGGDMPGSELADFVENADGFAEVFPQHKYNVVEILQQR--GYLVAMTGDGVNDAPSLKKA 626

Query: 850 DLGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKLNLFWALCYN 909
           D GIA+   T+ A  AADIV L           GL+  ID +LKT ++I   ++  + Y 
Sbjct: 627 DTGIAVEGATDAARSAADIVFLA---------PGLSAIID-ALKTSRQIFHRMYSYVVYR 676

Query: 910 I 910
           I
Sbjct: 677 I 677

>Scas_710.41
          Length = 904

 Score =  102 bits (254), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 134/595 (22%), Positives = 234/595 (39%), Gaps = 104/595 (17%)

Query: 371 IVFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVERNETKEIPIEL 430
           ++ + S+  I     G  +E L K+  +TA             +I D      +EIP   
Sbjct: 138 LMLNASVGFIQEFQAGSIVEELKKTLANTA------------RVIRD---GTLQEIPANE 182

Query: 431 LQVNDIVEIKPGMKIPADG-IITRGES-EIDESLMTGESILVPKKTGFPVIAGSVNGPGH 488
           +   DI+E+  G  IPADG ++T     ++D+S +TGES+ V K  G    + S    G 
Sbjct: 183 IVPGDILELDEGTIIPADGRLVTENRFLQVDQSAITGESLAVDKNYGDVTFSSSTVKTGT 242

Query: 489 FYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVLTFFIW--C 546
                T  G+ T +     ++ EA   +     + D L  I    ++++ +    +W  C
Sbjct: 243 SVMVVTATGDNTFVGRAAALVGEASGGQGH---FTDILNDIGTILLVLVIITLLLVWTAC 299

Query: 547 FILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNG 606
           F                + D   + L+    + I+  P  L     T + VG    A+  
Sbjct: 300 FY---------------RTDGIVMILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQ 344

Query: 607 VLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDEDEVL--ACIKAT 664
            +++    +E    +     DKTGTLT      K  L +   V  V  D+++  AC+ AT
Sbjct: 345 AIVQKLSAIESLAGVEILCSDKTGTLTKN----KLSLHEPYTVEGVSADDLMLTACLAAT 400

Query: 665 ESIS-----DHPVSKAIIRYCDGLNCNKALNAVVLESEYVLGKGIVSKCQVNGNTYDICI 719
                    D    K++ +Y   +N       +       + K + +  +        C+
Sbjct: 401 RKKKGLDAIDRAFLKSLNQYPKAMNALPKYKILEFHPFDPVSKKVTAVVKSPEGETITCV 460

Query: 720 GNEALILEDALKKSGFINSNVDQG--NTVSYVSVNG---------------HVFGLFEIN 762
               L +   +++   +  +V +   N V+ ++  G                + G+    
Sbjct: 461 KGAPLFVLKTVEEDHPVPEDVHENYENKVAELASRGFRSLGVARKRGEGYWEILGVMPCM 520

Query: 763 DEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISF----------------- 805
           D  + D+  T+   +  G    M+TGD    AK  +R++G+                   
Sbjct: 521 DPPRDDTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLGLGVNIYNAEKLGLGGGGDMP 580

Query: 806 --------ENV--YSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAI 855
                   EN   +++V P  K  +V+ +Q++     VA+ GDG+NDAP+L  +D GIA+
Sbjct: 581 GSELADFVENADGFAEVFPQHKYKVVEILQNR--GYLVAMTGDGVNDAPSLKKADTGIAV 638

Query: 856 STGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKLNLFWALCYNI 910
              T+ A  AADIV L           GL+  ID  LKT ++I   ++  + Y I
Sbjct: 639 EGATDAARSAADIVFLA---------PGLSAIID-GLKTSRQIFHRMYSYVVYRI 683

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score =  101 bits (252), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 126/570 (22%), Positives = 226/570 (39%), Gaps = 92/570 (16%)

Query: 396 QTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPGMKIPADGIITRGE 455
           Q  + + +L +   +   +I D    +  EIP   +   DI++++ G  IP DG I   +
Sbjct: 164 QAGSIVDELKKTLANTAVVIRD---GQLVEIPANEVVPGDILQLEDGTVIPTDGRIVTED 220

Query: 456 S--EIDESLMTGESILVPKKTGFPVIAGSVNGPGHFYFRTTTVGEETKLANIIKVMKEAQ 513
              +ID+S +TGES+ V K  G    + S    G  +   T  G+ T +     ++ +A 
Sbjct: 221 CFLQIDQSAITGESLAVDKHYGDQTFSSSTVKRGEGFMVVTATGDNTFVGRAAALVNKAA 280

Query: 514 LSKAPIQGYADYLASIFVPGILILAVLTFFIW--CFILNISANPPVAFTANTKADNFFIC 571
             +       + +  I +  +L++A L   +W  CF                + +     
Sbjct: 281 GGQGHFTEVLNGIGIILL--VLVIATL-LLVWTACFY---------------RTNGIVRI 322

Query: 572 LQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGT 631
           L+    + I+  P  L     T + VG    A+   +++    +E    +     DKTGT
Sbjct: 323 LRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGT 382

Query: 632 LTTGFMVVKKFLKDSNWVGNVDEDEVL--ACIKATESIS-----DHPVSKAIIRYCDGLN 684
           LT      K  L +   V  V  D+++  AC+ A+         D    K++ +Y    +
Sbjct: 383 LTKN----KLSLHEPYTVEGVSPDDLMLTACLAASRKKKGLDAIDKAFLKSLKQYPKAKD 438

Query: 685 CNKALNAVVLESEYVLGKGIVSKCQVNGNTYDICIGNEALILEDALKKSGFINSNVDQG- 743
                  +       + K + +  +       +C+    L +   +++   I  +V +  
Sbjct: 439 ALTKYKVLEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVEEDHPIPEDVHENY 498

Query: 744 -NTVSYVSVNG---------------HVFGLFEINDEVKHDSYATVQYLQRNGYETYMIT 787
            N V+ ++  G                + G+    D  + D+  TV   +  G    M+T
Sbjct: 499 ENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTVSEARHLGLRVKMLT 558

Query: 788 GDNNSAAKRVAREVGIS-------------------------FENV--YSDVSPTGKCDL 820
           GD    AK   R++G+                           EN   +++V P  K  +
Sbjct: 559 GDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYRV 618

Query: 821 VKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAISTGTEIAIEAADIVILCGNDLNTNS 880
           V+ +Q++     VA+ GDG+NDAP+L  +D GIA+   T+ A  AADIV L         
Sbjct: 619 VEILQNR--GYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLA-------- 668

Query: 881 LRGLANAIDISLKTFKRIKLNLFWALCYNI 910
             GL+  ID +LKT ++I   ++  + Y I
Sbjct: 669 -PGLSAIID-ALKTSRQIFHRMYSYVVYRI 696

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score =  100 bits (248), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 129/596 (21%), Positives = 236/596 (39%), Gaps = 106/596 (17%)

Query: 371 IVFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVERNETKEIPIEL 430
           ++ + S+  I     G  ++ L K+  +TA            ++I D    +  EIP   
Sbjct: 180 LLLNASVGFIQEFQAGSIVDELKKTLANTA------------TVIRD---GQLIEIPANE 224

Query: 431 LQVNDIVEIKPGMKIPADGIITRGES--EIDESLMTGESILVPKKTGFPVIAGSVNGPGH 488
           +   +I++++ G   PADG I   +   +ID+S +TGES+   K  G  V + S    G 
Sbjct: 225 VVPGEILQLESGTIAPADGRIVTEDCFLQIDQSAITGESLAAEKHYGDEVFSSSTVKTGE 284

Query: 489 FYFRTTTVGEETKLANIIKVMKEAQLSKAPIQG-YADYLASIFVPGILILAVLTFFIW-- 545
            +   T  G+ T +     ++ +A    + ++G + + L  I +  ++++      +W  
Sbjct: 285 AFMVVTATGDNTFVGRAAALVGQA----SGVEGHFTEVLNGIGIILLVLVIATLLLVWTA 340

Query: 546 CFILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQN 605
           CF   +                    L+    + I+  P  L     T + VG    A+ 
Sbjct: 341 CFYRTV---------------GIVSILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK 385

Query: 606 GVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDEDEVL--ACIKA 663
             +++    +E    +     DKTGTLT      K  L +   V  V  D+++  AC+ A
Sbjct: 386 QAIVQKLSAIESLAGVEILCSDKTGTLTKN----KLSLHEPYTVEGVSPDDLMLTACLAA 441

Query: 664 TESIS-----DHPVSKAIIRYCDGLNCNKALNAVVLESEYVLGKGIVSKCQVNGNTYDIC 718
           +         D    K++I Y    +       +       + K + +  +       +C
Sbjct: 442 SRKKKGLDAIDKAFLKSLIEYPKAKDALTKYKVLEFHPFDPVSKKVTAVVESPEGERIVC 501

Query: 719 IGNEALILEDALKKSGFINSNVDQG--NTVSYVSVNG---------------HVFGLFEI 761
           +    L +   +++   I  +V +   N V+ ++  G                + G+   
Sbjct: 502 VKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVARKRGEGHWEILGVMPC 561

Query: 762 NDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGIS----------------- 804
            D  + D+  T+   +  G    M+TGD    AK   R++G+                  
Sbjct: 562 MDPPRDDTAQTINEARNLGLRIKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDM 621

Query: 805 --------FENV--YSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIA 854
                    EN   +++V P  K  +V+ +Q++     VA+ GDG+NDAP+L  +D GIA
Sbjct: 622 PGSELADFVENADGFAEVFPQHKYRVVEILQNR--GYLVAMTGDGVNDAPSLKKADTGIA 679

Query: 855 ISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKLNLFWALCYNI 910
           +   T+ A  AADIV L           GL+  ID +LKT ++I   ++  + Y I
Sbjct: 680 VEGATDAARSAADIVFLA---------PGLSAIID-ALKTSRQIFHRMYSYVVYRI 725

>Scas_688.1
          Length = 913

 Score = 97.8 bits (242), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 125/541 (23%), Positives = 214/541 (39%), Gaps = 89/541 (16%)

Query: 425 EIPIELLQVNDIVEIKPGMKIPADGIITRGES--EIDESLMTGESILVPKKTGFPVIAGS 482
           E+P   +   DI++++ G+ IPADG I   +   +ID+S +TGES+   K  G    + S
Sbjct: 185 EVPANEVVPGDILQLEDGVIIPADGRIVTEDCFVQIDQSAITGESLAADKHYGDQTFSSS 244

Query: 483 VNGPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVLTF 542
               G  +   T  G+ T +     ++ +A       QG+                VL  
Sbjct: 245 TVKRGEAFMVITATGDNTFVGRAAALVNKASGG----QGH-------------FTEVLNG 287

Query: 543 FIWCFILNISANPPVAFTAN-TKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGV 601
                ++ +     + +TA+  + D     L+    + IV  P  L     T + VG   
Sbjct: 288 IGIILLVLVIVTLLLVWTASFYRTDGIVRILRYTLGITIVGVPVGLPAVVTTTMAVGAAY 347

Query: 602 GAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDEDEVL--A 659
            A+   +++    +E    +     DKTGTLT      K  L +   V  V  D+++  A
Sbjct: 348 LAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKN----KLSLHEPYTVEGVSADDLMLTA 403

Query: 660 CIKATESIS-----DHPVSKAIIRYCDGLNCNKALNAVVLESEYVLGKGIVSKCQVNGNT 714
           C+ A+         D    K++ +Y    N       +       + K + +  +     
Sbjct: 404 CLAASRKKKGLDAIDKAFLKSLAQYPAAKNALTKYKVLEFHPFDPVSKKVTAVVESPEGE 463

Query: 715 YDICIGNEALILEDALKKSGFINSNVDQG--NTVSYVSVNG---------------HVFG 757
             IC+    L +   +++   I  ++ +   N V+ ++  G                + G
Sbjct: 464 RIICVKGAPLFVLKTVEEDHPIPEDIHENYENKVAELASRGFRALGVARKRGEGHWEILG 523

Query: 758 LFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENVY-------- 809
           +    D  + D+  TV   +R G    M+TGD    AK   R++G+   NVY        
Sbjct: 524 VMPCMDPPRDDTGETVAEARRLGLRVKMLTGDAVGIAKETCRQLGLG-TNVYNAERLGLS 582

Query: 810 --------------------SDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALS 849
                               ++V P  K  +V+ +Q +     VA+ GDG+NDAP+L  +
Sbjct: 583 GGGDMPGSELADFVENADGFAEVFPQDKYRVVEILQTR--GYLVAMTGDGVNDAPSLKKA 640

Query: 850 DLGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKLNLFWALCYN 909
           D GIA+   T+ A  AADIV L           GL+  ID +LKT ++I   ++  + Y 
Sbjct: 641 DTGIAVEGATDAARSAADIVFLA---------PGLSAIID-ALKTSRQIFHRMYSYVVYR 690

Query: 910 I 910
           I
Sbjct: 691 I 691

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 96.3 bits (238), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 122/539 (22%), Positives = 216/539 (40%), Gaps = 85/539 (15%)

Query: 425 EIPIELLQVNDIVEIKPGMKIPADGIITRGES--EIDESLMTGESILVPKKTGFPVIAGS 482
           E+P   +   DI++++ G+ IPADG +   +   +ID+S +TGES+ V K+ G    + S
Sbjct: 171 EVPSNEVVPGDILQLEDGVVIPADGRLVTEDCFIQIDQSAITGESLAVDKRFGDSTFSSS 230

Query: 483 VNGPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVLTF 542
               G  +   T  G+ T +     ++ +A         + + L  I    ++++ V   
Sbjct: 231 TVKRGEAFMIVTATGDSTFVGRAAALVNKAAAGSG---HFTEVLNGIGTILLILVIVTLL 287

Query: 543 FIWCFILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVG 602
            +W               +  + +     L+   ++ IV  P  L     T + VG    
Sbjct: 288 LVWV-------------ASFYRTNKIVRILRYTLAITIVGVPVGLPAVVTTTMAVGAAYL 334

Query: 603 AQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDEDEVL--AC 660
           A+   +++    +E    +     DKTGTLT      K  L +   V  VD D+++  AC
Sbjct: 335 AKKQAIVQKLSAIESLAGVEILCSDKTGTLTKN----KLSLHEPYTVEGVDPDDLMLTAC 390

Query: 661 IKATESIS-----DHPVSKAIIRYCDGLNCNKALNAVVLESEYVLGKGIVSKCQVNGNTY 715
           + A+         D    K++I Y            +       + K + +  +      
Sbjct: 391 LAASRKKKGLDAIDKAFLKSLISYPRAKAALTKYKLLEFHPFDPVSKKVTAIVESPEGER 450

Query: 716 DICIGNEALILEDALKKSGFINSNVDQG--NTVSYVSVNG---------------HVFGL 758
            IC+    L +   +++   I  +V +   N V+ ++  G                + G+
Sbjct: 451 IICVKGAPLFVLKTVEEEHPIPEDVRENYENKVAELASRGFRALGVARKRGEGHWEILGV 510

Query: 759 FEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGIS-------------- 804
               D  + D+  TV   +  G    M+TGD    AK   R++G+               
Sbjct: 511 MPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGG 570

Query: 805 -----------FENV--YSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDL 851
                       EN   +++V P  K ++V+ +Q +     VA+ GDG+NDAP+L  +D 
Sbjct: 571 GDMPGSELADFVENADGFAEVFPQHKYNVVEILQQR--GYLVAMTGDGVNDAPSLKKADT 628

Query: 852 GIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKLNLFWALCYNI 910
           GIA+   T+ A  AADIV L           GL+  ID +LKT ++I   ++  + Y I
Sbjct: 629 GIAVEGATDAARSAADIVFLA---------PGLSAIID-ALKTSRQIFHRMYSYVVYRI 677

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 127/570 (22%), Positives = 229/570 (40%), Gaps = 92/570 (16%)

Query: 396 QTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPGMKIPADGIITRGE 455
           Q  + + +L +   +V  +I D    +  E+P   +   DI++++ G  IPADG +    
Sbjct: 148 QAGSIVDELKKTLANVAVVIRD---GQLVEVPANEVVPGDILQLEDGTIIPADGRLVTEN 204

Query: 456 S--EIDESLMTGESILVPKKTGFPVIAGSVNGPGHFYFRTTTVGEETKLANIIKVMKEAQ 513
              ++D+S +TGES+ V K  G    + S    G  +   T  G+ T +     ++ +A 
Sbjct: 205 CFLQVDQSAITGESLAVDKGYGDQTFSSSTVKRGEAFMVVTATGDNTFVGRAAALVNKAS 264

Query: 514 LSKAPIQGYADYLASIFVPGILILAVLTFFIW--CFILNISANPPVAFTANTKADNFFIC 571
             +     + + L  I +  ++++ V    +W  CF                + DN    
Sbjct: 265 GGQG---HFTEVLNGIGILLLVLVIVTLLGVWAACFY---------------RTDNIVKI 306

Query: 572 LQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGT 631
           L+    + I+  P  L     T + VG    A+   +++    +E    +     DKTGT
Sbjct: 307 LRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGT 366

Query: 632 LTTGFMVVKKFLKDSNWVGNVDEDEVL--ACIKATESIS-----DHPVSKAIIRYCDGLN 684
           LT      K  L +   V  V  D+++  AC+ A+         D    K++I Y    +
Sbjct: 367 LTKN----KLSLHEPYTVEGVSADDLMLTACLAASRKKKGLDAIDKAFLKSLINYPKAKD 422

Query: 685 CNKALNAVVLESEYVLGKGIVSKCQVNGNTYDICIGNEALILEDALKKSGFINSNVDQG- 743
                  +       + K + +  +       +C+    L +   +++   I  +V +  
Sbjct: 423 ALTKYKVIEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVEEDHPIPEDVHENY 482

Query: 744 -NTVSYVSVNG---------------HVFGLFEINDEVKHDSYATVQYLQRNGYETYMIT 787
            N V+ ++  G                + G+    D  + D+  TV   +R G    M+T
Sbjct: 483 ENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAETVNEARRLGLRVKMLT 542

Query: 788 GDNNSAAKRVAREVGIS-------------------------FENV--YSDVSPTGKCDL 820
           GD    AK   R++G+                           EN   +++V P  K  +
Sbjct: 543 GDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYKV 602

Query: 821 VKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAISTGTEIAIEAADIVILCGNDLNTNS 880
           V+ +Q++     VA+ GDG+NDAP+L  +D GIA+   ++ A  AADIV L         
Sbjct: 603 VEILQNR--GYLVAMTGDGVNDAPSLKKADTGIAVEGASDAARSAADIVFLA-------- 652

Query: 881 LRGLANAIDISLKTFKRIKLNLFWALCYNI 910
             GL+  ID +LKT ++I   ++  + Y I
Sbjct: 653 -PGLSAIID-ALKTSRQIFHRMYSYVVYRI 680

>Scas_707.48*
          Length = 741

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 149/637 (23%), Positives = 264/637 (41%), Gaps = 123/637 (19%)

Query: 376 SIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVND 435
           ++ I+  +S+G +++     ++  AL+KL+   P+ C +I      +   +    L   D
Sbjct: 121 TLAIVIVVSVG-FVQEYRSEKSLEALNKLV---PAECHLI---RCGQESHVLASGLVPGD 173

Query: 436 IVEIKPGMKIPAD-GIITRGESEIDESLMTGESILVPK------KTGF--------PV-- 478
           +V  K G +IPAD  II   +  IDES +TGE+  V K      K  F        P+  
Sbjct: 174 LVHFKIGDRIPADLRIIEAVDLSIDESNLTGENEPVHKSAKEVNKDSFNDQPNSIIPISD 233

Query: 479 -----IAGSVNGPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLA------ 527
                  G++   GH       +G+ T    I +++   +  K P+Q   D L       
Sbjct: 234 RTCVAYMGTLVKEGHGKGIVVGIGKNTSFGAIFEMLSNIEKPKTPLQNAMDKLGKDLSLF 293

Query: 528 SIFVPGIL-ILAVLTFFIWCFILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCA 586
           S  V G++ ++ +L    W  +  IS +  +A  A  +     + +  A  V+ +A   A
Sbjct: 294 SFIVIGLICLVGILQGRSWLEMFQISVS--LAVAAIPEGLPIIVTVTLALGVLRMAKRKA 351

Query: 587 LGLATPTAIMVG---------TGVGAQNGV----------LIKGGEVLE----KFNSITT 623
           +    P+   +G         TG    N +          +     VL     K  S+  
Sbjct: 352 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTASKIWCLDSMANKANVLSLEKSKSGSLKN 411

Query: 624 FVF-DKTGTLTTGFMVVKKFLKDSN--WVGNVDEDEVLACIKATESISDHPVSKAIIRYC 680
           ++  D   TLT G +         +  ++GN  +  +L  +   +     P  K +    
Sbjct: 412 YLTEDVKSTLTIGNICNNASFSQEHGKYLGNPTDIALLEQLSKFDLSDIRPTFKKVQEIP 471

Query: 681 DGLNCNKALNAVVL---ESEYVLG-KG----IVSKC----QVNGNTYDICIGNEALILED 728
              N  +   AV +   E +Y L  KG    ++S+C       G T  +  G   +I+E 
Sbjct: 472 --FNSKRKFMAVKIVNSEGKYSLCVKGAFEKVLSQCSHYLNQKGKTEKLTQGQRDVIIET 529

Query: 729 A-------LKKSGFINSNV-DQGNTVSYVSVNGHVF-GLFEINDEVKHDSYATVQYLQRN 779
           A       L+   F  + + D    ++  SV   +F GL  +ND  +      ++ L + 
Sbjct: 530 ANSLASEGLRMLAFAKTTLPDSPTLLTEESVGDLIFTGLIGMNDPPRPTVKPAIEQLLQG 589

Query: 780 GYETYMITGDNNSAAKRVAREVGI---------------------------SFENVYSDV 812
           G    MITGD+ + A  +AR++GI                              N+++  
Sbjct: 590 GVHIIMITGDSENTAVNIARQIGIPVLDPKLSVLSGDKLNEMSDDQLANVIDHVNIFARA 649

Query: 813 SPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAIST-GTEIAIEAADIVIL 871
           +P  K ++V+ ++ +   + VA+ GDG+NDAPAL L+D+G+++   GT++A EA+D+V L
Sbjct: 650 TPEHKLNIVRALRKR--GDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMV-L 706

Query: 872 CGNDLNTNSLRGLANAIDISLKTFKRIKLNLFWALCY 908
             +D +T     +  AI+     F  I+  L + LC+
Sbjct: 707 TDDDFST-----ILTAIEEGKGIFNNIQNFLTFQLCW 738

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 82.8 bits (203), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 63/220 (28%), Positives = 110/220 (50%), Gaps = 38/220 (17%)

Query: 741 DQGNTVSYVSVNGHVF-GLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAR 799
           D  N +S   +NG  F GLF + D  + +  A+++ L R G    MITGD+ + A  +A 
Sbjct: 553 DSDNVISEDDINGLTFTGLFGLADPPRPNVKASIEKLHRGGVHIIMITGDSVNTAVSIAE 612

Query: 800 EVGISFE---------------------------NVYSDVSPTGKCDLVKKIQDKEGNNK 832
           ++G+S +                           N+++  +P  K ++VK ++ +   + 
Sbjct: 613 KIGLSVQDRESSVMTGDKVSELTEDELSKVIDKVNIFARATPENKLNIVKALRKR--GDI 670

Query: 833 VAVVGDGINDAPALALSDLGIAIS-TGTEIAIEAADIVILCGNDLNTNSLRGLANAIDIS 891
           VA+ GDG+NDAPAL L+D+GIA+  +GT++A E +D+ IL  +D ++     +  AI+  
Sbjct: 671 VAMTGDGVNDAPALKLADIGIAMGISGTDVAKEVSDM-ILTDDDFSS-----ILTAIEEG 724

Query: 892 LKTFKRIKLNLFWALCYNIFMIP-IAMGVLIPWGITLPPM 930
              F  I+  L + L  ++  +  IA+  +      L PM
Sbjct: 725 KGIFNNIRNFLTFQLSISVATLSLIAITTIAKLPAPLNPM 764

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 117/287 (40%), Gaps = 42/287 (14%)

Query: 376 SIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVND 435
           S+ I+  +++G +++     ++  AL+KL+   P+ C +I      E+  +  EL+   D
Sbjct: 131 SLAILIVVTVG-FIQEYRSEKSLEALNKLV---PTKCHLIR--YGRESNTLASELVP-GD 183

Query: 436 IVEIKPGMKIPAD-GIITRGESEIDESLMTGESILVPKKT-----------GFPV----- 478
           +V  K G +IPAD  II   +  IDES +TGE+  + K               PV     
Sbjct: 184 LVRFKIGDRIPADVRIIEAVDLSIDESNLTGETEPLHKDAQTIDPEEYDNRNVPVSERSC 243

Query: 479 --IAGSVNGPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILI 536
               G++   GH        G  T    I +++   +  K P+Q   D L +        
Sbjct: 244 IAYMGTLVKEGHGKGIVIGTGTNTSYGAIFEMVNSIEKPKTPLQETMDRLGT-------- 295

Query: 537 LAVLTFFIWCFILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIM 596
              L++  +  I  IS           + ++  +  Q + S+ + A P  L +     + 
Sbjct: 296 --ELSYISFFIIAIISI------VGIIRGNSLLMMFQVSVSLAVAAIPEGLPIIVTVTLA 347

Query: 597 VGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFL 643
           +G     +   +++    +E   S+     DKTGTLTT  M V K  
Sbjct: 348 LGVLRMTKQNAIVRRLPSVETLGSVNVICTDKTGTLTTNHMTVSKLF 394

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 79.3 bits (194), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 124/597 (20%), Positives = 229/597 (38%), Gaps = 126/597 (21%)

Query: 396 QTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPGMKIPAD-GIITRG 454
           ++  +L  L +L P+ C +I          +    L   D+V  K G +IPAD  II   
Sbjct: 143 RSEKSLEALHKLVPASCHLI---RFGAETHVLASCLVPGDLVYFKVGDRIPADVRIIEST 199

Query: 455 ESEIDESLMTGES----------------------ILVPKKTGFPVIAGSVNGPGHFYFR 492
           +  +DES +TGE+                      I + ++T    + G++   GH    
Sbjct: 200 DLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYM-GTLVREGHGKGI 258

Query: 493 TTTVGEETKLANIIKVMKEAQLSKAPIQGYAD-------YLASIFVPGILILAVLTFFIW 545
               G+ T    + ++M   +  K P+Q   D       Y+  +    I +L V+    W
Sbjct: 259 VVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFVLSGIIFLLGVIQGRSW 318

Query: 546 CFILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVG------- 598
             +  IS +  +A  A  +     + +  A  V+ +A   A+    P+   +G       
Sbjct: 319 LEMFQISVS--LAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGSVNVICS 376

Query: 599 --TGVGAQNGVLIKG----GEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDS------ 646
             TG    N +        G +  K N++ +     +G L      +K +L D       
Sbjct: 377 DKTGTLTANHMTASKIWCLGSMANK-NNVLSLEAKSSGGLPGKLPNLKNYLSDDVKATLR 435

Query: 647 ---------------NWVGNVDEDEVLACIKATESISDHPVSKAIIRYCDGLNCNKALNA 691
                           ++GN  +  +L  ++  + + + P +  +       N  +   A
Sbjct: 436 IGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDERPTTTRVDELT--FNSKRKYMA 493

Query: 692 VVLESEYVLGKGIV--------------------SKCQVNGNTYDICIGNEALIL-EDAL 730
           V ++S    GK I+                     K +   +++   I + A  L  + L
Sbjct: 494 VKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAKSLASEGL 553

Query: 731 KKSGFINSNVDQGNTVSYVSVNGHVF-GLFEINDEVKHDSYATVQYLQRNGYETYMITGD 789
           +   F          ++  ++    F GL  + D  +      ++ L + G    MITGD
Sbjct: 554 RTLAFAQLECSTNKPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGD 613

Query: 790 NNSAAKRVAREVGI---------------------------SFENVYSDVSPTGKCDLVK 822
             + A  +AR++GI                              N+++  +P  K ++V+
Sbjct: 614 AENTAVNIARQIGIPVINPEISVLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVR 673

Query: 823 KIQDKEGNNKVAVVGDGINDAPALALSDLGIAIS-TGTEIAIEAADIVILCGNDLNT 878
            +Q +   + VA+ GDG+NDAPAL L+D+G+A+   GT++A EA+D+V L  +D +T
Sbjct: 674 ALQKR--GDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMV-LTDDDFST 727

>Kwal_14.1498
          Length = 939

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 90/182 (49%), Gaps = 34/182 (18%)

Query: 728 DALKKSGFINSNVDQGNT--VSYVSVNGHVF-GLFEINDEVKHDSYATVQYLQRNGYETY 784
           D L+   F    +  GN+  ++   +NG  F GL  +ND  +    A V+ L        
Sbjct: 531 DGLRTLAFAQLELSNGNSKKLTEDDINGLTFAGLLGMNDPPRPSVKAAVERLSEGSVHII 590

Query: 785 MITGDNNSAAKRVAREVGI---------------------------SFENVYSDVSPTGK 817
           MITGD  + A  +AR++GI                              N+++  +P  K
Sbjct: 591 MITGDAENTAVSIARQIGIPVVNPETAVLTGDKLDHMSEDQLASIIDHVNIFARATPEHK 650

Query: 818 CDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAI-STGTEIAIEAADIVILCGNDL 876
            ++V+ +Q +   + VA+ GDG+NDAPAL L+D+G+++   GT++A EA+D+V L  +D 
Sbjct: 651 LNIVRALQKR--GDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMV-LTDDDF 707

Query: 877 NT 878
           +T
Sbjct: 708 ST 709

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 61/268 (22%), Positives = 103/268 (38%), Gaps = 41/268 (15%)

Query: 396 QTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPGMKIPAD-GIITRG 454
           ++  +L  L +L P  C +I      +  ++   +L   D+V  + G +IPAD  II   
Sbjct: 132 RSEKSLEALNRLVPDQCHLI---RCGQESKLLASVLVPGDVVRFRVGDRIPADLRIIEAV 188

Query: 455 ESEIDESLMTGESILVPKKTG--------------FPV-------IAGSVNGPGHFYFRT 493
           +  I+ES +TGE+  V K T                PV         G++   GH     
Sbjct: 189 DLSIEESNLTGENEPVHKSTATVNKEFYKENLGSIVPVSERSCIAFMGTLVREGHGRGIV 248

Query: 494 TTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVLTFFIWCFILNISA 553
               + T    + ++M   +  K P+Q   D L       +  ++ +   I C I  I  
Sbjct: 249 IGTAKNTAFGKVFEMMNAIEKPKTPLQTAMDKLGK----DLSFMSFIVIGIICLIGVI-- 302

Query: 554 NPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGE 613
                     +  ++    Q + S+ + A P  L +     + +G    A+   +I+   
Sbjct: 303 ----------QGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRRAIIRRLP 352

Query: 614 VLEKFNSITTFVFDKTGTLTTGFMVVKK 641
            +E   S+     DKTGTLT   M V K
Sbjct: 353 SVETLGSVNVICSDKTGTLTANHMSVNK 380

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 80/157 (50%), Gaps = 32/157 (20%)

Query: 751 VNGHVF-GLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGI------ 803
           V G  F GL  +ND  +    + ++ L +      MITGD  + A  +AR++GI      
Sbjct: 555 VEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPVINPE 614

Query: 804 ---------------------SFENVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGIND 842
                                   NV++  +P  K ++V+ +Q +   + VA+ GDG+ND
Sbjct: 615 YSVLSGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKR--GDIVAMTGDGVND 672

Query: 843 APALALSDLGIAI-STGTEIAIEAADIVILCGNDLNT 878
           APAL L+D+G+++   GT++A EA+D+V L  +D +T
Sbjct: 673 APALKLADIGVSMGKMGTDVAKEASDMV-LTDDDFST 708

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 59/268 (22%), Positives = 102/268 (38%), Gaps = 41/268 (15%)

Query: 396 QTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPGMKIPAD-GIITRG 454
           ++  +L  L +L P+ C +       +   +    L   D+V  K G +IPAD  I+   
Sbjct: 132 KSEKSLEALNKLVPAECHL---TRSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESI 188

Query: 455 ESEIDESLMTGESILVPKKTG--------------FPV-------IAGSVNGPGHFYFRT 493
           +  +DES +TGE+  V K +G               PV         G++   GH     
Sbjct: 189 DLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIV 248

Query: 494 TTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVLTFFIWCFILNISA 553
              G+ T   ++ ++M      K P+Q   D L          L+ ++F +         
Sbjct: 249 IATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQD-------LSYMSFVLIGI------ 295

Query: 554 NPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGE 613
              +      +  ++    Q A S+ + A P  L +     + +G    A+   +++   
Sbjct: 296 ---ICLIGIIQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLP 352

Query: 614 VLEKFNSITTFVFDKTGTLTTGFMVVKK 641
            +E   S+     DKTGTLT   M V K
Sbjct: 353 SVETLGSVNVICSDKTGTLTANHMTVSK 380

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 79/150 (52%), Gaps = 31/150 (20%)

Query: 757 GLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGI------------- 803
           GL  +ND  + +    ++ L + G    MITGD+ + A  +A+++GI             
Sbjct: 574 GLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGD 633

Query: 804 --------------SFENVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALS 849
                            N+++  +P  K ++V+ ++ +   + VA+ GDG+NDAPAL LS
Sbjct: 634 KLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKR--GDVVAMTGDGVNDAPALKLS 691

Query: 850 DLGIAIST-GTEIAIEAADIVILCGNDLNT 878
           D+G+++   GT++A EA+D+V L  +D +T
Sbjct: 692 DIGVSMGRIGTDVAKEASDMV-LTDDDFST 720

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/269 (22%), Positives = 105/269 (39%), Gaps = 41/269 (15%)

Query: 396 QTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPGMKIPAD-GIITRG 454
           ++  +L  L +L P+ C ++      +   +    L   D+V  + G +IPAD  II   
Sbjct: 137 RSEKSLEALNKLVPAECHLM---RCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAI 193

Query: 455 ESEIDESLMTGESILVPK------KTGF--------PV-------IAGSVNGPGHFYFRT 493
           +  IDES +TGE+  V K      K+ F        P+         G++   GH     
Sbjct: 194 DLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIV 253

Query: 494 TTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVLTFFIWCFILNISA 553
              G  T    + ++M   +  K P+Q   D L          L++++F +   I     
Sbjct: 254 VGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKD-------LSLVSFIVIGMI----- 301

Query: 554 NPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGE 613
                     +  ++    Q + S+ + A P  L +     + +G    A+   +++   
Sbjct: 302 ----CLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLP 357

Query: 614 VLEKFNSITTFVFDKTGTLTTGFMVVKKF 642
            +E   S+     DKTGTLT+  M V K 
Sbjct: 358 SVETLGSVNVICSDKTGTLTSNHMTVSKL 386

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 80/151 (52%), Gaps = 33/151 (21%)

Query: 757 GLFEINDEVKHD-SYATVQYLQRNGYETYMITGDNNSAAKRVAREVGI------------ 803
           GL  +ND  +    +A  Q+LQ  G    MITGD+ + A  +AR++GI            
Sbjct: 575 GLIGMNDPPRSSVKFAIDQFLQ-GGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSG 633

Query: 804 ---------------SFENVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALAL 848
                             N+++  +P  K ++V+ ++ +   + VA+ GDG+NDAPAL L
Sbjct: 634 DKLNEMTDDQLANVIDHVNIFARATPEHKLNIVRALRRR--GDVVAMTGDGVNDAPALKL 691

Query: 849 SDLGIAIST-GTEIAIEAADIVILCGNDLNT 878
           +D+G+++   GT++A EA+D+ IL  +D +T
Sbjct: 692 ADIGVSMGRMGTDVAKEASDM-ILTDDDFST 721

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 59/269 (21%), Positives = 105/269 (39%), Gaps = 43/269 (15%)

Query: 396 QTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPGMKIPAD-GIITRG 454
           ++  +L  L +L P  C +I      E+  +   L+   D+V  + G +IPAD  II   
Sbjct: 145 RSEKSLEALNKLVPQECHLIRG--GRESNVLATNLVP-GDLVRFRIGDRIPADIRIIECN 201

Query: 455 ESEIDESLMTGES----------------------ILVPKKTGFPVIAGSVNGPGHFYFR 492
           +  IDES +TGE+                      + V ++T    + G++   G+    
Sbjct: 202 DLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPVAERTNIAYM-GTLVKEGNGRGI 260

Query: 493 TTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVLTFFIWCFILNIS 552
               G ET   N+ ++M   +  K P+Q   D L          L++ +F          
Sbjct: 261 VVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKD-------LSLASF---------V 304

Query: 553 ANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGG 612
               +      +  ++    Q + S+ + A P  L +     + +G    A+   +++  
Sbjct: 305 VIGIICVVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRL 364

Query: 613 EVLEKFNSITTFVFDKTGTLTTGFMVVKK 641
             +E   S+     DKTGTLT+  M V K
Sbjct: 365 PSVETLGSVNVICSDKTGTLTSNHMTVSK 393

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 84/181 (46%), Gaps = 45/181 (24%)

Query: 757 GLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENVYSDV---- 812
           GL  I D ++     +VQ  QR G    M+TGDN   AK +AR   I   ++ S+     
Sbjct: 732 GLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTDISSEAYSAM 791

Query: 813 --------------------------SPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPAL 846
                                     SP  K  LV+ +  K   + VAV GDG NDAPAL
Sbjct: 792 EGTEFRKLTKNERIRILPNLRVLARSSPEDKRLLVETL--KGMGDVVAVTGDGTNDAPAL 849

Query: 847 ALSDLGIAIS-TGTEIAIEAADIVILCGNDLNTNSLRGLANAI------DISLKTFKRIK 899
            L+D+G ++  +GTE+A EA+DI+++      T+    + NAI       +S+K F + +
Sbjct: 850 KLADVGFSMGISGTEVAREASDIILM------TDDFSAIVNAIKWGRCVSVSIKKFIQFQ 903

Query: 900 L 900
           L
Sbjct: 904 L 904

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 105/264 (39%), Gaps = 42/264 (15%)

Query: 426 IPIELLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPK------------- 472
           I I  + V D++ ++ G  +PAD ++  G+ E DES +TGES  + K             
Sbjct: 205 ISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESNTIQKFPVDNSLRDFKKF 264

Query: 473 ------KTGFPVIAGSVNGPGHFYFR-----------------TTTVGEETKLANIIKVM 509
                     P+  G VN  G+                      T+VG  +     +  +
Sbjct: 265 NSIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRILSGLGRGVITSVGINSVYGQTMTSL 324

Query: 510 KEAQLSKAPIQGYADYLA-SIFVPG---ILILAVLTFFIWCFILNISANPPVAFTANTKA 565
             A+    P+Q +   LA +I V G    +IL ++ F  + F +              K 
Sbjct: 325 N-AEPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKG 383

Query: 566 DNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTFV 625
             F     T+ +V++VA P  L LA   A+   T    ++G L++     E   S T   
Sbjct: 384 SKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVC 443

Query: 626 FDKTGTLTTGFM-VVKKFLKDSNW 648
            DKTGTLT   M VV+ F  +S +
Sbjct: 444 SDKTGTLTENVMTVVRGFPGNSKF 467

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 89/186 (47%), Gaps = 51/186 (27%)

Query: 757 GLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENVYSD----- 811
           G+  I+D ++     +V+  Q++G    MITGDN +  + +AR  GI  E+ Y+D     
Sbjct: 708 GVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIARACGILSESEYADHECAM 767

Query: 812 -------------------------VSPTGK---CDLVKKIQDKEGNNKVAVVGDGINDA 843
                                     SP  K    D++KK+     N  VAV GDG NDA
Sbjct: 768 EGPVFRKLSRRQMMDAAPKLKVLARSSPEDKRIFVDILKKM-----NEVVAVTGDGTNDA 822

Query: 844 PALALSDLGIAIS-TGTEIAIEAADIVILCGNDLNTNSLRGLANAI------DISLKTFK 896
           PAL L+D+G ++  +GT +A EA+DI+++      T+    + NAI       +S+K F 
Sbjct: 823 PALTLADVGFSMGISGTGVAREASDIILM------TDDFTSIVNAIKWGRCVSLSIKKFI 876

Query: 897 RIKLNL 902
           + +L +
Sbjct: 877 QFQLTV 882

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 88/325 (27%), Positives = 134/325 (41%), Gaps = 59/325 (18%)

Query: 418 VERNETKE-IPIELLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGES--------- 467
           V RN  K  I +  L V D++ ++ G  +P D I+  G+ E DES +TGES         
Sbjct: 187 VVRNGDKHVISVHDLLVGDLLSLQTGDVVPVDCILVEGKCECDESGITGESDTIKKVSLA 246

Query: 468 -------------------------ILVPKKTGFPVIAGS--VNGPGHFYFRTTTVGEET 500
                                     LVP      +I+GS  ++G GH     T VG  +
Sbjct: 247 MSLQVYRTVAADNPSADIGSSDNGHSLVPDPM---LISGSKLLSGIGHAV--VTAVGPHS 301

Query: 501 KLANIIKVMKEAQLSKAPIQGYADYLAS-IFVPGILILAVLTFFIWCFILNISANPPVAF 559
               ++  +K ++    P+Q   + LA  I + G +  A    F+  F+  +S  P    
Sbjct: 302 VHGKMMLALK-SEPETTPLQERLNTLADDISIYGSV--AAFLLFVVLFLRFLSYLPKGRL 358

Query: 560 ----TANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVL 615
                +  K   F     TA +V++VA P  L LA   A+   T    ++G L++     
Sbjct: 359 YHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRAC 418

Query: 616 EKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDEDEVLACIKA-TESISDHPVSK 674
           E   S TT   DKTGTLT   MVV K    S+   ++ ED   A   A  + +S H ++ 
Sbjct: 419 ETMGSATTVCSDKTGTLTQNKMVVVKGFLGSSHFDDISEDSNCAQSDALRQDMSQHTLND 478

Query: 675 AIIRYCDGLNCNKALNAVVLESEYV 699
            +         N ALN+   E++ V
Sbjct: 479 IL--------ANIALNSTAFENKQV 495

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 82/177 (46%), Gaps = 45/177 (25%)

Query: 761 INDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGI----------------S 804
           I D ++ +   +V   Q+ G    M+TGDN   AK +AR  GI                +
Sbjct: 691 IQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSSKSLNDSACAMEGPA 750

Query: 805 FE--------------NVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSD 850
           F                V +  SP  K  LV+ +  KE    VAV GDG NDAPAL L+D
Sbjct: 751 FRKLSDSERKRILPKLRVLARSSPEDKKILVRAL--KEMGEVVAVTGDGTNDAPALKLAD 808

Query: 851 LGIAIS-TGTEIAIEAADIVILCGNDLNTNSLRGLANAID------ISLKTFKRIKL 900
           +G ++  TGTE+A EA+DI+++      T+    + NAI        S+K F + +L
Sbjct: 809 VGFSMGITGTEVAREASDIILM------TDDFSAIVNAIKWGRCVAASIKKFIQFQL 859

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 100/254 (39%), Gaps = 43/254 (16%)

Query: 426 IPIELLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPK------------- 472
           I I  L V D+++++ G  +PAD ++ RGE E DES +TGES  + K             
Sbjct: 170 ISIHNLLVGDLLKLQTGDVVPADCVLVRGECETDESALTGESNTIKKLPLADALEYHSAH 229

Query: 473 ------------------KTGFP---VIAGSVNGPGHFYFRTTTVGEETKLANIIKVMKE 511
                              +  P   +I+GS    G      T VG  +     +  +KE
Sbjct: 230 GGRDIGDTSASGASGAADDSRCPDCMLISGSRVLSGLASAIVTNVGVNSVHGKTMASLKE 289

Query: 512 AQLSKAPIQGYADYLA-SIFVPGILILAVLTFFIWCFILNISANPPVA-----FTANTKA 565
                 P+Q     L  +I V G   +A +T F+  F   +S   P            K 
Sbjct: 290 DS-EDTPLQMRLSQLTDNISVYG--CVAAITLFVVLFARYLSYILPSGGKYHDLPPAEKG 346

Query: 566 DNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTFV 625
             F     TA +V++VA P  L LA   A+   T    ++G L++     E   S T   
Sbjct: 347 SKFMDIFITAITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVC 406

Query: 626 FDKTGTLTTGFMVV 639
            DKTGTLT   M V
Sbjct: 407 SDKTGTLTENIMTV 420

>Kwal_47.17547
          Length = 1240

 Score = 66.6 bits (161), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 109/253 (43%), Gaps = 38/253 (15%)

Query: 426 IPIELLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPKKT----------- 474
           I I  + V DI+ ++ G  +PAD I+ +G  E DES +TGES  + K             
Sbjct: 199 ISIHDILVGDILSLQTGDVVPADCILVKGSCECDESALTGESATIKKAAIDVCYEKYKQL 258

Query: 475 ---------GFP---------VIAGSVNGPGHFYFRTTTVGEETKLANIIKVMK-EAQLS 515
                    G P         +I+GS    G      T+VG  +     +  +K EA+ +
Sbjct: 259 SATDAAIDIGTPGAEKVPDPMLISGSKLLSGLGRAVVTSVGVNSMHGRTLMALKVEAETT 318

Query: 516 KAPIQGYADYLA-SIFVPGILILAVLTFFIWC--FILNISANPPVA-FTANTKADNFFIC 571
             P+Q   D LA SI V G    A+L FFI    F+ N+     +   T   K   F   
Sbjct: 319 --PLQERLDSLANSISVYGSAA-ALLLFFILFMRFLANLKKGGELHDLTPAQKGSRFMNI 375

Query: 572 LQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGT 631
                +V++VA P  L LA   A+   T   A++G L++     E   S T    DKTGT
Sbjct: 376 FIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRVLRACETMGSATAVCSDKTGT 435

Query: 632 LTTGFM-VVKKFL 643
           LT   M VVK FL
Sbjct: 436 LTENRMTVVKGFL 448

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/183 (28%), Positives = 83/183 (45%), Gaps = 45/183 (24%)

Query: 757 GLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFE---------- 806
           G+  I D ++     +V+  Q+ G    M+TGDN   A  +A++  I  E          
Sbjct: 719 GIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEEQAENPESSM 778

Query: 807 --------------------NVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPAL 846
                                V +  SP  K  LV+ +  K+  + VAV GDG NDAPAL
Sbjct: 779 EGPRFRKLSNKERVRILPNLRVLARSSPEDKRILVETL--KKMGDVVAVTGDGTNDAPAL 836

Query: 847 ALSDLGIAIS-TGTEIAIEAADIVILCGNDLNTNSLRGLANAI------DISLKTFKRIK 899
            L+D+G ++   GTE+A EA+DI+++      T+    + NAI        S+K F + +
Sbjct: 837 KLADVGFSMGIAGTEVAREASDIILM------TDDFSAIVNAIKWGRCVSTSIKKFIQFQ 890

Query: 900 LNL 902
           L +
Sbjct: 891 LTV 893

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
           Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 1280

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 82/177 (46%), Gaps = 45/177 (25%)

Query: 761 INDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENVYSD--------- 811
           + D ++     +V+  QR G    M+TGDN   A+ ++R   I  E  Y+D         
Sbjct: 760 LQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILSEEGYNDPECAMEGPT 819

Query: 812 ---------------------VSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSD 850
                                 SP  K  LV+ +  K+    VAV GDG NDAPAL L+D
Sbjct: 820 FRKLPYKKMLRVIPKLRVLARSSPEDKRILVETL--KKMGEVVAVTGDGTNDAPALKLAD 877

Query: 851 LGIAIS-TGTEIAIEAADIVILCGNDLNTNSLRGLANAI------DISLKTFKRIKL 900
           +G ++  +GTE+A EA+DI+++      T+    + NAI       +S+K F + +L
Sbjct: 878 VGFSMGISGTEVAREASDIILM------TDDFTAIVNAIKWGRCVSVSIKKFIQFQL 928

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 109/259 (42%), Gaps = 51/259 (19%)

Query: 426 IPIELLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPKKTGFP-------- 477
           I I  L V D++ ++ G  +PAD ++  G  E DES +TGES  + K    P        
Sbjct: 252 ISIHDLLVGDVISLQTGDVVPADAVLISGSCECDESALTGESDTIKKVALKPALEKYKQI 311

Query: 478 ----------------------VIAGS--VNGPGHFYFRTTTVGEETKLANIIKVMKEAQ 513
                                 +I+GS  ++G G+     T+VGE +    I+  +K   
Sbjct: 312 FEKDPTIDIGSHGVGEKVPDPLLISGSKLLSGIGNAVI--TSVGENSVNGRIMMALKTES 369

Query: 514 LSKAPIQGYADYLA-SIFVPGILILAVLTFFIWCFILNISANP--------PVAFTANTK 564
            S  P+Q     LA +I + G +  A L  FI  FI  ++  P        P A     K
Sbjct: 370 ES-TPLQERLSNLADNISIYGCM--AALVLFIILFIRFLTYLPNGKKYHDLPPA----QK 422

Query: 565 ADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTF 624
              F     TA +V++VA P  L LA   A+   T    ++G L++     E   S T  
Sbjct: 423 GSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRACETMGSATAI 482

Query: 625 VFDKTGTLTTGFM-VVKKF 642
             DKTGTLT   M VVK F
Sbjct: 483 CSDKTGTLTENRMTVVKGF 501

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 89/199 (44%), Gaps = 44/199 (22%)

Query: 748 YVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFEN 807
           +V  N    GL  I D  + +S A V+     G   +M+TGD    AK +A+EVGI   N
Sbjct: 623 FVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHMLTGDFPGTAKSIAQEVGILPHN 682

Query: 808 VY-----------------------------------SDVSPTGKCDLVKKIQDKEGNNK 832
           +Y                                   +  +P  K  +++ +  +  N  
Sbjct: 683 LYHYPKEVVNFMVMTATDFDALSDKEIDELPVLPLVIARCAPQTKVRMIEALHRR--NRF 740

Query: 833 VAVVGDGINDAPALALSDLGIAIS-TGTEIAIEAADIVILCGNDLNTNSLRGLANAIDIS 891
            A+ GDG+ND+P+L ++++GIA+   G+++A +A+DIV      L+ ++   + NA++  
Sbjct: 741 CAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIV------LSDDNFASILNAVEEG 794

Query: 892 LKTFKRIKLNLFWALCYNI 910
            +    I+  +   L  N+
Sbjct: 795 RRMSDNIQKFVLQLLAENV 813

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 37/83 (44%), Gaps = 6/83 (7%)

Query: 559 FTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKF 618
           F  N +   + IC      V +   P +L +     +  G  V A   V+I+  + LE  
Sbjct: 307 FKVNKQVAIYAIC------VALSMIPSSLVVVLTITMSAGAKVMATRHVIIRKLDSLEAL 360

Query: 619 NSITTFVFDKTGTLTTGFMVVKK 641
            ++     DKTGTLT G M+ K+
Sbjct: 361 GAVNDICSDKTGTLTQGKMIAKQ 383

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 52/122 (42%), Gaps = 20/122 (16%)

Query: 383 ISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPG 442
           + IG Y E  A S+T  +L  L   +  V    +D+     + +P       DI  I+ G
Sbjct: 107 VVIGAYQEYNA-SKTMNSLKSLSTPSAHVIRAGNDLTIESKELVP------GDICIIRVG 159

Query: 443 MKIPADGIITRG-ESEIDESLMTGESILVPKKTGFPVIAGSVNGPGHFYFRTTTVGEETK 501
             +PAD  +      E DE+L+TGES+ V K              G  Y + T VG+   
Sbjct: 160 DTVPADLRLFEAINLETDEALLTGESLPVAKSH------------GEVYEQDTPVGDRLN 207

Query: 502 LA 503
           LA
Sbjct: 208 LA 209

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 87/191 (45%), Gaps = 44/191 (23%)

Query: 756 FGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENVY------ 809
            GL  I D  + +S A V+   + G   +M+TGD    AK +A+EVGI   N+Y      
Sbjct: 631 LGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEV 690

Query: 810 -----------------------------SDVSPTGKCDLVKKIQDKEGNNKVAVVGDGI 840
                                        +  +P  K  +++ +  +  +   A+ GDG+
Sbjct: 691 VNFMVMAATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRR--SKFCAMTGDGV 748

Query: 841 NDAPALALSDLGIAIS-TGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIK 899
           ND+P+L ++++GIA+   G+++A +A+DIV      L+ ++   + NA++   +    I+
Sbjct: 749 NDSPSLKIANVGIAMGINGSDVAKDASDIV------LSDDNFASILNAVEEGRRMSDNIQ 802

Query: 900 LNLFWALCYNI 910
             +   L  N+
Sbjct: 803 KFVLQLLAENV 813

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%)

Query: 575 ATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTT 634
           A  V I   P +L +     +  G  V A   V+++  + LE   ++     DKTGTLT 
Sbjct: 317 AICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQ 376

Query: 635 GFMVVKK 641
           G M+ K+
Sbjct: 377 GKMIAKQ 383

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 52/122 (42%), Gaps = 20/122 (16%)

Query: 383 ISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPG 442
           + IG Y E  A S+T  +L  L   +  V    +D+     + +P       DI  IK G
Sbjct: 107 VVIGAYQEYNA-SKTMNSLKSLSTPSAHVIRDGNDITIQSKELVP------GDICIIKVG 159

Query: 443 MKIPAD-GIITRGESEIDESLMTGESILVPKKTGFPVIAGSVNGPGHFYFRTTTVGEETK 501
             +PAD  ++     E DE+L+TGES+ V K                 Y + T VG+   
Sbjct: 160 DTVPADLRLLESINLETDEALLTGESLPVAKSH------------SEVYEKDTPVGDRLN 207

Query: 502 LA 503
           LA
Sbjct: 208 LA 209

>CAGL0K12034g complement(1161299..1164562) highly similar to
           sp|P13587 Saccharomyces cerevisiae YDR040c ENA1 or
           sp|Q01896 Saccharomyces cerevisiae YDR039c ENA2 or
           sp|Q12691 Saccharomyces cerevisiae YDR038c ENA5,
           hypothetical start
          Length = 1087

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 86/191 (45%), Gaps = 44/191 (23%)

Query: 756 FGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGI------------ 803
            GL  I D  + ++   V+   + G    M+TGD    AK +A+EVGI            
Sbjct: 637 LGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEV 696

Query: 804 ---------SFENVYSD--------------VSPTGKCDLVKKIQDKEGNNKVAVVGDGI 840
                     F+N+  D               SP  K  +++ +  +E     A+ GDG+
Sbjct: 697 VDIMVMTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRRE--KFCAMTGDGV 754

Query: 841 NDAPALALSDLGIAIS-TGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIK 899
           ND+P+L ++++GIA+   G+++A +A+DIV      L+ ++   + NA++   +    I+
Sbjct: 755 NDSPSLKMANVGIAMGINGSDVAKDASDIV------LSDDNFASILNAVEEGRRMSDNIQ 808

Query: 900 LNLFWALCYNI 910
             +   L  N+
Sbjct: 809 KFVLQLLAENV 819

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 102/244 (41%), Gaps = 49/244 (20%)

Query: 435 DIVEIKPGMKIPAD-GIITRGESEIDESLMTGESILVPKKTG------FPVIAGSVNGPG 487
           D+V +K G  IPAD  ++++   E DE+L+TGES+ V K          PV    +N   
Sbjct: 146 DLVVVKVGDTIPADLRLVSQQNFETDEALLTGESLPVSKDANEIFDDETPV-GDRIN--- 201

Query: 488 HFYFRTTTV------------GEETKLANIIKVMKEAQ--LSKAPIQGYAD--YLASIFV 531
              F ++TV            G  T++  I K ++     +S+ P + +    ++++   
Sbjct: 202 -LAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTKRT 260

Query: 532 PGILI--------------LAVLTFFIWCFILNISANPPVAFTANTKADNFFICLQTATS 577
            G  +              LAVL F+I   +  I       F  +     + +C      
Sbjct: 261 VGAFLGTTQGTPLHRKLSKLAVLLFWI-AVVFAIVVMASQKFDVDRGVAIYAVC------ 313

Query: 578 VVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFM 637
           V +   P +L +     + VG  V A   V+I+  + LE   ++     DKTGTLT G M
Sbjct: 314 VALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKM 373

Query: 638 VVKK 641
           + K+
Sbjct: 374 IAKQ 377

>Kwal_23.3160
          Length = 1100

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 84/190 (44%), Gaps = 44/190 (23%)

Query: 757 GLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENVY------- 809
           GL  I D  + ++   V+   + G   +M+TGD    AK +A+EVGI   N+Y       
Sbjct: 649 GLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVV 708

Query: 810 ----------------------------SDVSPTGKCDLVKKIQDKEGNNKVAVVGDGIN 841
                                       +  +P  K  ++  +  +E     A+ GDG+N
Sbjct: 709 DSMVMTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRRE--KFCAMTGDGVN 766

Query: 842 DAPALALSDLGIAIS-TGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKL 900
           D+P+L  +++GIA+   G+++A +A+DIV      L+ ++   + NA++   +    I+ 
Sbjct: 767 DSPSLKKANVGIAMGINGSDVAKDASDIV------LSDDNFASILNAVEEGRRMSDNIQK 820

Query: 901 NLFWALCYNI 910
            +   L  N+
Sbjct: 821 FVLQLLAENV 830

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 79/293 (26%), Positives = 127/293 (43%), Gaps = 48/293 (16%)

Query: 383 ISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPG 442
           ++IG Y E  A S+T  +L  L   TPS   +I D   +ET  IP + L   D+  +K G
Sbjct: 111 VAIGSYQEYKA-SKTMNSLKSLS--TPS-AHVIRD-GNDET--IPSKQLVPGDLCVVKAG 163

Query: 443 MKIPAD-GIITRGESEIDESLMTGESILVPKKTG--FPVIAGSVNGPG-HFYFRTTTV-- 496
             +PAD  +I     E DE+L+TGES+ + K+    +P    +  G   +  F ++TV  
Sbjct: 164 DTVPADLRLIECVNFETDEALLTGESLPIAKEASQVYPATEDTPVGDRLNLAFASSTVSK 223

Query: 497 ----------GEETKLANIIKVMK--EAQLSKAPIQGY------------ADYLASI--- 529
                     G  T++  I + +K   + +SK   + +              +L +    
Sbjct: 224 GRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAATIGSFLGTTTGT 283

Query: 530 -FVPGILILAVLTFFIWCFILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCALG 588
                +  LAVL FFI   +  I       F  N +   + IC      V +   P +L 
Sbjct: 284 PLHRKLSKLAVLLFFI-AVVFAIVVMATQKFVVNKEVAIYAIC------VAVSMIPSSLV 336

Query: 589 LATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKK 641
           +     + VG  + A   V+++  + LE   ++     DKTGTLT G M+VK+
Sbjct: 337 VVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQ 389

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 87/191 (45%), Gaps = 44/191 (23%)

Query: 756 FGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENVY------ 809
            GL  I D  ++++   V+   + G   +M+TGD    AK +A+EVGI   N+Y      
Sbjct: 642 LGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEI 701

Query: 810 -----------------------------SDVSPTGKCDLVKKIQDKEGNNKVAVVGDGI 840
                                        +  SP  K  +++ +  ++     A+ GDG+
Sbjct: 702 VDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRK--KFCAMTGDGV 759

Query: 841 NDAPALALSDLGIAIS-TGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIK 899
           ND+P+L ++++GIA+   G++++ EA+DIV      L+ ++   + NA++   +    I+
Sbjct: 760 NDSPSLKMANVGIAMGINGSDVSKEASDIV------LSDDNFASILNAVEEGRRMTDNIQ 813

Query: 900 LNLFWALCYNI 910
             +   L  N+
Sbjct: 814 KFVLQLLAENV 824

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 103/243 (42%), Gaps = 45/243 (18%)

Query: 435 DIVEIKPGMKIPAD-GIITRGESEIDESLMTGESILVPKKTGFPVIAG-----SVNGPGH 488
           DI  +K G  IPAD  +I     + DESL+TGES+ V K     ++ G     SV    +
Sbjct: 150 DICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDAN--LVFGKEEETSVGDRLN 207

Query: 489 FYFRTTTVGE--------ETKL-ANIIKVMKEAQ-----LSKAPIQGYAD--YLASIFVP 532
             F ++ V +        +T L + I K+ K  Q     +S+ P + +    ++++  V 
Sbjct: 208 LAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVT 267

Query: 533 GILI--------------LAVLTFFIWCFILNISANPPVAFTANTKADNFFICLQTATSV 578
           G  +              LAVL F+I   +  I       F  + +   + IC      V
Sbjct: 268 GAFLGTNVGTPLHRKLSKLAVLLFWI-AVLFAIIVMASQKFDVDKRVAIYAIC------V 320

Query: 579 VIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMV 638
            +   P +L +     + VG  V     V+++  + LE   ++     DKTGTLT G M+
Sbjct: 321 ALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKML 380

Query: 639 VKK 641
            ++
Sbjct: 381 ARQ 383

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 87/191 (45%), Gaps = 44/191 (23%)

Query: 756 FGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENVY------ 809
            GL  I D  ++++   V+   + G   +M+TGD    AK +A+EVGI   N+Y      
Sbjct: 642 LGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEI 701

Query: 810 -----------------------------SDVSPTGKCDLVKKIQDKEGNNKVAVVGDGI 840
                                        +  SP  K  +++ +  ++     A+ GDG+
Sbjct: 702 VDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRK--KFCAMTGDGV 759

Query: 841 NDAPALALSDLGIAIS-TGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIK 899
           ND+P+L ++++GIA+   G++++ EA+DIV      L+ ++   + NA++   +    I+
Sbjct: 760 NDSPSLKMANVGIAMGINGSDVSKEASDIV------LSDDNFASILNAVEEGRRMTDNIQ 813

Query: 900 LNLFWALCYNI 910
             +   L  N+
Sbjct: 814 KFVLQLLAENV 824

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 103/243 (42%), Gaps = 45/243 (18%)

Query: 435 DIVEIKPGMKIPAD-GIITRGESEIDESLMTGESILVPKKTGFPVIAG-----SVNGPGH 488
           DI  +K G  IPAD  +I     + DESL+TGES+ V K     ++ G     SV    +
Sbjct: 150 DICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDAN--LVFGKEEETSVGDRLN 207

Query: 489 FYFRTTTVGE--------ETKL-ANIIKVMKEAQ-----LSKAPIQGYAD--YLASIFVP 532
             F ++ V +        +T L + I K+ K  Q     +S+ P + +    ++++  V 
Sbjct: 208 LAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVT 267

Query: 533 GILI--------------LAVLTFFIWCFILNISANPPVAFTANTKADNFFICLQTATSV 578
           G  +              LAVL F+I   +  I       F  + +   + IC      V
Sbjct: 268 GAFLGTNVGTPLHRKLSKLAVLLFWI-AVLFAIIVMASQKFDVDKRVAIYAIC------V 320

Query: 579 VIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMV 638
            +   P +L +     + VG  V     V+++  + LE   ++     DKTGTLT G M+
Sbjct: 321 ALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKML 380

Query: 639 VKK 641
            ++
Sbjct: 381 ARQ 383

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 84/190 (44%), Gaps = 44/190 (23%)

Query: 757 GLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENVY------- 809
           GL  I D  + ++   V+   R G   +M+TGD    AK +A+EVGI   N+Y       
Sbjct: 638 GLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVV 697

Query: 810 ----------------------------SDVSPTGKCDLVKKIQDKEGNNKVAVVGDGIN 841
                                       +  +P  K  ++  +  +E     A+ GDG+N
Sbjct: 698 DIMVMTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRRE--KFCAMTGDGVN 755

Query: 842 DAPALALSDLGIAIS-TGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKL 900
           D+P+L  +++GIA+   G+++A +A+DIV      L+ ++   + NA++   +    I+ 
Sbjct: 756 DSPSLKKANVGIAMGINGSDVAKDASDIV------LSDDNFASILNAVEEGRRMSDNIQK 809

Query: 901 NLFWALCYNI 910
            +   L  N+
Sbjct: 810 FVLQLLAANV 819

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 117/296 (39%), Gaps = 54/296 (18%)

Query: 383 ISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPG 442
           +SIG Y E  A  +T  +L  L   +  V     DV     + +P       DIV+++ G
Sbjct: 109 VSIGAYQEYNA-CKTMNSLKDLSTPSARVIRNGEDVVMASAQVVP------GDIVQVRVG 161

Query: 443 MKIPAD-GIITRGESEIDESLMTGESILVPKKTGFPVIAGSVNGPG----HFYFRTTTVG 497
             +PAD  ++     E DE+L+TGE++ V K    P      + P     +  F ++TV 
Sbjct: 162 DTVPADLRLVEALNLETDEALLTGEALPVAKD---PAAVFEQDTPVGDRLNLAFASSTVS 218

Query: 498 EETKLANIIKVMKEAQLSK--APIQGYADYLA-------------------------SIF 530
           +      +++    +++ K    +QG    ++                         ++ 
Sbjct: 219 KGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNVG 278

Query: 531 VPGILILAVLTFFIWC----FILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCA 586
            P    LA L   ++     F L + A     F  N +   + IC      V +   P +
Sbjct: 279 TPLHRKLAKLALILFAIAVLFALIVMATQ--KFIVNREVAIYAIC------VALSMIPSS 330

Query: 587 LGLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKF 642
           L +     +  G  V +   V+++  + LE   ++     DKTGTLT G M++K+ 
Sbjct: 331 LVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQL 386

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 86/191 (45%), Gaps = 44/191 (23%)

Query: 756 FGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENVY------ 809
            GL  I D  ++++   V+   + G   +M+TGD    AK +A+EVGI   N+Y      
Sbjct: 642 LGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEI 701

Query: 810 -----------------------------SDVSPTGKCDLVKKIQDKEGNNKVAVVGDGI 840
                                        +  SP  K  +++ +  ++      + GDG+
Sbjct: 702 VDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRK--KFCTMTGDGV 759

Query: 841 NDAPALALSDLGIAIS-TGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIK 899
           ND+P+L ++++GIA+   G++++ EA+DIV      L+ ++   + NA++   +    I+
Sbjct: 760 NDSPSLKMANVGIAMGINGSDVSKEASDIV------LSDDNFASILNAVEEGRRMTDNIQ 813

Query: 900 LNLFWALCYNI 910
             +   L  N+
Sbjct: 814 KFVLQLLAENV 824

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 103/243 (42%), Gaps = 45/243 (18%)

Query: 435 DIVEIKPGMKIPAD-GIITRGESEIDESLMTGESILVPKKTGFPVIAG-----SVNGPGH 488
           DI  +K G  IPAD  +I     + DESL+TGES+ V K     ++ G     SV    +
Sbjct: 150 DICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDAN--LVFGKEEETSVGDRLN 207

Query: 489 FYFRTTTVGE--------ETKL-ANIIKVMKEAQ-----LSKAPIQGYAD--YLASIFVP 532
             F ++ V +        +T L + I K+ K  Q     +S+ P + +    ++++  V 
Sbjct: 208 LAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVT 267

Query: 533 GILI--------------LAVLTFFIWCFILNISANPPVAFTANTKADNFFICLQTATSV 578
           G  +              LAVL F+I   +  I       F  + +   + IC      V
Sbjct: 268 GAFLGTNVGTPLHRKLSKLAVLLFWI-AVLFAIIVMASQKFDVDKRVAIYAIC------V 320

Query: 579 VIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMV 638
            +   P +L +     + VG  V     V+++  + LE   ++     DKTGTLT G M+
Sbjct: 321 ALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKML 380

Query: 639 VKK 641
            ++
Sbjct: 381 ARQ 383

>Scas_297.1
          Length = 800

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 74/149 (49%), Gaps = 24/149 (16%)

Query: 768 DSYATVQYLQRN----GYETYMIT-----GDNNSAAKRVAREVGISFENVYSDVSPTGKC 818
           D+  T + + RN      ETY+I      G       +  R   +    V +  SP  K 
Sbjct: 2   DNILTARAIARNCNILSEETYLIPECAIEGPKFRTLTKQERIKMLPNLRVMARSSPEDKR 61

Query: 819 DLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAIS-TGTEIAIEAADIVILCGNDLN 877
            LV+ +  K   + VAV GDG NDAPAL L+D+G ++  +GTE+A EA+DI+++      
Sbjct: 62  LLVETL--KGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILM------ 113

Query: 878 TNSLRGLANAI------DISLKTFKRIKL 900
           T+    + +AI       IS+K F + +L
Sbjct: 114 TDDFAAIVDAIKWGRCVSISIKKFIQFQL 142

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 30/45 (66%)

Query: 428 IELLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPK 472
           I  L V DI+ ++ G  IPADG++  G+ E+DES +TGES  + K
Sbjct: 613 IHNLLVGDIITLQTGDVIPADGVLVEGQCEVDESSITGESDTIKK 657

>Scas_569.0d
          Length = 468

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 51/83 (61%), Gaps = 9/83 (10%)

Query: 808 VYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAIS-TGTEIAIEAA 866
           V +  SP  K  +++ +  ++     A+ GDG+ND+P+L ++++GIA+   G+++A +A+
Sbjct: 104 VIARCSPQTKVRMIEALHRRD--KFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDAS 161

Query: 867 DIVILCGNDLNTNSLRGLANAID 889
           DIV      L+ ++   + NAI+
Sbjct: 162 DIV------LSDDNFASILNAIE 178

>AFR567W [3759] [Homologous to ScYOR291W - SH]
           complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 67/128 (52%), Gaps = 17/128 (13%)

Query: 348 YTFSVFSLVHNMFHPSSTGKLPRIVFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQL 407
           Y F +FS++  MF            + T I IIS +S+   ++TL +++ S+   +L +L
Sbjct: 487 YIFQIFSIILWMFDAY-------YYYATCIFIISVLSV---IDTLVETKQSS--ERLSEL 534

Query: 408 TPSVCSIISDVERNE-TKEIPIELLQVNDIVEI-KPGMKI-PADGIITRGESEIDESLMT 464
           +   C +   V R+    ++P   L   DI E+  P + + P D I+  G+  ++ES++T
Sbjct: 535 SQFYCDV--RVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCLVNESMLT 592

Query: 465 GESILVPK 472
           GES+ V K
Sbjct: 593 GESVPVSK 600

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 2/50 (4%)

Query: 807  NVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAIS 856
            ++Y+ +SP  K +LV+++Q      +V   GDG ND  AL  +D+GI++S
Sbjct: 1135 SIYARMSPDEKHELVERLQSI--GYQVGFCGDGANDCGALKAADIGISLS 1182

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 749  VSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGI----- 803
            +  N    G     +++K  +  T++ L R    T M TGDN   A  V RE G+     
Sbjct: 999  IESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPR 1058

Query: 804  SFENVYSDVSPTGKCDLV 821
             F +V +D+  + + D++
Sbjct: 1059 VFVSVINDIDTSQEGDII 1076

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 25/39 (64%)

Query: 765 VKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGI 803
           +KHD+  T+Q L  + +   MITGDN   A  VA+EVGI
Sbjct: 673 LKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGI 711

 Score = 34.3 bits (77), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 808 VYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAISTGTE 860
           +Y+ VSP  K  ++  ++D     +  + GDG ND  AL  + +G+A+  GTE
Sbjct: 786 IYARVSPAQKEFILNNLKDM--GYQTLMCGDGTNDVGALKQAHVGVALLNGTE 836

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 6/82 (7%)

Query: 723 ALILEDALKKSGFINSNVDQGNTVSYVSVNGHVFGLFEI-NDEVKHDSYATVQYLQRNGY 781
           AL  +D  K S     N+D+    +     G  FG F + +  +K D+  T++ L  + +
Sbjct: 635 ALAYKDLPKMSNSQIDNIDRDEIET-----GLTFGAFLVFHCPLKDDAIETIKMLNESSH 689

Query: 782 ETYMITGDNNSAAKRVAREVGI 803
            + MITGDN   A  VA+EVGI
Sbjct: 690 RSIMITGDNPLTAVHVAKEVGI 711

 Score = 33.9 bits (76), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 808 VYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAISTGTEIAIE 864
           +Y+ VSP+ K  ++  ++D     +  + GDG ND  AL  + +GIA+  GTE +++
Sbjct: 786 IYARVSPSQKEFILITLKDM--GYQTLMCGDGTNDVGALKQAHVGIALLNGTEDSLK 840

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 39/67 (58%), Gaps = 4/67 (5%)

Query: 739 NVDQGNTVSYVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVA 798
           ++++ +  S ++ NG  F +F     +K D+  T++ L  + + + MITGDN   A  VA
Sbjct: 653 DLNRDDVESELTFNG--FLIFHC--PLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVA 708

Query: 799 REVGISF 805
           +EVGI F
Sbjct: 709 KEVGIVF 715

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 808 VYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAISTGTE 860
           VY+ VSP+ K  L+  ++D     +  + GDG ND  AL  + +GIA+  GTE
Sbjct: 788 VYARVSPSQKEFLLNTLKDM--GYQTLMCGDGTNDVGALKQAHVGIALLNGTE 838

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 51/108 (47%), Gaps = 30/108 (27%)

Query: 749  VSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENV 808
            +++ G +F +   NDE+  D Y +          T ++ G                  ++
Sbjct: 1095 LAITGDIFRILFRNDEILPDDYIS----------TVLMKG------------------SI 1126

Query: 809  YSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAIS 856
            Y+ +SP  K +LV+++Q  + N  V   GDG ND  AL  +++GI++S
Sbjct: 1127 YARMSPDEKHELVEQLQKLDYN--VGFCGDGANDCGALKAANIGISLS 1172

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 56/102 (54%), Gaps = 16/102 (15%)

Query: 377 IMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVER-----NETKEIPIELL 431
           I +IS +SI   ++T+ +++ ++   KL  ++   C +    +R     N +  +P +L 
Sbjct: 508 IFLISVLSI---IDTVIETKKNS--EKLADISHFNCEVRVYKDRFWTQVNSSDLVPGDLF 562

Query: 432 QVNDIVEIKPGMKI-PADGIITRGESEIDESLMTGESILVPK 472
           +++D     P + + P D ++  G+  ++ES++TGES+ V K
Sbjct: 563 EISD-----PSLVVLPCDAVLISGDCIVNESMLTGESVPVSK 599

>Scas_665.30
          Length = 1439

 Score = 37.7 bits (86), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 785 MITGDNNSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAP 844
           +I GD N++         +    +Y+ +SP  K +L++++Q    N  V   GDG ND  
Sbjct: 906 IIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQ--RLNYTVGFCGDGANDCG 963

Query: 845 ALALSDLGIAIS 856
           AL  +D+GI++S
Sbjct: 964 ALKAADVGISLS 975

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 92/233 (39%), Gaps = 52/233 (22%)

Query: 435 DIVEIK-PGMKI-PADGIITRGESEIDESLMTGESILVPKKTGFP-------------VI 479
           DI EI  P + + P D ++  G+  ++ES++TGES+ V K    P              I
Sbjct: 349 DIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQI 408

Query: 480 AGSVNGPGHFYFRTTTV-------GEETKLANIIKV---MKEAQLSKAPI----QGYADY 525
           +  ++    F F  TT+       G+   LA +++      +  L ++ +     G+  Y
Sbjct: 409 SSYLS--KSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFY 466

Query: 526 LASIFVPGIL-ILAVLTFFIWCFILNISANPPVAFTANTKADNFFICLQTATSVVIVACP 584
             S    G++ ++A+  F I C          + F      D   + L+    + IV  P
Sbjct: 467 EDSFKYIGVMALIALFGFSISC----------IQFI-KIGLDKRTMILRALDIITIVVPP 515

Query: 585 CALGLATPTAIMVGTGVG----AQNGVLIKGGEVLEKFNSITTFVFDKTGTLT 633
                A P  + +GTG       + G+       +     I    FDKTGTLT
Sbjct: 516 -----ALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLT 563

>Scas_583.14*
          Length = 875

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 808 VYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAISTGTEIAIEA 865
           VY+ VSP+ K  ++  +  KE   +  + GDG ND  AL  + +G+A+  GTE ++ A
Sbjct: 442 VYARVSPSQKEFILNNL--KEMGYQTLMCGDGTNDVGALKQAHVGVALLNGTEESMTA 497

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%)

Query: 765 VKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGI 803
           +K D+  T++ L  + + + MITGDN   A  VA+EV I
Sbjct: 329 LKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAI 367

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 785  MITGDNNSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAP 844
            ++  D N   +    E+ ++  ++Y+ +SP  K +L+  IQ ++ +  V   GDG ND  
Sbjct: 1137 LLFRDENEIPEEYLNEILLN-SSIYARMSPDEKHELM--IQLQKLDYTVGFCGDGANDCG 1193

Query: 845  ALALSDLGIAIS 856
            AL  +D+GI++S
Sbjct: 1194 ALKAADVGISLS 1205

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%)

Query: 749  VSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGI 803
            V  N    G     +++K ++  T++ LQ     T M TGDN   A  V RE G+
Sbjct: 1015 VESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGL 1069

>Kwal_26.9207
          Length = 1469

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 30/114 (26%)

Query: 743  GNTVSYVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVG 802
            G++   ++V G VF L   N+EV  +SY  +  L+                         
Sbjct: 1119 GSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLK------------------------- 1153

Query: 803  ISFENVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAIS 856
                ++Y+ +SP  K +LV ++Q  +    V   GDG ND  AL  +D+G+++S
Sbjct: 1154 ---SSIYARMSPDEKHELVGQLQGLD--YVVGFCGDGANDCGALKAADVGVSLS 1202

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 69/135 (51%), Gaps = 31/135 (22%)

Query: 348 YTFSVFS----LVHNMFHPSSTGKLPRIVFDTSIMIISYISIGKYLETLAKSQTSTALSK 403
           Y F +FS    L  N ++           +   I IIS +SI   ++TL +++ ++   +
Sbjct: 505 YVFQIFSILLWLADNYYY-----------YAACIFIISMLSI---IDTLVETKKTS--QR 548

Query: 404 LIQLTPSVCSI--ISD---VERNETKEIPIELLQVNDIVEIKPGMK-IPADGIITRGESE 457
           L +++ S C +    D   V+ + ++ +P ++ +++D     P +   P D ++  G+  
Sbjct: 549 LAEVSHSHCEVRVYRDGFWVQVSSSELVPGDVYEISD-----PSLSTFPCDSLLLSGDCI 603

Query: 458 IDESLMTGESILVPK 472
           ++ES++TGES+ V K
Sbjct: 604 VNESMLTGESVPVSK 618

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 807  NVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAIS 856
            ++++ +SP  K +LV+++Q  + +  V   GDG ND  AL  +D+GI++S
Sbjct: 1138 SIFARMSPDEKHELVEQLQ--KMDYTVGFCGDGANDCGALKAADVGISLS 1185

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 2/40 (5%)

Query: 435 DIVEIK-PGMKI-PADGIITRGESEIDESLMTGESILVPK 472
           DI EI  P + + P D I+  G+  ++ES++TGES+ V K
Sbjct: 561 DIYEISDPNLNLLPCDSILLSGDCIVNESMLTGESVPVSK 600

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 89/216 (41%), Gaps = 41/216 (18%)

Query: 758  LFEINDEVKHDSYATVQYLQRNGYETYMITG-DNNSAAKRV-AREVGISFENVYSD---- 811
            L  +N+E K D+   +Q  + N  E++ I+  D NS A  +  + +G + E    D    
Sbjct: 861  LLIVNEETKEDTRTNLQS-KLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLT 919

Query: 812  ------------VSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAISTGT 859
                        VSP  K  +VK ++ K  +  +A+ GDG ND   +  + +G+ IS G 
Sbjct: 920  IGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAI-GDGANDVSMIQAAHVGVGIS-GM 977

Query: 860  E--IAIEAADIVILCGNDLN-------TNSLRGLANAIDISLKTFKRIKLNLFWALCYNI 910
            E   A  +AD  I     L        + S + ++ AI  S      + +  FW +  N 
Sbjct: 978  EGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANA 1037

Query: 911  FMIPIAMGVLIPWGIT--------LPPMLAGLAMAF 938
            F       ++  W +T        +PP + G+   F
Sbjct: 1038 FS---GQSIMESWTLTFYNVFFTVMPPFVIGIFDQF 1070

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of
           the Drs2p-like family of the P-type ATPase superfamily
           of membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 614 VLEKFNSITTFVFDKTGTLTTGFMVVKKF-LKDSNWVGNVD 653
           +LE+   ++    DKTGTLT   M+ +KF L  S+W+ NVD
Sbjct: 553 ILEELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSWLHNVD 593

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%)

Query: 812  VSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAIS 856
             SP+ K  +V  I++ + N     +GDG ND   +  +D+G+ I+
Sbjct: 1203 ASPSQKALMVSNIRNTDPNLVTLAIGDGANDIAMIQSADIGVGIA 1247

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 808 VYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAISTGTE 860
           VY+ VSP  K  ++  ++D     +  + GDG ND  AL  + +GIA+  GTE
Sbjct: 789 VYARVSPAQKEFIMNSLKDM--GYQTLMCGDGTNDVGALKQAHVGIALLNGTE 839

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 765 VKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGI 803
           +K D+  T++ L  + +   MITGDN   A  VA+EV I
Sbjct: 676 LKDDAIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAI 714

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 23/115 (20%)

Query: 812  VSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAISTGTEIAIEAADIVIL 871
            VSP+ K  +VK ++D      +A+ GDG ND   +  +D+GI       IA E     ++
Sbjct: 1105 VSPSQKAAVVKLVKDSLDVMTLAI-GDGSNDVAMIQSADVGIG------IAGEEGRQAVM 1157

Query: 872  CGNDLNTNSLRGLANAIDISLK-TFKRI--------------KLNLFWALCYNIF 911
            C +D      R LA  + +  + ++KR+               L LFW   YN F
Sbjct: 1158 C-SDYAIGQFRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDF 1211

>KLLA0C08393g 734655..738101 highly similar to sp|P40527
           Saccharomyces cerevisiae YIL048w NEO1 ATPase whose
           overproduction confers neomycin resistance, start by
           similarity
          Length = 1148

 Score = 33.9 bits (76), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 5/52 (9%)

Query: 421 NETKEIPIELLQVNDIVEIKPGMKIPADGIITR-----GESEIDESLMTGES 467
           N+   IP + L+V DI+++K G ++PAD ++ +     GES I    + GE+
Sbjct: 263 NKPCPIPSKDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGET 314

>YDR440W (DOT1) [1261] chr4 (1342481..1344229) Histone H3
           methyltransferase specific for lysine 79 that is
           involved in silencing at telomeres and other repressed
           loci, required for meiotic arrest checkpoint [1749 bp,
           582 aa]
          Length = 582

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 49/93 (52%), Gaps = 4/93 (4%)

Query: 804 SFEN-VYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAISTGTEIA 862
           +F N VY ++ P    D+ ++ Q K+G+     +G G+ +    A  + G A+S G EI 
Sbjct: 366 AFSNYVYGELLPNFLSDVYQQCQLKKGDT-FMDLGSGVGNCVVQAALECGCALSFGCEIM 424

Query: 863 IEAADIVILCGNDLNTN-SLRGLA-NAIDISLK 893
            +A+D+ IL   +L     L G+  N ++ SLK
Sbjct: 425 DDASDLTILQYEELKKRCKLYGMRLNNVEFSLK 457

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
           cerevisiae YIL048w NEO1 ATPase whose overproduction
           confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 737 NSNVDQGNTVS-YVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAK 795
           N   +  NT+S Y+  +  + GL  + D+++ D  ++++ L+  G + +M+TGD    A+
Sbjct: 716 NREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETAR 775

Query: 796 RVA 798
            V+
Sbjct: 776 CVS 778

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 5/52 (9%)

Query: 421 NETKEIPIELLQVNDIVEIKPGMKIPADGIITR-----GESEIDESLMTGES 467
           N+ + +P + L+V D+++I  G +IPAD ++ +     GES I    + GE+
Sbjct: 256 NKAQLVPSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGET 307

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 31/51 (60%)

Query: 748 YVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVA 798
           ++  N  + GL  + D++++D  ++++ L+  G + +M+TGD    A+ V+
Sbjct: 727 HLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVS 777

>YBL022C (PIM1) [173] chr2 complement(177839..181240) Serine
           protease required for intramitochondrial proteolysis and
           maintenance of respiratory function, related to E. coli
           ATP-dependent protease La, member of the AAA+ family of
           putative ATPases [3402 bp, 1133 aa]
          Length = 1133

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 22/30 (73%)

Query: 196 IEISDDMHTLTIKYCCNELGIRDLLRHLER 225
           +++++D  T  +KY C E G+R+L +H+E+
Sbjct: 799 VDMTEDAITALMKYYCRESGVRNLKKHIEK 828

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 60/141 (42%), Gaps = 16/141 (11%)

Query: 812  VSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAISTGTE--IAIEAADIV 869
            VSP  K  +VK ++ K  N+ +  +GDG ND   +  + +G+ IS G E   A  +ADI 
Sbjct: 910  VSPLQKALVVKMVKRKT-NSLLLAIGDGANDVSMIQAAHVGVGIS-GMEGMQAARSADIS 967

Query: 870  ILCGNDLN-------TNSLRGLANAIDISLKTFKRIKLNLFWALCYNIF-----MIPIAM 917
            +     L          S + ++ AI  S      + +  FW +  N F     M    M
Sbjct: 968  VGQFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTM 1027

Query: 918  GVLIPWGITLPPMLAGLAMAF 938
             +   +   LPP + G+   F
Sbjct: 1028 SLYNVFFTVLPPFVIGVFDQF 1048

>Kwal_23.5789
          Length = 1133

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 736 INSNVDQGNTVS-YVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAA 794
           +N  V   N +S ++  +  + GL  + D+++ D  ++++ L+  G + +M+TGD    A
Sbjct: 703 LNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETA 762

Query: 795 KRVA 798
           + V+
Sbjct: 763 RCVS 766

>Scas_704.38
          Length = 1161

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 32/52 (61%), Gaps = 5/52 (9%)

Query: 421 NETKEIPIELLQVNDIVEIKPGMKIPADGIITR-----GESEIDESLMTGES 467
           N++K +P + L+V D+++I  G ++PAD ++ +     GE+ I    + GE+
Sbjct: 270 NQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGET 321

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 31/51 (60%)

Query: 748 YVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVA 798
           Y+  +  + GL  + D++++D  ++++ L+  G + +M+TGD    A+ V+
Sbjct: 745 YLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVS 795

>YBR275C (RIF1) [454] chr2 complement(751313..757063) Protein involved
            in telomere length regulation and transcriptional
            silencing, interacts with Rap1p [5751 bp, 1916 aa]
          Length = 1916

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 52/112 (46%), Gaps = 8/112 (7%)

Query: 798  AREVGISFENVYSDVSPTGKCDLVKKIQ-----DKEGN--NKVAVVGDGINDAPALALSD 850
            +REV ++ E +   +  +G C+L K ++     DK+ N  +    V + + D   L   +
Sbjct: 1677 SREVVMTEEGINVRLEDSGTCELNKNLKGPLKGDKDANINDDFVPVEENVRDEGFLKSME 1736

Query: 851  LGIAISTGTEIAIEAADIVILCGNDLNT-NSLRGLANAIDISLKTFKRIKLN 901
              ++  TG E   E ADI +L    +   NSL+   +   I  K  KR++ N
Sbjct: 1737 HAVSKETGLEEQPEVADISVLPEIRIPIFNSLKMQGSKSQIKEKLKKRLQRN 1788

>Scas_89.1
          Length = 271

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 31/51 (60%)

Query: 748 YVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVA 798
           ++  N  + GL  + D++++D  ++++ L+  G + +M+TGD    A+ V+
Sbjct: 30  HLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVS 80

>Scas_710.22
          Length = 1120

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 22/31 (70%)

Query: 195 SIEISDDMHTLTIKYCCNELGIRDLLRHLER 225
           ++++S+D     +KY C E G+R+L +H+E+
Sbjct: 782 NVDLSEDSVIALMKYYCRESGVRNLKKHIEK 812

>Kwal_14.2103
          Length = 1099

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 22/31 (70%)

Query: 195 SIEISDDMHTLTIKYCCNELGIRDLLRHLER 225
           +++IS++     +KY C E G+R+L +H+E+
Sbjct: 760 NVDISENAIIALMKYYCRESGVRNLKKHIEK 790

>CAGL0F07777g complement(758205..759719) similar to sp|P47771
           Saccharomyces cerevisiae YMR170c ALD5 or sp|P54114
           Saccharomyces cerevisiae YMR169c ALD4, start by
           similarity
          Length = 504

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 3/43 (6%)

Query: 784 YMITGDNNSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQD 826
           Y  T D+   A + ARE   S+ENV+  +SP  K D++ K+ D
Sbjct: 53  YAATEDDVDKAVKSARE---SYENVWFKISPAEKRDMLLKLAD 92

>Sklu_2420.8 YPL164C, Contig c2420 15797-18109
          Length = 770

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 42/83 (50%), Gaps = 13/83 (15%)

Query: 758 LFEINDEVKHDSYATVQY----------LQRNGYETYMITGDNNSAAKRVAREVGISFEN 807
           LF++++EVK D++  + Y          + ++G  + ++   N + +    +++ + F N
Sbjct: 181 LFKLHNEVKDDAFQILVYHPHIRINISTIDQSGTRSTLVNSKNITGSLTTTQKLSLCFRN 240

Query: 808 VYSDVSPTGKCDLVKKIQDKEGN 830
           V+  + P    +LVKK+  K  N
Sbjct: 241 VFGTIIPH---NLVKKVSAKYRN 260

>Scas_505.4
          Length = 1025

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 4/61 (6%)

Query: 812 VSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAISTGTE--IAIEAADIV 869
           VSP  K  +VK ++ K  +  +A+ GDG ND   +  + +G+ IS G E   A  +ADI 
Sbjct: 594 VSPLQKALVVKMVKRKTSSLLLAI-GDGANDVSMIQAAHVGVGIS-GMEGMQAARSADIA 651

Query: 870 I 870
           +
Sbjct: 652 V 652

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
           cerevisiae YMR162c, start by similarity
          Length = 1626

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 609 IKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKF-LKDSNWVGNVDED 655
           ++   +LE+   ++    DKTGTLT   M+ +K     ++WV N  +D
Sbjct: 511 VRTATILEELGQVSYIFSDKTGTLTDNKMLFRKLSFCGTSWVHNATQD 558

>Scas_669.3
          Length = 1638

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 610 KGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKF-LKDSNWVGNVD 653
           +   +LE+   ++    DKTGTLT   M+ +KF +  S+W+ + D
Sbjct: 535 RTATILEELGQVSYMFSDKTGTLTDNKMIFRKFSICGSSWLHSTD 579

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 813  SPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAISTGTE 860
            SP+ K  +V KI+  +       +GDG ND   +  +D+G+ I TG E
Sbjct: 1124 SPSQKALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGVDI-TGKE 1170

>YBR148W (YSW1) [333] chr2 (537832..539661) Protein of unknown
           function [1830 bp, 609 aa]
          Length = 609

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 60/150 (40%), Gaps = 16/150 (10%)

Query: 623 TFVFDKTGTLTTGFMVVKKFLKDS--NWVGNVDEDEVLACIKATESISDHPVSKAIIRYC 680
           T +  K  TL   F+     LK+S  + V +   D  L    + +S+ +  + + +  + 
Sbjct: 27  TGILQKNSTLRNWFLKPTADLKNSCEDRVEDDVNDVYLNDKNSQKSVEERKLGRKVRSFF 86

Query: 681 DGLNCNKALNAVVLESEYVLGKGIVSKCQVNGNTYDICIGNEALILEDALKKSG-----F 735
              N NK  + +  E + ++ K   +KC    N++DI  G+    + +++ KS      F
Sbjct: 87  KQTNSNKDESVLEDEDDALVWKKTSNKCAKKENSHDIQKGSFTKKIRNSIFKSANDVKEF 146

Query: 736 INSN---------VDQGNTVSYVSVNGHVF 756
            N N          D  N   +   N HV 
Sbjct: 147 RNENNLLLPVELSSDDENESHFTDANSHVM 176

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,868,157
Number of extensions: 1268612
Number of successful extensions: 3873
Number of sequences better than 10.0: 85
Number of HSP's gapped: 3813
Number of HSP's successfully gapped: 162
Length of query: 987
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 876
Effective length of database: 12,753,511
Effective search space: 11172075636
Effective search space used: 11172075636
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)