Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR268W (MSW1)37937320010.0
KLLA0E21923g37836512411e-171
Kwal_55.2156337236512051e-166
CAGL0M08624g33733312001e-165
ACR089C38936011271e-154
Scas_615.1037936010801e-147
Sklu_1979.431429910561e-144
Scas_502.44461911163e-06
Kwal_56.226584221911073e-05
YOL097C (WRS1)4321911065e-05
KLLA0B07733g4321911047e-05
ADR117W4261931003e-04
CAGL0I07579g425191985e-04
Sklu_2437.9472200930.002
Scas_659.23396237780.11
KLLA0F15389g397242770.16
YGR185C (TYS1)394237760.18
Scas_695.321072138760.26
Sklu_1679.2409242750.27
CAGL0H09372g392311730.49
Kwal_55.20214127570730.56
YER105C (NUP157)1391123663.9
AAL148W404237646.1
Scas_696.15693113647.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR268W
         (373 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR268W (MSW1) [1101] chr4 (1003996..1005135) Tryptophanyl-tRNA ...   775   0.0  
KLLA0E21923g 1947496..1948632 similar to sp|P04803 Saccharomyces...   482   e-171
Kwal_55.21563                                                         468   e-166
CAGL0M08624g complement(859796..860809) highly similar to sp|P04...   466   e-165
ACR089C [1136] [Homologous to ScYDR268W (MSW1) - SH] (518154..51...   438   e-154
Scas_615.10                                                           420   e-147
Sklu_1979.4 YDR268W, Contig c1979 7588-8532 reverse complement        411   e-144
Scas_502.4                                                             49   3e-06
Kwal_56.22658                                                          46   3e-05
YOL097C (WRS1) [4723] chr15 complement(136526..137824) Tryptopha...    45   5e-05
KLLA0B07733g 677879..679177 highly similar to sp|Q12109 Saccharo...    45   7e-05
ADR117W [1858] [Homologous to ScYOL097C (WRS1) - SH] complement(...    43   3e-04
CAGL0I07579g complement(730664..731941) highly similar to sp|Q12...    42   5e-04
Sklu_2437.9 YOL097C, Contig c2437 15996-17414                          40   0.002
Scas_659.23                                                            35   0.11 
KLLA0F15389g complement(1422689..1423882) highly similar to sp|P...    34   0.16 
YGR185C (TYS1) [2136] chr7 complement(866339..867523) Tyrosyl-tR...    34   0.18 
Scas_695.32                                                            34   0.26 
Sklu_1679.2 YGR185C, Contig c1679 2614-3843                            33   0.27 
CAGL0H09372g complement(918777..919955) highly similar to sp|P36...    33   0.49 
Kwal_55.20214                                                          33   0.56 
YER105C (NUP157) [1537] chr5 complement(367834..372009) Nuclear ...    30   3.9  
AAL148W [39] [Homologous to ScYGR185C (TYS1) - SH] complement(84...    29   6.1  
Scas_696.15                                                            29   7.1  

>YDR268W (MSW1) [1101] chr4 (1003996..1005135) Tryptophanyl-tRNA
           synthetase, mitochondrial, member of class I family of
           aminoacyl-tRNA synthetases [1140 bp, 379 aa]
          Length = 379

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/373 (100%), Positives = 373/373 (100%)

Query: 1   MSNKQAVLKLISKRWISTVQRADFKLNSEALHSNATVFSMIQPTGCFHLGNYLGATRVWT 60
           MSNKQAVLKLISKRWISTVQRADFKLNSEALHSNATVFSMIQPTGCFHLGNYLGATRVWT
Sbjct: 1   MSNKQAVLKLISKRWISTVQRADFKLNSEALHSNATVFSMIQPTGCFHLGNYLGATRVWT 60

Query: 61  DLCELKQPGQELIFGVADLHAITVPKPDGEMFRKFRHEAVASILAVGVDPEKASVIYQSA 120
           DLCELKQPGQELIFGVADLHAITVPKPDGEMFRKFRHEAVASILAVGVDPEKASVIYQSA
Sbjct: 61  DLCELKQPGQELIFGVADLHAITVPKPDGEMFRKFRHEAVASILAVGVDPEKASVIYQSA 120

Query: 121 IPQHSELHWLLSTLASMGLLNRMTQWKSKSNIKQSTNGDYLVNDSDVGKVRLGLFSYPVL 180
           IPQHSELHWLLSTLASMGLLNRMTQWKSKSNIKQSTNGDYLVNDSDVGKVRLGLFSYPVL
Sbjct: 121 IPQHSELHWLLSTLASMGLLNRMTQWKSKSNIKQSTNGDYLVNDSDVGKVRLGLFSYPVL 180

Query: 181 QAADILLYKSTHVPVGDDQSQHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLST 240
           QAADILLYKSTHVPVGDDQSQHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLST
Sbjct: 181 QAADILLYKSTHVPVGDDQSQHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLST 240

Query: 241 PEKKMSKSDPNHDSVIFLNDEPKAIQKKIRKALTDSISDRFYYDPVERPGVSNLINIVSG 300
           PEKKMSKSDPNHDSVIFLNDEPKAIQKKIRKALTDSISDRFYYDPVERPGVSNLINIVSG
Sbjct: 241 PEKKMSKSDPNHDSVIFLNDEPKAIQKKIRKALTDSISDRFYYDPVERPGVSNLINIVSG 300

Query: 301 IQRKSIEDVVEDVSRFNNYRDFKDYVSEVIIEELKGPRTEFEKYINEPTYLHSVVESGMR 360
           IQRKSIEDVVEDVSRFNNYRDFKDYVSEVIIEELKGPRTEFEKYINEPTYLHSVVESGMR
Sbjct: 301 IQRKSIEDVVEDVSRFNNYRDFKDYVSEVIIEELKGPRTEFEKYINEPTYLHSVVESGMR 360

Query: 361 KAREKAAKNLADI 373
           KAREKAAKNLADI
Sbjct: 361 KAREKAAKNLADI 373

>KLLA0E21923g 1947496..1948632 similar to sp|P04803 Saccharomyces
           cerevisiae YDR268w MSW1 tryptophanyl-tRNA synthetase,
           mitochondrial singleton, start by similarity
          Length = 378

 Score =  482 bits (1241), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 226/365 (61%), Positives = 286/365 (78%), Gaps = 6/365 (1%)

Query: 9   KLISKRWISTVQRADFKLNSEALHSNATVFSMIQPTGCFHLGNYLGATRVWTDLCELKQP 68
           +++ KR+ S+V+   FKL    L  NAT+FS+IQPTG FHLGNYLGA RVW D+ +LK  
Sbjct: 13  RILFKRFNSSVKTTGFKLRESDLPKNATIFSLIQPTGKFHLGNYLGAVRVWKDITDLKDD 72

Query: 69  GQELIFGVADLHAITVPKPDGEMFRKFRHEAVASILAVGVDPEKASVIYQSAIPQHSELH 128
           G  L+FG ADLHAITVPKP+ + FR +R EA+ASIL++G+DPEKA V +QS + QH+ELH
Sbjct: 73  GTTLLFGTADLHAITVPKPNAKEFRNYRIEAIASILSIGIDPEKAIVFHQSRVSQHTELH 132

Query: 129 WLLSTLASMGLLNRMTQWKSKSNIKQSTNGDYLVNDSDVGKVRLGLFSYPVLQAADILLY 188
           WLLS+LASMG LNRMTQWKSKSNI   ++      D+ +G ++LGLFSYPVLQAADILLY
Sbjct: 133 WLLSSLASMGSLNRMTQWKSKSNINDQSD------DAALGAIKLGLFSYPVLQAADILLY 186

Query: 189 KSTHVPVGDDQSQHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKS 248
           KSTHVPVGDDQSQHLELTR L+  FNK YK  +FP P T+LA TKK+LSL  PEKKMSKS
Sbjct: 187 KSTHVPVGDDQSQHLELTRQLSNTFNKFYKTKYFPMPTTILAPTKKILSLLNPEKKMSKS 246

Query: 249 DPNHDSVIFLNDEPKAIQKKIRKALTDSISDRFYYDPVERPGVSNLINIVSGIQRKSIED 308
           D N +SVI++ DEP+ I KKI++A+TDSISD FY+DPV+RPG+SNLIN +SG+QR SIED
Sbjct: 247 DTNQNSVIYITDEPEIIAKKIKRAVTDSISDSFYFDPVKRPGISNLINTLSGVQRVSIED 306

Query: 309 VVEDVSRFNNYRDFKDYVSEVIIEELKGPRTEFEKYINEPTYLHSVVESGMRKAREKAAK 368
           V +D++   +++DFK +V++V++EEL   R +F +Y+  P YLH V E G  KARE AAK
Sbjct: 307 VEKDIAHIKDHKDFKQHVTDVLVEELAPSREQFHRYMKNPDYLHKVSEDGASKAREIAAK 366

Query: 369 NLADI 373
           N+ +I
Sbjct: 367 NITEI 371

>Kwal_55.21563
          Length = 372

 Score =  468 bits (1205), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 226/365 (61%), Positives = 281/365 (76%), Gaps = 7/365 (1%)

Query: 10  LISKRWIS-TVQRADFKLNSEALHSNATVFSMIQPTGCFHLGNYLGATRVWTDLCELKQP 68
            +S R +S TV+  D+K+N+  L  NA VFSM+QPTG FHLGNYLGA RVW DLC+ K P
Sbjct: 8   FVSVRLLSKTVKTTDYKINASDLPDNAVVFSMVQPTGKFHLGNYLGAVRVWKDLCDQKAP 67

Query: 69  GQELIFGVADLHAITVPKPDGEMFRKFRHEAVASILAVGVDPEKASVIYQSAIPQHSELH 128
             +L+FGVADLHAIT+P PDG   R+ R EA+ASIL+VGVDP KA +  QS + QH+ELH
Sbjct: 68  STQLMFGVADLHAITIPIPDGMKLRQSRREAMASILSVGVDPSKAVLFNQSRVHQHTELH 127

Query: 129 WLLSTLASMGLLNRMTQWKSKSNIKQSTNGDYLVNDSDVGKVRLGLFSYPVLQAADILLY 188
           WLLSTLA MGLLNRMTQWKSKSN+K       + ++  +G V+LGLFSYPVLQAADILLY
Sbjct: 128 WLLSTLAPMGLLNRMTQWKSKSNLKN------MSDEQALGTVKLGLFSYPVLQAADILLY 181

Query: 189 KSTHVPVGDDQSQHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKS 248
           +STHVPVGDDQ+QHLELTR LA+ FNK+YK+   P P T+LA TK++LSL+  + KMSKS
Sbjct: 182 RSTHVPVGDDQAQHLELTRTLAQYFNKLYKRPILPLPTTILAPTKRILSLADIDSKMSKS 241

Query: 249 DPNHDSVIFLNDEPKAIQKKIRKALTDSISDRFYYDPVERPGVSNLINIVSGIQRKSIED 308
           D N ++ I+LNDEP +I KKIRKA+TDS S  FYYDP  RPGVSNLINIVSG+QR+SI+ 
Sbjct: 242 DQNQNATIYLNDEPDSIVKKIRKAVTDSNSKAFYYDPSSRPGVSNLINIVSGLQRQSIQQ 301

Query: 309 VVEDVSRFNNYRDFKDYVSEVIIEELKGPRTEFEKYINEPTYLHSVVESGMRKAREKAAK 368
           V +D+SRFN++ +FK YVSEV++E L+GPR  F  Y+ +P YL  V ESG   A + A K
Sbjct: 302 VEKDISRFNSHSEFKSYVSEVLVETLQGPRERFNLYMKDPDYLDKVFESGAENASKHAEK 361

Query: 369 NLADI 373
           ++ +I
Sbjct: 362 SIKEI 366

>CAGL0M08624g complement(859796..860809) highly similar to sp|P04803
           Saccharomyces cerevisiae YDR268w MSW1 tryptophanyl-tRNA
           synthetase, mitochondrial, start by similarity
          Length = 337

 Score =  466 bits (1200), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 215/333 (64%), Positives = 269/333 (80%), Gaps = 4/333 (1%)

Query: 40  MIQPTGCFHLGNYLGATRVWTDLCELKQPGQELIFGVADLHAITVPKPDGEMFRKFRHEA 99
           M+QPTG FHLGNYLGATRVW DLC++KQPGQ LIFGVADLHAIT+PKPD   F++ R EA
Sbjct: 1   MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAITIPKPDAAQFKQLRREA 60

Query: 100 VASILAVGVDPEKASVIYQSAIPQHSELHWLLSTLASMGLLNRMTQWKSKSNIKQSTNGD 159
           +ASILAVGVDP +AS++YQSAIP HS+L+WLLST+A MG LNRMTQWKSKSN+++  +  
Sbjct: 61  IASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLNRMTQWKSKSNLREDKDA- 119

Query: 160 YLVNDSDVGKVRLGLFSYPVLQAADILLYKSTHVPVGDDQSQHLELTRHLAEKFNKMYKK 219
                 ++G+V+LGLF YPVLQAADILLYK+THVPVGDDQ QHLELTR LAE FNK+YKK
Sbjct: 120 ---TAKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHLELTRTLAENFNKLYKK 176

Query: 220 NFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHDSVIFLNDEPKAIQKKIRKALTDSISD 279
             FP P T+LA TKK+LSL+   KKMSKSDPN D VI++ND P+ I +KI+KA TDSI+D
Sbjct: 177 QVFPLPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETIIRKIKKARTDSITD 236

Query: 280 RFYYDPVERPGVSNLINIVSGIQRKSIEDVVEDVSRFNNYRDFKDYVSEVIIEELKGPRT 339
           +FYYDPV RPG+SNLINIVSGI ++ +  V +++ +F+NYRD K +VSEVIIEEL+ PR 
Sbjct: 237 KFYYDPVHRPGLSNLINIVSGITKQPVHAVEQELQKFDNYRDLKAHVSEVIIEELRVPRE 296

Query: 340 EFEKYINEPTYLHSVVESGMRKAREKAAKNLAD 372
           +F +Y+ +P +L   V+ G ++A E AA  + +
Sbjct: 297 KFHQYMEDPQFLDDTVQQGTQRASEIAASTMKE 329

>ACR089C [1136] [Homologous to ScYDR268W (MSW1) - SH]
           (518154..519323) [1170 bp, 389 aa]
          Length = 389

 Score =  438 bits (1127), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 206/360 (57%), Positives = 266/360 (73%), Gaps = 7/360 (1%)

Query: 14  RWISTVQRADFKLNSEALHSNATVFSMIQPTGCFHLGNYLGATRVWTDLCELKQPGQELI 73
           R  ST+Q  D+   S  L   A VFS+IQPTG FHLGNYLGA RVWT+L E    G + I
Sbjct: 31  RKASTIQNIDYANRSLKLPDGAVVFSLIQPTGKFHLGNYLGAVRVWTELSEDAPAGGKCI 90

Query: 74  FGVADLHAITVPKPDGEMFRKFRHEAVASILAVGVDPEKASVIYQSAIPQHSELHWLLST 133
           FG ADLHAIT+PKPDG  FR+ RHEA+AS+LAVG+DP K+ + +QS +P+H+EL W LST
Sbjct: 91  FGTADLHAITIPKPDGNAFRQMRHEAIASLLAVGIDPTKSILFHQSQVPEHAELCWYLST 150

Query: 134 LASMGLLNRMTQWKSKSNIKQSTNGDYLVNDSDVGKVRLGLFSYPVLQAADILLYKSTHV 193
           L SMG LNRMTQWK+K+NIK +++         VG V+LGLF+YPVLQAAD+LLYKSTH+
Sbjct: 151 LTSMGALNRMTQWKTKANIKDTSS-------EKVGAVKLGLFTYPVLQAADVLLYKSTHI 203

Query: 194 PVGDDQSQHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHD 253
           PVG+DQ Q LELTR LA+ FN  YK  +F +P T+L  T+KVLSL  P KKMSKSD N +
Sbjct: 204 PVGEDQVQQLELTRQLAQAFNSTYKTRYFREPTTLLTPTRKVLSLQNPLKKMSKSDANQN 263

Query: 254 SVIFLNDEPKAIQKKIRKALTDSISDRFYYDPVERPGVSNLINIVSGIQRKSIEDVVEDV 313
           S I + DEP AI++KIR A+TDSI   F YDP  RPGVSNLINIV+GIQ+K+I  V  D+
Sbjct: 264 SCICVTDEPDAIRRKIRSAVTDSIGHEFKYDPEGRPGVSNLINIVAGIQKKTIAAVEADI 323

Query: 314 SRFNNYRDFKDYVSEVIIEELKGPRTEFEKYINEPTYLHSVVESGMRKAREKAAKNLADI 373
           + F ++  FK+YV+++++ EL+GPR EF +Y+N+ +Y++ V  +G  +A   AAK LA++
Sbjct: 324 AGFKDHATFKNYVTDILVAELRGPREEFARYMNDKSYIYEVERNGAERAGAIAAKTLAEV 383

>Scas_615.10
          Length = 379

 Score =  420 bits (1080), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 203/360 (56%), Positives = 265/360 (73%), Gaps = 16/360 (4%)

Query: 17  STVQRADFKLN--SEALHSNATVFSMIQPTGCFHLGNYLGATRVWTDLCELKQPGQELIF 74
            TVQ  D+ L   S+ L S+AT+FS+IQPTG FHLGNYLGATR+W  + + KQP Q  IF
Sbjct: 27  GTVQNTDYALQDISQTLPSDATIFSLIQPTGKFHLGNYLGATRIWKQISQSKQPTQTAIF 86

Query: 75  GVADLHAITVPKPDGEMFRKFRHEAVASILAVGVDPEKASVIYQSAIPQHSELHWLLSTL 134
           GVADLHAITVPKPD   F + R EA+ASIL++G+DP+ A ++YQS +PQH++LHW+LST 
Sbjct: 87  GVADLHAITVPKPDPMEFLQCRREALASILSLGIDPQNAIMMYQSEVPQHTQLHWVLSTF 146

Query: 135 ASMGLLNRMTQWKSKSNIKQSTNGDYLVNDSDVGKVRLGLFSYPVLQAADILLYKSTHVP 194
            SMG+LNRMTQWK+K+              S+   V+LGLFSYPVLQAADILLYK+THVP
Sbjct: 147 TSMGVLNRMTQWKAKAK-------------SNHMSVKLGLFSYPVLQAADILLYKATHVP 193

Query: 195 VGDDQSQHLELTRHLAEKFNKMY-KKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHD 253
           VGDDQ Q LEL R +A++FN+ Y  +NFFP P T+LA TKK+LSL  P KKMSKSDPN D
Sbjct: 194 VGDDQCQPLELCRSIAQQFNQFYGDENFFPIPRTILAPTKKILSLGDPLKKMSKSDPNKD 253

Query: 254 SVIFLNDEPKAIQKKIRKALTDSISDRFYYDPVERPGVSNLINIVSGIQRKSIEDVVEDV 313
           S I++ND    I KKIRKA+TDS++    +DPV RPGVSNL+N+VSGI ++ +  V ++V
Sbjct: 254 SNIYVNDAADVIVKKIRKAVTDSVTGPITFDPVNRPGVSNLLNMVSGITQREMSAVEQEV 313

Query: 314 SRFNNYRDFKDYVSEVIIEELKGPRTEFEKYINEPTYLHSVVESGMRKAREKAAKNLADI 373
           S  ++  +FK+YV+E+++EEL+GPR  +E+ +NEP YL  V + G  +AR  A  N+  +
Sbjct: 314 SHLSHLGEFKNYVAEIVVEELRGPRERYEQLMNEPEYLKQVGDQGAERARAIAEVNMRQV 373

>Sklu_1979.4 YDR268W, Contig c1979 7588-8532 reverse complement
          Length = 314

 Score =  411 bits (1056), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 192/299 (64%), Positives = 245/299 (81%), Gaps = 5/299 (1%)

Query: 11  ISKRWISTVQRADFKLNSEALHSNATVFSMIQPTGCFHLGNYLGATRVWTDLCELKQPGQ 70
           ISKR+++TV+  D+ L+S  +   +T+FS+IQPTG FHLGNYLGA RVW DLC+      
Sbjct: 9   ISKRFLTTVKTTDYTLHSHDIPDKSTIFSLIQPTGKFHLGNYLGAVRVWKDLCDTDLDES 68

Query: 71  ELIFGVADLHAITVPKPDGEMFRKFRHEAVASILAVGVDPEKASVIYQSAIPQHSELHWL 130
           +L+FGVADLHAIT+PKP+   FR++R EA+ASIL++G+DP+KA + +QS + QH+ELHW+
Sbjct: 69  KLLFGVADLHAITIPKPNSSEFRQYRTEAIASILSIGIDPKKAIIFHQSQVHQHAELHWI 128

Query: 131 LSTLASMGLLNRMTQWKSKSNIKQSTNGDYLVNDSDVGKVRLGLFSYPVLQAADILLYKS 190
           LST+A +G LNRMTQWKSKSN++Q  +     +   +G V+LGLF+YPVLQAADILLY S
Sbjct: 129 LSTIAPVGYLNRMTQWKSKSNLRQDAS-----DAEALGNVKLGLFAYPVLQAADILLYHS 183

Query: 191 THVPVGDDQSQHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDP 250
           THVPVGDDQSQHLELTR LA++FNK+YKK++FP P T+LA TKK+LSL++P KKMSKSD 
Sbjct: 184 THVPVGDDQSQHLELTRFLAQQFNKLYKKSYFPLPTTILAPTKKILSLASPGKKMSKSDA 243

Query: 251 NHDSVIFLNDEPKAIQKKIRKALTDSISDRFYYDPVERPGVSNLINIVSGIQRKSIEDV 309
           N +SVI+LND+P+ I KKI+KA+TDSIS  F YDP  RPGVSNLINIVSGIQR+SI +V
Sbjct: 244 NQNSVIYLNDDPETISKKIKKAVTDSISHEFKYDPENRPGVSNLINIVSGIQRRSIAEV 302

>Scas_502.4
          Length = 446

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 77/191 (40%), Gaps = 42/191 (21%)

Query: 93  RKFRHEAVASILAVGVDPEKASVIYQSAIPQHSELHWLLSTLASMGLLNRMTQWKSKSNI 152
           +KF ++    I+AVG +PE                 ++ S L  MG     T  +    I
Sbjct: 175 KKFANDNAKDIIAVGFNPENT---------------FIFSDLQYMGGGFYETVVRVSRQI 219

Query: 153 KQST-NGDYLVNDSDVGKVRLGLFSYPVLQAA--------DIL-LYKSTH--VPVGDDQS 200
             ST    +   DSD     +G F +  +Q A        D+L L   T   +P   DQ 
Sbjct: 220 TGSTAKAVFGFTDSDC----IGKFHFASIQIASAFPNSFPDVLGLPDKTQCLIPCAIDQD 275

Query: 201 QHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHDSVIFLND 260
            +  + R +AEK         F KP   L  +K   +L     KMS SD    S IF+ D
Sbjct: 276 PYFRVCRDVAEKLK-------FAKPA--LLHSKFFPALQGSTTKMSASDDT--SAIFMTD 324

Query: 261 EPKAIQKKIRK 271
            PK IQKKI K
Sbjct: 325 TPKQIQKKINK 335

>Kwal_56.22658
          Length = 422

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/191 (28%), Positives = 78/191 (40%), Gaps = 42/191 (21%)

Query: 93  RKFRHEAVASILAVGVDPEKASVIYQSAIPQHSELHWLLSTLASMGLLNRMTQWKSKSNI 152
           + F  +  + I++VG DP+K                ++ S L  MG     T  +    I
Sbjct: 153 KHFARQNASDIISVGFDPKKT---------------FIFSDLEYMGGGFYETVVRVSRQI 197

Query: 153 KQST-NGDYLVNDSDVGKVRLGLFSYPVLQAA--------DIL-LYKSTH--VPVGDDQS 200
             ST    +   DSD     +G F +  +Q A        D+L L + T   +P   DQ 
Sbjct: 198 TGSTAKAVFGFTDSDC----IGKFHFASIQIASAFPSSYPDVLGLPEKTPCLIPCAIDQD 253

Query: 201 QHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHDSVIFLND 260
            +  + R +AEK         F KP   L  +K   +L     KMS SD    + IF+ D
Sbjct: 254 PYFRVCRDVAEKLK-------FSKP--SLIHSKFFPALQGSTTKMSASDDT--TAIFMTD 302

Query: 261 EPKAIQKKIRK 271
            PK IQKKI K
Sbjct: 303 TPKQIQKKINK 313

>YOL097C (WRS1) [4723] chr15 complement(136526..137824)
           Tryptophanyl-tRNA synthetase, member of the class I
           aminoacyl tRNA synthetase family [1299 bp, 432 aa]
          Length = 432

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 73/191 (38%), Gaps = 42/191 (21%)

Query: 93  RKFRHEAVASILAVGVDPEKASVIYQSAIPQHSELHWLLSTLASMGLLNRMTQWKSKSNI 152
           + F  E    I+AVG DP+                 ++ S L  MG     T  +    I
Sbjct: 160 KNFARENAKDIIAVGFDPKNT---------------FIFSDLQYMGGAFYETVVRVSRQI 204

Query: 153 KQST-NGDYLVNDSDVGKVRLGLFSYPVLQAADILLYKSTHV-----------PVGDDQS 200
             ST    +  NDSD     +G F +  +Q A        +V           P   DQ 
Sbjct: 205 TGSTAKAVFGFNDSDC----IGKFHFASIQIATAFPSSFPNVLGLPDKTPCLIPCAIDQD 260

Query: 201 QHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHDSVIFLND 260
            +  + R +A+K         + KP  + ++    L  ST   KMS SD    + IF+ D
Sbjct: 261 PYFRVCRDVADKLK-------YSKPALLHSRFFPALQGST--TKMSASDDT--TAIFMTD 309

Query: 261 EPKAIQKKIRK 271
            PK IQKKI K
Sbjct: 310 TPKQIQKKINK 320

>KLLA0B07733g 677879..679177 highly similar to sp|Q12109
           Saccharomyces cerevisiae YOL097c WRS1 tryptophan--tRNA
           ligase singleton, start by similarity
          Length = 432

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 75/191 (39%), Gaps = 42/191 (21%)

Query: 93  RKFRHEAVASILAVGVDPEKASVIYQSAIPQHSELHWLLSTLASMGLLNRMTQWKSKSNI 152
           +KF  +    I+AVG +PEK                ++ S L  MG     T  +    I
Sbjct: 157 KKFTKDNAKDIVAVGFNPEKT---------------FIFSDLEYMGGGFYETVVRISRQI 201

Query: 153 KQST-NGDYLVNDSDVGKVRLGLFSYPVLQAA--------DILLYKS---THVPVGDDQS 200
             ST    +   DSD     +G F +  +Q A        D+L         +P   DQ 
Sbjct: 202 TGSTAKAVFGFTDSDC----IGKFHFASIQIASAFPSSFPDVLGLPDKTPCLIPCAIDQD 257

Query: 201 QHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHDSVIFLND 260
            +  + R +A+K         + KP   L  ++   +L     KMS SD    S IF+ D
Sbjct: 258 PYFRVCRDVADKLK-------YSKP--SLLHSRFFPALQGSSTKMSASDDT--SAIFMTD 306

Query: 261 EPKAIQKKIRK 271
            PK IQKKI K
Sbjct: 307 TPKQIQKKINK 317

>ADR117W [1858] [Homologous to ScYOL097C (WRS1) - SH]
           complement(911631..912911) [1281 bp, 426 aa]
          Length = 426

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 73/193 (37%), Gaps = 46/193 (23%)

Query: 93  RKFRHEAVASILAVGVDPEKASVIYQSAIPQHSELHWLLSTLASMGLLNRMTQWKSKSNI 152
           + F  E    I+AVG  PE                 ++ S L  MG     T  +    I
Sbjct: 156 KSFARENCKDIIAVGFKPENT---------------FIFSDLDYMGGGFYETVVRVSRQI 200

Query: 153 KQST-NGDYLVNDSDVGKVRLGLFSYPVLQAADILLYKSTH-------------VPVGDD 198
             ST    +   DSD     +G F +  +Q A    + S++             +P   D
Sbjct: 201 TGSTAKAVFGFTDSDC----IGKFHFASIQIASA--FPSSYPEVLGLPPKTPCLIPCAID 254

Query: 199 QSQHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHDSVIFL 258
           Q  +  + R +A+K         F KP   L  +K   +L     KMS SD    + IF+
Sbjct: 255 QDPYFRVCRDVADKLK-------FTKP--SLLHSKFFPALQGSTTKMSASDDT--TAIFM 303

Query: 259 NDEPKAIQKKIRK 271
            D PK IQKKI K
Sbjct: 304 TDTPKQIQKKINK 316

>CAGL0I07579g complement(730664..731941) highly similar to sp|Q12109
           Saccharomyces cerevisiae YOL097c WRS1 tryptophan--tRNA
           ligase, hypothetical start
          Length = 425

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 73/191 (38%), Gaps = 42/191 (21%)

Query: 93  RKFRHEAVASILAVGVDPEKASVIYQSAIPQHSELHWLLSTLASMGLLNRMTQWKSKSNI 152
           + F  E    I+AVG +PE                 ++ S L  MG        +    I
Sbjct: 156 KGFARENARDIIAVGFNPENT---------------FIFSDLEYMGGAFYENVVRVSRQI 200

Query: 153 KQST-NGDYLVNDSDVGKVRLGLFSYPVLQAA--------DILLY---KSTHVPVGDDQS 200
             ST    +   DSD     +G F +  +Q A        D+L         +P   DQ 
Sbjct: 201 TGSTAKAVFGFTDSDC----IGKFHFASIQIATAFPSSFPDVLGLPPKTPCLIPCAIDQD 256

Query: 201 QHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHDSVIFLND 260
            +  + R +A+K         + KP  + ++    L  ST   KMS SD    S IF+ D
Sbjct: 257 PYFRVCRDVADKLK-------YSKPALIHSRFFPALQGST--TKMSASDDT--SAIFMTD 305

Query: 261 EPKAIQKKIRK 271
            PK IQKKI K
Sbjct: 306 TPKQIQKKINK 316

>Sklu_2437.9 YOL097C, Contig c2437 15996-17414
          Length = 472

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 80/200 (40%), Gaps = 39/200 (19%)

Query: 80  HAITVPKPDGEMFRKFRHEAVASILAVGVDPEKASVIYQSAIPQHSELHWLLSTLASMGL 139
           H +TV     E  +K+  E    I+AVG +PE                 ++ S L  +G 
Sbjct: 195 HKLTV-----EDVKKYARENAKDIVAVGFNPENT---------------FIFSDLQYVGG 234

Query: 140 LNRMTQWKSKSNIKQST-NGDYLVNDSD-VGKVRLGLF----SYPVLQAADILLYKSTH- 192
               T  +    I  ST    +   DSD +GK+         ++P      + L   T  
Sbjct: 235 GFYETIVRVSRQITGSTAKAVFGFTDSDNIGKIHFASIQIASAFPSSFPDVLGLPNKTPC 294

Query: 193 -VPVGDDQSQHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPN 251
            +P   DQ  +  + R +A+K         F KP  + ++    L  ST   KMS SD  
Sbjct: 295 LIPCAIDQDPYFRVCRDVADKLK-------FAKPSLIHSRFFPALQGST--TKMSASDDT 345

Query: 252 HDSVIFLNDEPKAIQKKIRK 271
             + IF+ D PK IQKKI K
Sbjct: 346 --TAIFMTDTPKQIQKKINK 363

>Scas_659.23
          Length = 396

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 96/237 (40%), Gaps = 34/237 (14%)

Query: 43  PTGCFHLGNYLGATRVWTDLCELKQPGQELIFGVADLHA----ITVPKPDGEMFRKFRHE 98
           PTG  H G ++  T+    L +  + G E+   +ADLHA    +  P    +   K+   
Sbjct: 44  PTGKPHCGYFVPMTK----LADFLKAGCEVTVLLADLHAFLDNMKAPLEVVQYRAKYYEL 99

Query: 99  AVASIL-AVGVDPEKASVIYQSAIPQHSELHWLLSTLASMGLLNRMTQWKSKSNIKQSTN 157
            + +IL ++ V  EK   +  S+        + L++  ++ +  RM    S++  K++  
Sbjct: 100 TIKAILRSINVPIEKLKFVTGSS--------YQLTSDYTLDIF-RMANIVSQNEAKRA-- 148

Query: 158 GDYLVNDSDVGKVRLGLFSYPVLQAADILLYKSTHVPVGDDQSQHLELTRHLAEKFNKMY 217
           G  +V    V    L    YP++QA D           G DQ +   L     +      
Sbjct: 149 GADVV--KQVANPLLSGLIYPLMQALDEHFLDCDAQFGGVDQRKIFVLAEENLQSLGYKK 206

Query: 218 KKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHDSVIFLNDEPKAIQKKIRKALT 274
           + +     V  L Q  K          MS SDPN  S I L +EPK ++KKI  A  
Sbjct: 207 RAHLMNPMVPGLGQGGK----------MSASDPN--SKIDLLEEPKIVKKKINSAFC 251

>KLLA0F15389g complement(1422689..1423882) highly similar to
           sp|P36421 Saccharomyces cerevisiae YGR185c TYS1
           tyrosyl-tRNA synthetase singleton, start by similarity
          Length = 397

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 102/242 (42%), Gaps = 44/242 (18%)

Query: 43  PTGCFHLGNYLGATRVWTDLCELKQPGQELIFGVADLHA-ITVPKPDGEM--FRKFRHEA 99
           PTG  H G ++  T+    L +  + G E+   +ADLHA +   K   E+  +R   +E 
Sbjct: 46  PTGRPHCGYFVPMTK----LADFLKAGCEVTVLLADLHAFLDNMKASLEVVAYRAKYYEL 101

Query: 100 V--ASILAVGVDPEKASVIYQSAIPQHSELHWLLSTLASMGLLNRMTQWKSKSNIKQSTN 157
           V  A + ++ V  EK   +  S+    +E  +++          +++   S+++ K++  
Sbjct: 102 VIKAILRSINVPIEKLKFVIGSSYQTSNE--YIMDIF-------KLSNIVSQNDAKRA-- 150

Query: 158 GDYLVNDSDVGKVRLGLFSYPVLQAADILLYKSTHVPV-----GDDQSQHLELTRHLAEK 212
           G  +V    V    L    YP++QA D       H+ V     G DQ +   L     EK
Sbjct: 151 GADVV--KQVANPLLSGLIYPLMQALD-----EEHLGVDVQFGGVDQRKIFVLAEENLEK 203

Query: 213 FNKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHDSVIFLNDEPKAIQKKIRKA 272
                + +     V  L Q  K          MS SDPN  S I L +EPK ++KKI  A
Sbjct: 204 LGYKKRAHLMNPMVPGLGQGGK----------MSASDPN--SKIDLLEEPKQVKKKINSA 251

Query: 273 LT 274
             
Sbjct: 252 FC 253

>YGR185C (TYS1) [2136] chr7 complement(866339..867523) Tyrosyl-tRNA
           synthetase, cytoplasmic, charges its cognate tRNAs with
           tyrosine during protein synthesis [1185 bp, 394 aa]
          Length = 394

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 96/237 (40%), Gaps = 34/237 (14%)

Query: 43  PTGCFHLGNYLGATRVWTDLCELKQPGQELIFGVADLHA----ITVPKPDGEMFRKFRHE 98
           PTG  H G ++  T+    L +  + G E+   +ADLHA    +  P        K+   
Sbjct: 48  PTGRPHCGYFVPMTK----LADFLKAGCEVTVLLADLHAFLDNMKAPLEVVNYRAKYYEL 103

Query: 99  AVASIL-AVGVDPEKASVIYQSAIPQHSELHWLLSTLASMGLLNRMTQWKSKSNIKQSTN 157
            + +IL ++ V  EK   +  S+        + L+   +M +  R++   S+++ K++  
Sbjct: 104 TIKAILRSINVPIEKLKFVVGSS--------YQLTPDYTMDIF-RLSNIVSQNDAKRA-- 152

Query: 158 GDYLVNDSDVGKVRLGLFSYPVLQAADILLYKSTHVPVGDDQSQHLELTRHLAEKFNKMY 217
           G  +V    V    L    YP++QA D           G DQ +   L            
Sbjct: 153 GADVV--KQVANPLLSGLIYPLMQALDEQFLDVDCQFGGVDQRKIFVLAEENLPSLGYKK 210

Query: 218 KKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHDSVIFLNDEPKAIQKKIRKALT 274
           + +     V  LAQ  K          MS SDPN  S I L +EPK ++KKI  A  
Sbjct: 211 RAHLMNPMVPGLAQGGK----------MSASDPN--SKIDLLEEPKQVKKKINSAFC 255

>Scas_695.32
          Length = 1072

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 59/138 (42%), Gaps = 23/138 (16%)

Query: 55  ATRV--WTDLCELKQPG-------QELIFGVADLHAITVPKPDGEMFRKFRHE-----AV 100
           ATRV   +DLC++  P         E        H  T P    +++ K R E     A 
Sbjct: 302 ATRVDRISDLCKIIDPKDTYHNLKNETAVTDKSYHRFTTPFHIKKLYSKLRPEVYQLQAR 361

Query: 101 ASILAVGVDPEKASVI------YQSAIPQHSELHWLLSTLASMGLLNRMTQWKSKSNIKQ 154
             IL+    P   +++      YQ  + Q S L+ + S L    + ++   W+S   IK+
Sbjct: 362 NYILSTIRHPLSLTILVGNTDAYQVNLQQESRLNLVESNLLDTFVKDK---WQSPEFIKE 418

Query: 155 STNGDYLVNDSDVGKVRL 172
             N D LVN++ +GK  L
Sbjct: 419 VPNTDPLVNEAGLGKQAL 436

>Sklu_1679.2 YGR185C, Contig c1679 2614-3843
          Length = 409

 Score = 33.5 bits (75), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 99/242 (40%), Gaps = 36/242 (14%)

Query: 37  VFSMIQPTGCFHLGNYLGATRVWTDLCELKQPGQELIFGVADLHA----ITVPKPDGEMF 92
           V+    PTG  H G ++  T+    L    + G E+   +ADLHA    +  P       
Sbjct: 44  VYWGTAPTGRPHCGYFVPMTK----LAHFLKAGCEVTVLLADLHAFLDNMKAPLEVVNYR 99

Query: 93  RKFRHEAVASIL-AVGVDPEKASVIYQSAIPQHSELHWLLSTLASMGLLNRMTQWKSKSN 151
            K+    V SIL ++ V  EK   +  S+        + L    +M L  R++   S+++
Sbjct: 100 AKYYEFVVKSILKSINVPIEKLKFVVGSS--------YQLEAKYTMDLF-RLSNIVSQND 150

Query: 152 IKQSTNGDYLVNDSDVGKVRLGLFSYPVLQAADILLYKSTHVPVGD-DQSQHLELTRHLA 210
            K++  G  +V    V    L    YP++QA D   Y +  V  G  DQ +   L     
Sbjct: 151 AKRA--GADVVKQ--VSNPLLSGLIYPLMQALD-EEYLAVDVQFGGVDQRKIFVLAEENM 205

Query: 211 EKFNKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHDSVIFLNDEPKAIQKKIR 270
           +      + +     V  L Q  K          MS SDPN  S I + +EPK ++KKI 
Sbjct: 206 QALGYKKRAHLMNPMVPGLTQGGK----------MSASDPN--SKIDVLEEPKQVKKKIN 253

Query: 271 KA 272
            A
Sbjct: 254 SA 255

>CAGL0H09372g complement(918777..919955) highly similar to sp|P36421
           Saccharomyces cerevisiae YGR185c TYS1, hypothetical
           start
          Length = 392

 Score = 32.7 bits (73), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 110/311 (35%), Gaps = 70/311 (22%)

Query: 43  PTGCFHLGNYLGATRVWTDLCELKQPGQELIFGVADLHA----ITVPKPDGEMFRKFRHE 98
           PTG  H G ++  T+    L    + G E+   +ADLHA    +  P        K+   
Sbjct: 41  PTGRPHCGYFVAMTK----LAHFLKAGVEVTVLLADLHAFLDNMKAPLEVVNYRTKYYEY 96

Query: 99  AVASIL-AVGVDPEKASVIYQSAIPQHSELHWLLSTLASMGLLNRMTQWKSKSNIKQSTN 157
            V +IL ++ V  EK   +  S+     +      TL    L N ++Q     N  +   
Sbjct: 97  TVKAILKSINVPIEKLKFVVGSSYQLGGDY-----TLDLFKLSNMVSQ-----NDAKRAG 146

Query: 158 GDYLVNDSDVGKVRLGLFSYPVLQAADILLYKSTHVPVGDDQSQHLELTRHLAEKFNKMY 217
            D +     V    L    YP++QA D           G DQ +   L      +     
Sbjct: 147 ADVV---KQVANPLLSGLIYPLMQALDEQFLDVDVQFGGVDQRKIFVLAEENLPRIGYKK 203

Query: 218 KKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHDSVIFLNDEPKAIQKKIRKALTDSI 277
           + +     V  L Q  K          MS SDPN  S I L +EPK + KKI  A     
Sbjct: 204 RAHLMNPMVPGLTQGGK----------MSASDPN--SKIDLLEEPKKVGKKINSAYCS-- 249

Query: 278 SDRFYYDPVERPGVSNLINIVSGIQRKSIEDVVEDVSRFNNYRDFKDYVSEVIIEELKGP 337
                      PG               IE+        N    F +YV E  I+ELK  
Sbjct: 250 -----------PG--------------DIEN--------NGLLSFVEYVIEP-IQELKKG 275

Query: 338 RTEFEKYINEP 348
             +FE +IN P
Sbjct: 276 TGKFEFFINRP 286

>Kwal_55.20214
          Length = 1275

 Score = 32.7 bits (73), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 137 MGLLNRMTQWKSKSNIKQSTNGDYL-VNDSDVGKVRLGLFSYPVL---QAADILLYKSTH 192
           +  LN    W + +N  +S +  +L   +  V K   G+FS  V     AA  L+ K+T 
Sbjct: 129 ISTLNNTKSWSANTNGNESLDSGHLDTKNESVTKDSSGIFSSLVSAAHSAASHLMPKTTE 188

Query: 193 VPVGDDQSQH 202
            P+ DD SQH
Sbjct: 189 KPLTDDVSQH 198

>YER105C (NUP157) [1537] chr5 complement(367834..372009) Nuclear
           pore protein (nucleoporin); has similarity to Nup170p
           and mammalian Nup155p [4176 bp, 1391 aa]
          Length = 1391

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 53/123 (43%), Gaps = 24/123 (19%)

Query: 150 SNIKQSTNGDYLVNDSDVGKVRLGLFSYPVLQAADILLYKSTHVPVGDDQSQHLELTRHL 209
           +NI   T+ DY+VN   V K R G F +    +ADIL Y++          +HLE  +  
Sbjct: 873 ANIASGTSADYIVN---VLKERFGSFCH----SADILCYRA---------GEHLEAAQKF 916

Query: 210 AEKFNKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHDSVIFLNDEPKAIQKKI 269
            E  +    +N     + +  +  + + L    + +       D ++ LN +PK +   +
Sbjct: 917 -EMIDSKISRNHLDTAIDLYERCAENIELCELRRVV-------DIMVKLNYQPKTVGFLL 968

Query: 270 RKA 272
           R A
Sbjct: 969 RFA 971

>AAL148W [39] [Homologous to ScYGR185C (TYS1) - SH]
           complement(84528..85742) [1215 bp, 404 aa]
          Length = 404

 Score = 29.3 bits (64), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 99/237 (41%), Gaps = 34/237 (14%)

Query: 43  PTGCFHLGNYLGATRVWTDLCELKQPGQELIFGVADLHA-ITVPKPDGEM--FRKFRHEA 99
           PTG  H G ++  T+    L    + G E+   +ADLHA +   K   E+  +R   +E 
Sbjct: 47  PTGKPHCGYFVPMTK----LAHFLRAGCEVTVLLADLHAFLDNMKASLEVVNYRVRYYEF 102

Query: 100 V--ASILAVGVDPEKASVIYQSAIPQHSELHWLLSTLASMGLLNRMTQWKSKSNIKQSTN 157
           V  A + ++ V  EK   +  S+        +  S   +M L  RM+   S+++ K++  
Sbjct: 103 VVKAILRSINVPIEKLRFVVGSS--------YQTSAAYTMDLF-RMSNVVSQNDAKRA-- 151

Query: 158 GDYLVNDSDVGKVRLGLFSYPVLQAADILLYKSTHVPVGDDQSQHLELTRHLAEKFNKMY 217
           G  +V    V    L    YP++QA D           G DQ +   L           Y
Sbjct: 152 GADVVKQ--VSNPLLSGLLYPLMQALDEEYLGVDAQFGGVDQRKIFVLAEENMGSLG--Y 207

Query: 218 KKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHDSVIFLNDEPKAIQKKIRKALT 274
           KK        ++      L++     KMS SDPN  S I + +EPK ++KKI  A  
Sbjct: 208 KKR-----AHLMNPMVPGLTMGG---KMSASDPN--SKIDILEEPKVVKKKINTAFC 254

>Scas_696.15
          Length = 693

 Score = 29.3 bits (64), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 46/113 (40%), Gaps = 7/113 (6%)

Query: 193 VPVGDDQSQHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNH 252
           V VG   ++H       A + N+   K    +P+ M   T    +L   ++  S+     
Sbjct: 9   VEVGKAANEH-----ETAPRRNRRVAKGPLMRPIGMTCDTVYEFALECFQRGQSRKAMAW 63

Query: 253 DSVIFLNDEPKAIQKKIRKALTDSISDRFYYD--PVERPGVSNLINIVSGIQR 303
             +I +++E K + KKI    T      FYY+  P +      L +I+  I R
Sbjct: 64  RDIIDIHEEKKMVTKKINGKDTQVEKKWFYYELTPYKYNTFDELTHIMHNIGR 116

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,289,210
Number of extensions: 533831
Number of successful extensions: 1949
Number of sequences better than 10.0: 41
Number of HSP's gapped: 1981
Number of HSP's successfully gapped: 41
Length of query: 373
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 270
Effective length of database: 13,030,455
Effective search space: 3518222850
Effective search space used: 3518222850
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)