Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR267C33032516980.0
Scas_615.1134934412121e-168
CAGL0M08646g33733511781e-163
ACR091W32832611071e-152
Kwal_55.2155935131710701e-146
KLLA0E21879g33333010531e-144
Sklu_1710.12402318501e-114
Kwal_23.53514742692023e-17
Scas_631.174743171783e-14
CAGL0J03476g5171981759e-14
YCR072C5152091722e-13
YGL137W (SEC27)8892041722e-13
Kwal_23.63245141791713e-13
CAGL0I03454g3032991683e-13
Scas_679.288151471713e-13
AEL269C4551731678e-13
CAGL0J10340g3382411651e-12
AFL118W8322061671e-12
CAGL0H08932g9022031671e-12
Kwal_55.220674511711633e-12
Scas_630.66211821633e-12
Scas_624.1112052011634e-12
AGR180W8061471625e-12
AER263C5131791616e-12
Scas_720.955152451591e-11
KLLA0C08547g5152041581e-11
CAGL0E02805g8401881581e-11
CAGL0M04081g4551811572e-11
Sklu_2173.25151801572e-11
KLLA0A04928g8611831572e-11
Scas_652.163452411542e-11
AFR199C3342441543e-11
CAGL0M05335g8062121563e-11
AGR168W8251331554e-11
Scas_673.114342381535e-11
CAGL0C00737g8161721545e-11
ADR077C12041731545e-11
CAGL0J08778g2982891506e-11
YNL317W (PFS2)4651861526e-11
KLLA0B01958g8902051537e-11
YGL100W (SEH1)3492411508e-11
KLLA0E23529g8261611521e-10
KLLA0F13244g8141721492e-10
Scas_585.84601861482e-10
Kwal_47.174658001351482e-10
YFL009W (CDC4)7792311482e-10
KLLA0F04884g12121731483e-10
Scas_713.509832171474e-10
AEL246C8152611465e-10
Kwal_27.120537551711465e-10
KLLA0F10263g6822391465e-10
Kwal_56.245962941671436e-10
Sklu_2431.127492111457e-10
Scas_603.55892171447e-10
YDL145C (COP1)12011731458e-10
YLR222C (UTP13)8171601449e-10
ACR199C2951241401e-09
AFL038C3302461411e-09
YBL008W (HIR1)8401951431e-09
Kwal_23.64297502501431e-09
YLR208W (SEC13)2972881392e-09
CAGL0E00561g8361571422e-09
YBR198C (TAF5)7981711422e-09
CAGL0G09845g5002751412e-09
AGL196C9352331412e-09
Sklu_2416.54591551402e-09
Scas_674.202971631383e-09
Sklu_2160.37601311403e-09
AGL234W6291581384e-09
Scas_629.126711551385e-09
Scas_702.168162061386e-09
Scas_721.328222301386e-09
KLLA0F06754g3442461356e-09
ACR137W4252551366e-09
Kwal_27.115858231721377e-09
Kwal_27.103855361771368e-09
Kwal_23.50357442981369e-09
Scas_704.406081551359e-09
KLLA0E07073g4521701351e-08
KLLA0D16390g9362571351e-08
KLLA0F11231g4342531331e-08
Scas_592.4*3182311322e-08
YCR084C (TUP1)7131171332e-08
Scas_721.115*3182271312e-08
CAGL0L02629g7952131322e-08
YPL151C (PRP46)4512521322e-08
Kwal_23.57696271551323e-08
KLLA0C16643g3021091303e-08
Kwal_56.241637291241323e-08
Kwal_14.16113342471303e-08
KLLA0D07546g6472251314e-08
YIL046W (MET30)6401551304e-08
YLR129W (DIP2)9432161305e-08
ADL082C5691551295e-08
ADL184W4491711286e-08
Kwal_56.2452612102001289e-08
Kwal_26.75702181351231e-07
CAGL0M04279g9401651271e-07
Scas_707.227302041261e-07
CAGL0C03608g6431171261e-07
YNL006W (LST8)3032261232e-07
YCR057C (PWP2)9232651262e-07
AGL024W7562281252e-07
Scas_720.83d9152621252e-07
KLLA0E18986g9902611252e-07
Sklu_2114.211401821252e-07
CAGL0I03718g12012001252e-07
KLLA0E12287g3262201223e-07
Sklu_2420.24412721223e-07
KLLA0E04741g4591561224e-07
AER280C5102061224e-07
YBR175W (SWD3)3151871214e-07
AGR207C3201461214e-07
Kwal_27.122393161871205e-07
AAR057W9222621208e-07
Scas_465.410023091191e-06
YPR178W (PRP4)4651741181e-06
KLLA0E24508g3271851171e-06
Scas_721.73251911171e-06
KLLA0F27511g6231961182e-06
Kwal_56.2368511021771182e-06
KLLA0E21263g4291801162e-06
Scas_720.457551201162e-06
KLLA0D04840g3032281142e-06
Kwal_56.239209372411163e-06
YMR116C (ASC1)3192281143e-06
Sklu_1963.23141931133e-06
Scas_605.184242321143e-06
YKL021C (MAK11)4682651144e-06
CAGL0D02090g2771351124e-06
Scas_695.15327881134e-06
KLLA0E11297g5122381144e-06
Kwal_26.87764332811135e-06
YDR364C (CDC40)4552241135e-06
KLLA0C08976g9112591136e-06
CAGL0L00781g6731941136e-06
Kwal_14.17105742391136e-06
Kwal_23.62409131691128e-06
AFL014C5572181101e-05
YIR012W (SQT1)4312441101e-05
Kwal_27.111269962341111e-05
YLR429W (CRN1)6512421101e-05
Scas_680.11347811091e-05
Sklu_2364.45552371091e-05
CAGL0L06952g3471011082e-05
YPL183C10133231102e-05
CAGL0M02277g4271541092e-05
CAGL0G04345g7111821092e-05
ACR097W4672551082e-05
CAGL0K09284g9111841092e-05
AGR242C4192391072e-05
Sklu_2172.62631801053e-05
YDR128W11481711083e-05
CAGL0H03729g3032291053e-05
Kwal_0.2123032261053e-05
CAGL0J06512g5451481063e-05
AAL009C3031351054e-05
AER114W6331941064e-05
Scas_718.6*5462641064e-05
CAGL0M06193g3161871054e-05
KLLA0F22000g7933191056e-05
Sklu_2442.23031351036e-05
Kwal_47.175675902361046e-05
CAGL0L02761g4192531047e-05
CAGL0A00605g6401291047e-05
YOR212W (STE4)4232311037e-05
ACL116W8042821049e-05
Kwal_33.154757831521039e-05
KLLA0D02530g7071281031e-04
AER448W7142681031e-04
CAGL0F07337g6212131021e-04
ADR176W4611451021e-04
Scas_658.14421751011e-04
CAGL0L03201g5792421012e-04
KLLA0A08822g5822281012e-04
YGR200C (ELP2)7881021012e-04
KLLA0E03982g372213992e-04
ACL034W5501431002e-04
KLLA0C07513g439190993e-04
KLLA0F10791g54580993e-04
AER337W445239983e-04
YKR036C (CAF4)659298984e-04
CAGL0K00957g793196984e-04
CAGL0J04818g65485984e-04
Sklu_1645.258758974e-04
Sklu_1880.3471218974e-04
Scas_571.4601136975e-04
AFL007C551238975e-04
CAGL0L09647g429110975e-04
CAGL0C01441g1005228976e-04
KLLA0E11143g493156966e-04
Scas_558.3725174966e-04
Scas_693.36375142958e-04
Sklu_2317.3368129940.001
Scas_719.52628239940.001
KLLA0D06787g436136930.001
Scas_442.2*795116940.001
CAGL0K03861g513188930.001
KLLA0C07425g444178920.002
YMR146C (TIF34)34779920.002
Scas_692.25488243920.002
YER066W185143890.002
CAGL0J03344g54396920.002
Kwal_56.244781296216930.002
AFL056C976133930.002
Sklu_2318.1711175920.002
Sklu_2406.11426232910.002
ADR264C34681910.002
Scas_670.21595226920.002
Sklu_2435.13575126910.002
Scas_693.221145166920.003
YGL003C (CDH1)566163910.003
Kwal_55.21450503104900.003
Kwal_27.12586509192900.003
Kwal_26.8628422234900.003
Sklu_2233.280965900.003
AFL009C413108890.004
AER255C467158900.004
Kwal_27.1207041886890.004
KLLA0F19734g1133168900.004
Kwal_26.897544597890.004
CAGL0L04950g80587900.004
ADL322C501253890.004
Kwal_33.15591714132890.005
CAGL0K00275g715273880.006
AGL190W370146870.006
YGL116W (CDC20)610101880.007
KLLA0C09262g55896870.009
YDR142C (PEX7)37594860.009
Sklu_2291.4997234870.010
Kwal_55.21144570171860.010
CAGL0B03575g419216860.010
Kwal_56.23895367127850.011
YER082C (UTP7)554172850.013
ABR101C827144850.014
Scas_469.362458850.014
AAR102C591124850.014
CAGL0B01529g369136850.014
YPR137W (RRP9)573151850.016
ACR017W423175840.016
CAGL0F06853g388117840.017
Scas_700.27*433106840.018
CAGL0A02772g441157840.018
KLLA0B14410g70678840.019
Kwal_23.596255296840.019
Kwal_26.7655743184840.020
Sklu_2438.457396840.020
AGR067W1125171840.022
Scas_512.3534192830.022
KLLA0B11077g567126830.022
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR267C
         (325 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...   658   0.0  
Scas_615.11                                                           471   e-168
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...   458   e-163
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....   431   e-152
Kwal_55.21559                                                         416   e-146
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...   410   e-144
Sklu_1710.1 YDR267C, Contig c1710 17-739                              332   e-114
Kwal_23.5351                                                           82   3e-17
Scas_631.17                                                            73   3e-14
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    72   9e-14
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    71   2e-13
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    71   2e-13
Kwal_23.6324                                                           70   3e-13
CAGL0I03454g 292823..293734 similar to sp|Q04491 Saccharomyces c...    69   3e-13
Scas_679.28                                                            70   3e-13
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    69   8e-13
CAGL0J10340g complement(1008637..1009653) highly similar to sp|P...    68   1e-12
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    69   1e-12
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    69   1e-12
Kwal_55.22067                                                          67   3e-12
Scas_630.6                                                             67   3e-12
Scas_624.11                                                            67   4e-12
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    67   5e-12
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    67   6e-12
Scas_720.95                                                            66   1e-11
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    65   1e-11
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    65   1e-11
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    65   2e-11
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            65   2e-11
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    65   2e-11
Scas_652.16                                                            64   2e-11
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    64   3e-11
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    65   3e-11
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    64   4e-11
Scas_673.11                                                            64   5e-11
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    64   5e-11
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    64   5e-11
CAGL0J08778g 866175..867071 highly similar to sp|Q04491 Saccharo...    62   6e-11
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    63   6e-11
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    64   7e-11
YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in com...    62   8e-11
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    63   1e-10
KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomy...    62   2e-10
Scas_585.8                                                             62   2e-10
Kwal_47.17465                                                          62   2e-10
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...    62   2e-10
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    62   3e-10
Scas_713.50                                                            61   4e-10
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    61   5e-10
Kwal_27.12053                                                          61   5e-10
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    61   5e-10
Kwal_56.24596                                                          60   6e-10
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      60   7e-10
Scas_603.5                                                             60   7e-10
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    60   8e-10
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    60   9e-10
ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH] (698881..6...    59   1e-09
AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH] (367581..36...    59   1e-09
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    60   1e-09
Kwal_23.6429                                                           60   1e-09
YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the C...    58   2e-09
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    59   2e-09
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    59   2e-09
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    59   2e-09
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    59   2e-09
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           59   2e-09
Scas_674.20                                                            58   3e-09
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         59   3e-09
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    58   4e-09
Scas_629.12                                                            58   5e-09
Scas_702.16                                                            58   6e-09
Scas_721.32                                                            58   6e-09
KLLA0F06754g complement(650475..651509) similar to sp|P53011 Sac...    57   6e-09
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    57   6e-09
Kwal_27.11585                                                          57   7e-09
Kwal_27.10385                                                          57   8e-09
Kwal_23.5035                                                           57   9e-09
Scas_704.40                                                            57   9e-09
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    57   1e-08
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    57   1e-08
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    56   1e-08
Scas_592.4*                                                            55   2e-08
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    56   2e-08
Scas_721.115*                                                          55   2e-08
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...    55   2e-08
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    55   2e-08
Kwal_23.5769                                                           55   3e-08
KLLA0C16643g complement(1457590..1458498) highly similar to sp|Q...    55   3e-08
Kwal_56.24163                                                          55   3e-08
Kwal_14.1611                                                           55   3e-08
KLLA0D07546g complement(647984..649927) some similarities with s...    55   4e-08
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    55   4e-08
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    55   5e-08
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    54   5e-08
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    54   6e-08
Kwal_56.24526                                                          54   9e-08
Kwal_26.7570                                                           52   1e-07
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    54   1e-07
Scas_707.22                                                            53   1e-07
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    53   1e-07
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    52   2e-07
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    53   2e-07
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    53   2e-07
Scas_720.83d                                                           53   2e-07
KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomy...    53   2e-07
Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement          53   2e-07
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    53   2e-07
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    52   3e-07
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            52   3e-07
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    52   4e-07
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    52   4e-07
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    51   4e-07
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    51   4e-07
Kwal_27.12239                                                          51   5e-07
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    51   8e-07
Scas_465.4                                                             50   1e-06
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    50   1e-06
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    50   1e-06
Scas_721.7                                                             50   1e-06
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    50   2e-06
Kwal_56.23685                                                          50   2e-06
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    49   2e-06
Scas_720.45                                                            49   2e-06
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    49   2e-06
Kwal_56.23920                                                          49   3e-06
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    49   3e-06
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         48   3e-06
Scas_605.18                                                            49   3e-06
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...    49   4e-06
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    48   4e-06
Scas_695.15                                                            48   4e-06
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    49   4e-06
Kwal_26.8776                                                           48   5e-06
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    48   5e-06
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    48   6e-06
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    48   6e-06
Kwal_14.1710                                                           48   6e-06
Kwal_23.6240                                                           48   8e-06
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    47   1e-05
YIR012W (SQT1) [2677] chr9 (378483..379778) Protein that may be ...    47   1e-05
Kwal_27.11126                                                          47   1e-05
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    47   1e-05
Scas_680.11                                                            47   1e-05
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         47   1e-05
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    46   2e-05
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    47   2e-05
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    47   2e-05
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    47   2e-05
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    46   2e-05
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    47   2e-05
AGR242C [4553] [Homologous to ScYIR012W (SQT1) - SH] (1203152..1...    46   2e-05
Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement       45   3e-05
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    46   3e-05
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    45   3e-05
Kwal_0.212                                                             45   3e-05
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    45   3e-05
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    45   4e-05
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    45   4e-05
Scas_718.6*                                                            45   4e-05
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    45   4e-05
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    45   6e-05
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            44   6e-05
Kwal_47.17567                                                          45   6e-05
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    45   7e-05
CAGL0A00605g complement(67281..69203) similar to sp|P53197 Sacch...    45   7e-05
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    44   7e-05
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    45   9e-05
Kwal_33.15475                                                          44   9e-05
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    44   1e-04
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    44   1e-04
CAGL0F07337g complement(714870..716735) similar to sp|P26309 Sac...    44   1e-04
ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH] complement(...    44   1e-04
Scas_658.1                                                             44   1e-04
CAGL0L03201g complement(366795..368534) some similarities with s...    44   2e-04
KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces c...    44   2e-04
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    44   2e-04
KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces c...    43   2e-04
ACL034W [1015] [Homologous to ScYER082C (KRE31) - SH] complement...    43   2e-04
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    43   3e-04
KLLA0F10791g complement(991642..993279) similar to sp|P26309 Sac...    43   3e-04
AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH] complement(...    42   3e-04
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    42   4e-04
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    42   4e-04
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    42   4e-04
Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement          42   4e-04
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            42   4e-04
Scas_571.4                                                             42   5e-04
AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH] (424004..42...    42   5e-04
CAGL0L09647g 1032740..1034029 highly similar to sp|P35184 Saccha...    42   5e-04
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    42   6e-04
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    42   6e-04
Scas_558.3                                                             42   6e-04
Scas_693.36                                                            41   8e-04
Sklu_2317.3 YDR142C, Contig c2317 5804-6910                            41   0.001
Scas_719.52                                                            41   0.001
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    40   0.001
Scas_442.2*                                                            41   0.001
CAGL0K03861g complement(359448..360989) highly similar to sp|Q04...    40   0.001
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    40   0.002
YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translat...    40   0.002
Scas_692.25                                                            40   0.002
YER066W (YER066W) [1497] chr5 (290240..290797) Protein containin...    39   0.002
CAGL0J03344g complement(322226..323857) highly similar to sp|P40...    40   0.002
Kwal_56.24478                                                          40   0.002
AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146) [...    40   0.002
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          40   0.002
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      40   0.002
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    40   0.002
Scas_670.21                                                            40   0.002
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         40   0.002
Scas_693.22                                                            40   0.003
YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of...    40   0.003
Kwal_55.21450                                                          39   0.003
Kwal_27.12586                                                          39   0.003
Kwal_26.8628                                                           39   0.003
Sklu_2233.2 YMR049C, Contig c2233 5630-8059 reverse complement         39   0.003
AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248) [...    39   0.004
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    39   0.004
Kwal_27.12070                                                          39   0.004
KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomy...    39   0.004
Kwal_26.8975                                                           39   0.004
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    39   0.004
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    39   0.004
Kwal_33.15591                                                          39   0.005
CAGL0K00275g complement(25300..27447) similar to sp|P36037 Sacch...    39   0.006
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    38   0.006
YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anapha...    39   0.007
KLLA0C09262g 805512..807188 similar to sp|P40055 Saccharomyces c...    38   0.009
YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal...    38   0.009
Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement         38   0.010
Kwal_55.21144                                                          38   0.010
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    38   0.010
Kwal_56.23895                                                          37   0.011
YER082C (UTP7) [1514] chr5 complement(324268..325932) Component ...    37   0.013
ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH] (567357..569...    37   0.014
Scas_469.3                                                             37   0.014
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    37   0.014
CAGL0B01529g 137174..138283 highly similar to sp|P39108 Saccharo...    37   0.014
YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component o...    37   0.016
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    37   0.016
CAGL0F06853g 671942..673108 highly similar to sp|P20484 Saccharo...    37   0.017
Scas_700.27*                                                           37   0.018
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    37   0.018
KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces...    37   0.019
Kwal_23.5962                                                           37   0.019
Kwal_26.7655                                                           37   0.020
Sklu_2438.4 YER082C, Contig c2438 8089-9810 reverse complement         37   0.020
AGR067W [4377] [Homologous to ScYDR128W - SH] complement(842182....    37   0.022
Scas_512.3                                                             37   0.022
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    37   0.022
Kwal_33.15136                                                          37   0.023
KLLA0F17237g 1577197..1578768 similar to sp|Q04225 Saccharomyces...    36   0.029
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    36   0.030
Scas_705.2                                                             36   0.030
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    36   0.036
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    36   0.036
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    36   0.038
Scas_692.29                                                            36   0.038
Kwal_47.17572                                                          36   0.040
CAGL0K07095g 698028..699143 highly similar to sp|P38328 Saccharo...    35   0.045
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    35   0.047
YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associa...    35   0.049
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    35   0.056
Scas_659.9                                                             35   0.057
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    35   0.058
ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH] complement...    35   0.058
YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein w...    35   0.059
Sklu_1048.1 YIR012W, Contig c1048 895-2196                             35   0.061
Kwal_55.22076                                                          35   0.074
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    35   0.075
CAGL0I03542g 299881..301485 similar to tr|Q12510 Saccharomyces c...    35   0.076
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    35   0.078
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    35   0.079
YMR131C (RRB1) [4088] chr13 complement(533162..534697) Protein i...    35   0.086
Scas_706.24                                                            35   0.088
Scas_719.7*                                                            35   0.088
Sklu_1513.2 YGL190C, Contig c1513 930-2276                             35   0.089
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    35   0.092
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    35   0.10 
YBR234C (ARC40) [413] chr2 complement(685395..686549) Component ...    34   0.11 
ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1...    35   0.11 
Kwal_33.14971                                                          35   0.11 
CAGL0G00704g 65805..67127 similar to sp|P39706 Saccharomyces cer...    34   0.12 
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    34   0.12 
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...    35   0.12 
Scas_649.10                                                            34   0.14 
YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin a...    34   0.15 
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    34   0.15 
Scas_684.7                                                             34   0.15 
Scas_711.11                                                            34   0.16 
AAL119W [68] [Homologous to ScYFR021W (AUT10) - SH] complement(1...    34   0.19 
AER439W [2939] [Homologous to ScYGL213C (SKI8) - SH] complement(...    33   0.22 
Kwal_33.13515                                                          33   0.28 
Scas_701.22                                                            33   0.28 
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    33   0.28 
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    33   0.30 
Kwal_27.12667                                                          33   0.30 
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    33   0.31 
Scas_712.34                                                            33   0.32 
KLLA0A08800g 770989..772308 similar to sp|P39706 Saccharomyces c...    33   0.36 
KLLA0D06677g complement(574289..576844) similar to sgd|S0006047 ...    33   0.37 
CAGL0D01826g 189933..197933 similar to sp|P33892 Saccharomyces c...    33   0.38 
Kwal_47.17555                                                          33   0.38 
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    33   0.40 
Kwal_34.15818                                                          32   0.46 
AFR195W [3387] [Homologous to ScYGL190C (CDC55) - SH] complement...    32   0.48 
Sklu_2133.4 YBR234C, Contig c2133 6409-7530                            32   0.49 
CAGL0J07854g complement(765463..766761) similar to sp|P53851 Sac...    32   0.52 
YGL190C (CDC55) [1803] chr7 complement(145813..147393) Protein s...    32   0.63 
Scas_652.7                                                             32   0.64 
YEL056W (HAT2) [1372] chr5 (47168..48373) Histone acetyltransfer...    32   0.65 
Scas_685.11                                                            32   0.70 
Sklu_2364.5 YAR003W, Contig c2364 9220-10515 reverse complement        32   0.70 
Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement         32   0.71 
YDL156W (YDL156W) [714] chr4 (174919..176487) Protein containing...    32   0.73 
YMR092C (AIP1) [4050] chr13 complement(451631..453478) Actin int...    32   0.82 
ADR242C [1983] [Homologous to ScYMR131C (RRB1) - SH] (1126443..1...    32   0.91 
KLLA0F13750g complement(1274110..1275972) similar to sp|P46680 S...    32   1.0  
YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and ...    31   1.0  
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         32   1.0  
Scas_607.8                                                             31   1.0  
Kwal_33.13148                                                          32   1.1  
KLLA0D00814g complement(76687..77913) similar to sp|P39984 Sacch...    31   1.1  
KLLA0C02849g 255963..257285 some similarities with sp|P53851 Sac...    31   1.1  
Scas_595.3*                                                            31   1.3  
AFL022W [3171] [Homologous to ScYBR234C (ARC40) - SH] complement...    31   1.3  
CAGL0M01430g 164428..166683 highly similar to tr|Q06679 Saccharo...    31   1.3  
KLLA0D04664g 397818..399320 similar to sp|P43601 Saccharomyces c...    31   1.4  
AFR715C [3908] [Homologous to ScYCL039W - SH] (1752847..1754997)...    31   1.4  
Sklu_2113.2 YCL039W, Contig c2113 2538-4865                            31   1.4  
KLLA0E15972g 1419922..1420941 weakly similar to sp|P50079 Saccha...    31   1.4  
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    31   1.5  
KLLA0C01177g 89978..92131 weakly similar to sp|P25569 Saccharomy...    31   1.6  
AFL006C [3187] [Homologous to ScYAR003W (SWD1) - SH] (425925..42...    31   1.8  
CAGL0M05291g complement(566250..567509) similar to sp|P13712 Sac...    30   1.8  
KLLA0F09053g 842591..843949 similar to sp|Q00362 Saccharomyces c...    30   1.9  
KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces c...    31   2.1  
Kwal_34.16089                                                          30   2.1  
Scas_699.5                                                             30   2.2  
Scas_711.46                                                            30   2.2  
KLLA0F10615g 978492..979604 similar to sp|P38328 Saccharomyces c...    30   2.2  
AFR634W [3826] [Homologous to ScYNL253W - SH] complement(1593772...    30   2.2  
CAGL0J03564g 338044..341133 similar to sp|P25365 Saccharomyces c...    30   2.2  
Scas_719.30                                                            30   2.3  
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    30   2.3  
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    30   2.6  
CAGL0I07073g complement(681102..682283) similar to sp|Q02793 Sac...    30   2.6  
Scas_701.45                                                            30   2.9  
Kwal_27.10785                                                          30   3.7  
ADL186C [1555] [Homologous to ScYOL138C - SH] (369322..373407) [...    30   3.8  
Kwal_14.884                                                            30   4.0  
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...    29   4.0  
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    30   4.0  
CAGL0J11286g 1095788..1097374 similar to sp|P53877 Saccharomyces...    30   4.2  
Kwal_14.1675                                                           29   4.4  
Sklu_675.1 YMR146C, Contig c675 761-1687                               29   4.4  
Scas_636.4                                                             30   4.5  
Scas_544.4                                                             29   4.7  
Scas_642.1                                                             29   5.0  
YGL092W (NUP145) [1891] chr7 (337907..341860) Nuclear pore prote...    29   5.0  
Sklu_1659.2 YMR092C, Contig c1659 410-2251                             29   5.1  
KLLA0E08415g 759718..760986 similar to sp|P53962 Saccharomyces c...    29   5.1  
CAGL0J08998g 882655..886500 highly similar to sp|P38968 Saccharo...    29   5.3  
Sklu_2251.5 YNL032W, Contig c2251 2992-3792 reverse complement         29   5.4  
Kwal_47.17827                                                          29   5.5  
Scas_660.7*                                                            29   5.8  
Kwal_14.2508                                                           29   5.9  
Scas_670.22                                                            29   6.0  
YNR058W (BIO3) [4641] chr14 (734288..735730) DAPA aminotransfera...    29   6.6  
KLLA0C16533g complement(1448866..1450404) similar to sgd|S000231...    29   6.7  
Sklu_2431.8 YBR195C, Contig c2431 12732-14009 reverse complement       29   6.7  
CAGL0E01485g complement(138830..142840) similar to tr|Q08281 Sac...    29   6.9  
Scas_721.29                                                            29   7.1  
CAGL0D04884g 475678..477369 highly similar to tr|Q06506 Saccharo...    29   7.1  
KLLA0A01650g complement(146030..147235) similar to sp|Q02793 Sac...    28   7.1  
ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH] com...    29   7.1  
CAGL0J03806g 361174..362436 similar to sp|Q12363 Saccharomyces c...    29   7.2  
Kwal_56.23035                                                          28   7.7  
Scas_397.2                                                             28   7.7  
CAGL0M02563g complement(295156..296529) weakly similar to sp|Q03...    28   8.2  
Kwal_47.19083                                                          28   8.7  
CAGL0J01287g 120215..122047 similar to sp|P46680 Saccharomyces c...    28   8.9  
Sklu_2423.1 YLR409C, Contig c2423 869-3703                             28   8.9  
AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH] (137221..13...    28   9.2  
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    28   9.3  
AER035W [2540] [Homologous to ScYOL087C - SH] complement(699524....    28   9.7  

>YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Protein
           containing seven WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to WD40 protein Ciao1 (human CIAO1), which
           binds and inhibits Wilms tumor suppressor protein (human
           WT1) transactivation activity [993 bp, 330 aa]
          Length = 330

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/325 (100%), Positives = 325/325 (100%)

Query: 1   MASINLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKA 60
           MASINLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKA
Sbjct: 1   MASINLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKA 60

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120
           IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY
Sbjct: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
           YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW
Sbjct: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180

Query: 181 KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWV 240
           KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWV
Sbjct: 181 KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWV 240

Query: 241 CEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEWKVFAKRALCHGVYEINV 300
           CEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEWKVFAKRALCHGVYEINV
Sbjct: 241 CEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEWKVFAKRALCHGVYEINV 300

Query: 301 VKWLELNGKTILATGGDDGIVNFWS 325
           VKWLELNGKTILATGGDDGIVNFWS
Sbjct: 301 VKWLELNGKTILATGGDDGIVNFWS 325

>Scas_615.11
          Length = 349

 Score =  471 bits (1212), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 232/344 (67%), Positives = 274/344 (79%), Gaps = 22/344 (6%)

Query: 4   INLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSV---KYDDFTLIDVLDETAHKKA 60
           I L KSLKL  +K+WS D+S G+LATGSTDRKIK+++V        +L+DVLD+T HKKA
Sbjct: 3   IKLAKSLKLQNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKA 62

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEES------------ADRTFEMDLLAIIEGHEN 108
           IR VAWRPH++LLAAGSFDSTVSIW +E+                + EMDLLAIIEGHEN
Sbjct: 63  IRCVAWRPHSNLLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIEGHEN 122

Query: 109 EVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALL 168
           EVKG+AWS+DG  L++CSRDKSVWIWETD+ GEEYECISVLQEHSQDVKHV+WHP   LL
Sbjct: 123 EVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLL 182

Query: 169 ASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEG--VFRLCSGSDDSTVRVW 226
           ASSSYDDT+R+WKDYDDDWEC AVLNGHEGTVW SDF+K +     RLCSGSDDSTVRVW
Sbjct: 183 ASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242

Query: 227 KYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDG----- 281
           +Y+ DDED QQEW+CEAILP VH RQ+Y+V+W  NGLIAS G+DG LAVY+EV       
Sbjct: 243 RYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDDEH 302

Query: 282 EWKVFAKRALCHGVYEINVVKWLELNGKTILATGGDDGIVNFWS 325
           +W+V AK+ LCHGVYE N+VKW+++NG  +LATGGDDG VN W+
Sbjct: 303 DWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLWN 346

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score =  458 bits (1178), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 228/335 (68%), Positives = 263/335 (78%), Gaps = 14/335 (4%)

Query: 3   SINLIKSLKLYKEKIWSFDFS--QGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKA 60
            + L KSLKL+ +K+WS DF   +G+LATGSTDR IK++ +K     L+DVLD+T HKKA
Sbjct: 2   PLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKA 61

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAK-----EESADRTFEMDLLAIIEGHENEVKGVAW 115
           +RSVAWRPH+ LLAAGSFDST+SIW +     EE A    EM+LLAIIEGHENEVKG++W
Sbjct: 62  VRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGA--KLEMELLAIIEGHENEVKGISW 119

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
           S DG  LATCSRDKSVWIWETDE+GEEYECISVLQEHSQDVKHV+WH    LLASSSYDD
Sbjct: 120 SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDD 179

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDD 235
           TVRIWKDYDDDWEC AVL GHEGT+W SDF K E   RLCSGSDDSTVRVWKY+GDDEDD
Sbjct: 180 TVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDD 239

Query: 236 QQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDG-----EWKVFAKRA 290
           QQEWVCE+ LP+ H+ Q+Y VAW  +G IASVGADGVLAVY+E        EW++ A   
Sbjct: 240 QQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSEWEISATYK 299

Query: 291 LCHGVYEINVVKWLELNGKTILATGGDDGIVNFWS 325
             H VYEIN VKW+ ++GK +L T GDDG VN W+
Sbjct: 300 AAHTVYEINTVKWVNIDGKEMLITAGDDGRVNLWN 334

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score =  431 bits (1107), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 213/326 (65%), Positives = 263/326 (80%), Gaps = 5/326 (1%)

Query: 1   MASINLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKA 60
           M +++L++SLKL+ ++ WS D S+G+LATGS DRKIKLV V+  +F L++ LD+TAHKKA
Sbjct: 1   MPNLHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVR--NFKLVEELDDTAHKKA 58

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120
           +RSVAWRPH ++LAAGSFD+TVSIW +++  D + E +LLA+IEGHENEVK VAWS+DG 
Sbjct: 59  VRSVAWRPHCNVLAAGSFDTTVSIWGRDDD-DYSGETELLAVIEGHENEVKSVAWSHDGA 117

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
           YLATCSRDKSVWIWE DE  EE+EC SVLQEHSQDVKH++WH S  LLASSSYDDTVRIW
Sbjct: 118 YLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177

Query: 181 KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDD-QQEW 239
            + DDDWEC AVL+GH GTVW SDF++ E   RLCSGSDD+TVR+W+ + DD D   +EW
Sbjct: 178 AEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEW 237

Query: 240 VCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVD-GEWKVFAKRALCHGVYEI 298
           + E +LP VH R VY+V+W  +GLIASVG+DGVLAVY+EV  G W+V A+    H VYEI
Sbjct: 238 IQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEI 297

Query: 299 NVVKWLELNGKTILATGGDDGIVNFW 324
           NVVKWL L+G+ +L TGGDDG VN W
Sbjct: 298 NVVKWLALDGRVLLVTGGDDGCVNVW 323

>Kwal_55.21559
          Length = 351

 Score =  416 bits (1070), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 201/317 (63%), Positives = 253/317 (79%), Gaps = 4/317 (1%)

Query: 13  YKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSL 72
           + +K+WS D S+G++AT S+DRKIKLV++K  DF L++ LD++ HKK++RSV++RPH+S+
Sbjct: 32  HTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSI 91

Query: 73  LAAGSFDSTVSIWAKEESADRT---FEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDK 129
           LAAGSFDST+SIW KEE AD      E +LLAIIEGHENEVK V+WS+ GYYLA+CSRDK
Sbjct: 92  LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDK 151

Query: 130 SVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWEC 189
           SVWIWE DE GEEYEC+SVLQEH+QDVKHV+WH    LLASSSYDDT+R+WK+  DDWEC
Sbjct: 152 SVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWEC 211

Query: 190 VAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVH 249
            AVLNGH+GTVW SDF+K+E   RL S SDDSTVRVW Y+ ++E+ +  W  EAILP+VH
Sbjct: 212 AAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVH 271

Query: 250 KRQVYNVAWGFNGLIASVGADGVLAVYEEV-DGEWKVFAKRALCHGVYEINVVKWLELNG 308
            R VY+V+W  +G IASVG+DG+L VY+EV  GEW+V  ++   HG+YEINVVKW  ++ 
Sbjct: 272 SRAVYSVSWSLDGYIASVGSDGLLVVYKEVKKGEWEVVVQQHEAHGIYEINVVKWATVDD 331

Query: 309 KTILATGGDDGIVNFWS 325
             +L TGGDDG  N WS
Sbjct: 332 SVLLLTGGDDGCANIWS 348

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score =  410 bits (1053), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 211/330 (63%), Positives = 249/330 (75%), Gaps = 8/330 (2%)

Query: 1   MASINLIKSLKLYKEKIWSFDFSQG-ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKK 59
           MA + L+KSL L+ +K WS D + G I+ATGSTDRKIKLV ++   F +I+ LD+TAHKK
Sbjct: 1   MAGLKLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIR--SFQIIEELDDTAHKK 58

Query: 60  AIRSVAWRPHTSLLAAGSFDSTVSIWAKEESA---DRTFEMDLLAIIEGHENEVKGVAWS 116
            +RSVAWRPH+++LAAGSFDSTVSIW K++     +   E +LLAIIEGHENE+K VAWS
Sbjct: 59  TVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWS 118

Query: 117 NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDT 176
           +DG  LATCSRDKSVWIWE DE GEE+ECISVLQEHSQDVKHVIWH S  LLASSSYDDT
Sbjct: 119 HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDT 178

Query: 177 VRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQ 236
           VRIWKD DDDWEC AVLNGHEGTVWSSDF+K+    RLCSGSDD TVR+W    D+ + +
Sbjct: 179 VRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYE 238

Query: 237 QEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEWKVFAKRALCHGVY 296
           QEW+ E+ILP  H R VY+V W   G IAS G+DG L +Y+E +  W V     L HGVY
Sbjct: 239 QEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVY 298

Query: 297 EINVVKWLELNGK--TILATGGDDGIVNFW 324
           E N+VKW+E   K   +L T GDDG VN W
Sbjct: 299 ETNMVKWVEYGSKDVILLITAGDDGHVNVW 328

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/233 (30%), Positives = 111/233 (47%), Gaps = 41/233 (17%)

Query: 18  WSFDFSQGILATGSTDRKIKL--VSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAA 75
           WS D    +LAT S D+ + +       ++F  I VL E  H + ++ V W     LLA+
Sbjct: 117 WSHDGE--LLATCSRDKSVWIWEADEMGEEFECISVLQE--HSQDVKHVIWHQSLPLLAS 172

Query: 76  GSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSND------GYYLATCSRDK 129
            S+D TV IW      D   + +  A++ GHE    G  WS+D         L + S D 
Sbjct: 173 SSYDDTVRIWK-----DCDDDWECCAVLNGHE----GTVWSSDFEKSNSNVRLCSGSDDG 223

Query: 130 SVWIWETDESGEEYECI----SVLQE-HSQDVKHVIWHPSEALLASSSYDDTVRIWKDYD 184
           +V IW  ++   EYE      S+L + H++ V  V W P +  +AS+  D  + I+K+ +
Sbjct: 224 TVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSP-KGYIASTGSDGRLVIYKESE 282

Query: 185 DDW--ECVAVLNGHEGT--VWSSDFDK-----TEGVFRLCSGSDDSTVRVWKY 228
           D W  EC+     HE T  V+ ++  K     ++ V  L +  DD  V VWK+
Sbjct: 283 DGWIVECI-----HELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVWKF 330

>Sklu_1710.1 YDR267C, Contig c1710 17-739
          Length = 240

 Score =  332 bits (850), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 194/231 (83%), Gaps = 1/231 (0%)

Query: 95  FEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQ 154
            E +LLAI+EGHENEVK V+WS+ GYYLATCSRDKSVWIWE DE GEE+ECISVLQEHSQ
Sbjct: 7   METELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQ 66

Query: 155 DVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRL 214
           DVKHV+WH   +LLASSSYDDT+RIWKD+DDDW+C AVLNGHEGTVW SDF+K+E   RL
Sbjct: 67  DVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRL 126

Query: 215 CSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLA 274
           CSGSDD+TVR+WKY+ D+EDD+Q W  +++LP  H R VY+V+W   GLIAS G+DG+LA
Sbjct: 127 CSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLA 186

Query: 275 VYEEV-DGEWKVFAKRALCHGVYEINVVKWLELNGKTILATGGDDGIVNFW 324
           +Y+E  +G+W++ A+  L HGVYE NVVKW +++G+T+L TGGDDG VN W
Sbjct: 187 IYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237

 Score = 55.5 bits (132), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 105/225 (46%), Gaps = 28/225 (12%)

Query: 19  SFDFSQGILATGSTDRKIKLVSVKY--DDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAG 76
           S+  S   LAT S D+ + +       ++F  I VL E  H + ++ V W    SLLA+ 
Sbjct: 26  SWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQE--HSQDVKHVVWHSVLSLLASS 83

Query: 77  SFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSND------GYYLATCSRDKS 130
           S+D T+ IW      D   +    A++ GHE    G  W +D         L + S D +
Sbjct: 84  SYDDTIRIW-----KDFDDDWQCAAVLNGHE----GTVWCSDFEKSESSLRLCSGSDDTT 134

Query: 131 VWIWETDESGEEYECISVLQE-----HSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDD 185
           V IW+  E  E+ E +  LQ      HS+ V  V W P+  L+AS+  D  + I+++ ++
Sbjct: 135 VRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPT-GLIASTGSDGLLAIYQEKEE 193

Query: 186 -DWECVAVLNGHEGTVWSS--DFDKTEGVFRLCSGSDDSTVRVWK 227
             WE +A      G   ++   + + +G   L +G DD  V +WK
Sbjct: 194 GKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIWK 238

>Kwal_23.5351
          Length = 474

 Score = 82.4 bits (202), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 78/269 (28%), Positives = 128/269 (47%), Gaps = 30/269 (11%)

Query: 59  KAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEG-HENEVKGVAWSN 117
           + +  VA  P  + LAAGS++  V I   +        ++++  ++G H++++ GVAWS+
Sbjct: 183 RPVSQVARSPDGASLAAGSWNGDVKILHPQS-------LEVVRSLDGAHDDKIGGVAWSS 235

Query: 118 DGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTV 177
           D   LAT   D  V IW             VL+ H   V  V +HPS+  +AS+S+D T 
Sbjct: 236 DSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTW 295

Query: 178 RIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQ 237
           R+W D + + E + +  GH   V+  DF + +G   LCS   DS   VW    D    + 
Sbjct: 296 RLW-DVERETE-LQLQEGHAKEVYCLDF-QCDGSL-LCSAGLDSVGHVW----DMRTGRS 347

Query: 238 EWVCEAILPDVHKRQVYNVAWGFNG-LIASVGADGVLAVYE--EVDGEWKVFAKRALCHG 294
             V E      H + +Y V+W  NG  +A+   DG + V++  + +    + A  ++   
Sbjct: 348 LMVLEG-----HAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILAHNSI--- 399

Query: 295 VYEINVVKWLELNGKTILATGGDDGIVNF 323
           V E+N  K    NG  ++++  D  I  F
Sbjct: 400 VSEVNFEKE---NGNFLVSSSYDRTIGVF 425

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/257 (21%), Positives = 98/257 (38%), Gaps = 81/257 (31%)

Query: 3   SINLIKSLK-LYKEKI----WSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAH 57
           S+ +++SL   + +KI    WS D SQ +LATG  D  +K+ + +    +    +    H
Sbjct: 213 SLEVVRSLDGAHDDKIGGVAWSSD-SQ-LLATGGADNLVKIWNPQAQSHSEASRVVLRGH 270

Query: 58  KKAIRSVAWRPHTSLLAAGSFDSTVSIW---------AKEESADRTFEMDL--------- 99
           +  +  V + P    +A+ SFD T  +W          +E  A   + +D          
Sbjct: 271 EARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCS 330

Query: 100 -----------------LAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEE 142
                            L ++EGH   + GV+WS +G+++AT S D +V +W+  ++ + 
Sbjct: 331 AGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKP 390

Query: 143 YECIS---------------------------------------VLQEHSQDVKHVIWHP 163
              ++                                        LQ H+  +  V    
Sbjct: 391 SSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIKLASLQGHTDKILSVDISR 450

Query: 164 SEALLASSSYDDTVRIW 180
             A L SS +D +V+IW
Sbjct: 451 GGANLWSSGWDRSVKIW 467

>Scas_631.17
          Length = 474

 Score = 73.2 bits (178), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 81/317 (25%), Positives = 145/317 (45%), Gaps = 37/317 (11%)

Query: 7   IKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAW 66
           +K L+  KE+  +FD  + I      ++ ++ + +         V  +    + I  V  
Sbjct: 144 MKRLQSMKERALNFDIGKEINTRRQLNQHLEKMQL---------VGSQIVSIRPISKVCL 194

Query: 67  RPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIE-GHENEVKGVAWSNDGYYLATC 125
               +L A GS       WA +     T  +D+++ IE GH+ ++ G+AW++   +L + 
Sbjct: 195 MSDNALCATGS-------WAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSG 247

Query: 126 SRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDD 185
           + D  V I   D   +  + ++ LQ H+  V +V +HPS   +AS+S+D T R+W D + 
Sbjct: 248 ADDCLVKIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLW-DIES 306

Query: 186 DWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAIL 245
           + E +    GH   V+S  F + +G   LCSG  D+   VW               ++I+
Sbjct: 307 ETE-LQFQEGHGKEVYSLSF-QNDGAL-LCSGGLDNAAIVWDVR----------TGKSIM 353

Query: 246 P-DVHKRQVYNVAWGFNGL-IASVGADGVLAVYEEVDGEWKVFAKRALCHGVYEINVVKW 303
               H + +Y+V W  +G  IA+ G DGV+ ++   D        R L H    +  V++
Sbjct: 354 NLQGHAKPIYSVDWSPDGYHIATGGGDGVINIW---DIRKTTETTRLLAHNNI-VTGVRF 409

Query: 304 LELNGKTILATGGDDGI 320
            +  G  +++ G D  I
Sbjct: 410 QKSTGHCLVSCGYDKQI 426

 Score = 59.7 bits (143), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 79/175 (45%), Gaps = 16/175 (9%)

Query: 54  ETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGV 113
           +  H K + S++++   +LL +G  D+   +W              +  ++GH   +  V
Sbjct: 313 QEGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKS-------IMNLQGHAKPIYSV 365

Query: 114 AWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA-LLASSS 172
            WS DGY++AT   D  + IW+  ++ E    ++    H+  V  V +  S    L S  
Sbjct: 366 DWSPDGYHIATGGGDGVINIWDIRKTTETTRLLA----HNNIVTGVRFQKSTGHCLVSCG 421

Query: 173 YDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
           YD  +RI+    D+W  V  L GH   +   D D +E    + S   D ++++WK
Sbjct: 422 YDKQIRIYS--SDNWIQVKTLEGHTDKIL--DVDISEDAQLIVSSGWDRSLKLWK 472

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 30/163 (18%), Positives = 62/163 (38%), Gaps = 42/163 (25%)

Query: 13  YKEKIWSFDFSQ--GILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHT 70
           + ++++S  F     +L +G  D      ++ +D  T   +++   H K I SV W P  
Sbjct: 316 HGKEVYSLSFQNDGALLCSGGLDN----AAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDG 371

Query: 71  SLLAAGSFDSTVSIWAKEESAD---------------------------------RTFEM 97
             +A G  D  ++IW   ++ +                                 R +  
Sbjct: 372 YHIATGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSS 431

Query: 98  D---LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETD 137
           D    +  +EGH +++  V  S D   + +   D+S+ +W+ +
Sbjct: 432 DNWIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWKQE 474

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 72.0 bits (175), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 65/198 (32%), Positives = 90/198 (45%), Gaps = 30/198 (15%)

Query: 56  AHKKAIRSVAWRPHTS-LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
            H   I   A+ PHTS  +  G  D+T  IW  +    +         + GH N V  V+
Sbjct: 143 GHGATILCSAFAPHTSSRVVTGGGDNTARIWDCDTQTPK-------VTLNGHRNWVLCVS 195

Query: 115 WSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-------SEAL 167
           WS DG  +AT S D ++ +W+  ESG+       L+ HS+ +  + W P       S+  
Sbjct: 196 WSADGEVIATGSMDNTIRLWDA-ESGKPLG--DALRGHSKWITSLTWEPIHLVEPGSKPR 252

Query: 168 LASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
           LAS+S D T+RIW        C+  L GH  +V    +   EG+  L SGS D TVR W 
Sbjct: 253 LASASKDGTIRIWDSSRR--VCLMTLGGHTNSVSCVKWGG-EGI--LYSGSHDKTVRAW- 306

Query: 228 YMGDDEDDQQEWVCEAIL 245
                 D +Q   C  IL
Sbjct: 307 ------DMKQNGKCINIL 318

 Score = 63.5 bits (153), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 77/161 (47%), Gaps = 16/161 (9%)

Query: 69  HTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRD 128
           H  L+   S D T+ +W   +       M       GH+  V  VA+S DG Y+ + S D
Sbjct: 372 HEELMVTASDDFTMFLWNPLKGTKPISRM------TGHQKLVNHVAFSPDGKYIVSASFD 425

Query: 129 KSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWE 188
            S+ +W+    G+E   +S  + H   V  V W     LL S S D T+++W   D    
Sbjct: 426 NSIKLWD----GKEGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW---DVKTR 478

Query: 189 CVAV-LNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKY 228
            ++V L GH+  V++ D+   +G  R+CSG  D  +R+W +
Sbjct: 479 KLSVDLPGHQDEVYTVDWS-VDGK-RVCSGGKDKMMRLWTH 517

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 69/154 (44%), Gaps = 22/154 (14%)

Query: 37  KLVSVKYDDFTLI---------DVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAK 87
           +L+    DDFT+           +   T H+K +  VA+ P    + + SFD+++ +W  
Sbjct: 374 ELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDG 433

Query: 88  EESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECIS 147
           +E          L+   GH   V  VAWS+D   L +CS+D ++ +W+      +   +S
Sbjct: 434 KEGT-------FLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDV-----KTRKLS 481

Query: 148 V-LQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
           V L  H  +V  V W      + S   D  +R+W
Sbjct: 482 VDLPGHQDEVYTVDWSVDGKRVCSGGKDKMMRLW 515

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 91/358 (25%), Positives = 145/358 (40%), Gaps = 87/358 (24%)

Query: 18  WSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRP-------HT 70
           WS D    ++ATGS D  I+L   +     L D L    H K I S+ W P         
Sbjct: 196 WSADGE--VIATGSMDNTIRLWDAESGK-PLGDAL--RGHSKWITSLTWEPIHLVEPGSK 250

Query: 71  SLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKS 130
             LA+ S D T+ IW   +S+ R   M L     GH N V  V W  +G  L + S DK+
Sbjct: 251 PRLASASKDGTIRIW---DSSRRVCLMTL----GGHTNSVSCVKWGGEGI-LYSGSHDKT 302

Query: 131 VWIWETDESGEEYECISVLQEHSQDVKHVIW----------------HPSEA-------- 166
           V  W+  ++G+   CI++L+ H+  V H+                   P+ A        
Sbjct: 303 VRAWDMKQNGK---CINILKSHAHWVNHLSLSTDYALRVGAFDYTGVKPANAKEARDKAL 359

Query: 167 ---------------LLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGV 211
                          L+ ++S D T+ +W       + ++ + GH+  V    F   +G 
Sbjct: 360 QNYEKVARKNGKHEELMVTASDDFTMFLWNPLKGT-KPISRMTGHQKLVNHVAFSP-DGK 417

Query: 212 FRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFN-GLIASVGAD 270
           + + S S D+++++W        D +E    +     H   VY VAW  +  L+ S   D
Sbjct: 418 Y-IVSASFDNSIKLW--------DGKEGTFLSTFRG-HVASVYQVAWSSDCRLLVSCSKD 467

Query: 271 GVLAVYEEVDGEWKVFAKRA---LCHGVYEINVVKWLELNGKTILATGGDDGIVNFWS 325
             L V       W V  ++    L     E+  V W  ++GK +  +GG D ++  W+
Sbjct: 468 TTLKV-------WDVKTRKLSVDLPGHQDEVYTVDW-SVDGKRV-CSGGKDKMMRLWT 516

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 70.9 bits (172), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 99/209 (47%), Gaps = 29/209 (13%)

Query: 31  STDRKIKLVSVKYDDFTLIDVLDETA----HKKAIRSVAWRPHTS-LLAAGSFDSTVSIW 85
           ST+ +I L+      F +  V   ++    H   I   A+ PHTS  +  G+ D+T  IW
Sbjct: 112 STEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIW 171

Query: 86  AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYEC 145
                 D    M  L   +GH N V  V+WS DG  +AT S D ++ +W+  +SG   +C
Sbjct: 172 ----DCDTQTPMHTL---KGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDP-KSG---QC 220

Query: 146 IS-VLQEHSQDVKHVIWHP-------SEALLASSSYDDTVRIWKDYDDDWECVAVLNGHE 197
           +   L+ HS+ +  + W P       S+  LASSS D T++IW        C   ++GH 
Sbjct: 221 LGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSR--VCQYTMSGHT 278

Query: 198 GTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            +V      K  G   L SGS D TVRVW
Sbjct: 279 NSV---SCVKWGGQGLLYSGSHDRTVRVW 304

 Score = 64.3 bits (155), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 105/245 (42%), Gaps = 58/245 (23%)

Query: 24  QGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSL-----LAAGSF 78
           QG+L +GS DR +++  +       I++L   AH        W  H SL     L  G+F
Sbjct: 289 QGLLYSGSHDRTVRVWDIN-SQGRCINILKSHAH--------WVNHLSLSTDYALRIGAF 339

Query: 79  DSTVSIWAKEESADRT-------------------------FEMDL---------LAIIE 104
           D T    +  E A +                          + M L         +A + 
Sbjct: 340 DHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMT 399

Query: 105 GHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPS 164
           GH+  V  VA+S DG Y+ + S D S+ +W+    G + + IS  + H   V  V W   
Sbjct: 400 GHQKLVNHVAFSPDGRYIVSASFDNSIKLWD----GRDGKFISTFRGHVASVYQVAWSSD 455

Query: 165 EALLASSSYDDTVRIWKDYDDDWECVAV-LNGHEGTVWSSDFDKTEGVFRLCSGSDDSTV 223
             LL S S D T+++W   D     ++V L GH+  V++ D+   +G  R+CSG  D  V
Sbjct: 456 CRLLVSCSKDTTLKVW---DVRTRKLSVDLPGHKDEVYTVDWS-VDGK-RVCSGGKDKMV 510

Query: 224 RVWKY 228
           R+W +
Sbjct: 511 RLWTH 515

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 78/182 (42%), Gaps = 22/182 (12%)

Query: 103 IEGHENEVKGVAWS-NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIW 161
           I GH + +   A++ +    + T + D +  IW+ D     +     L+ H   V  V W
Sbjct: 139 IAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMH----TLKGHYNWVLCVSW 194

Query: 162 HPSEALLASSSYDDTVRIWKDYDDDWECVA-VLNGHEGTVWSSDFD-----KTEGVFRLC 215
            P   ++A+ S D+T+R+W       +C+   L GH   + S  ++     K     RL 
Sbjct: 195 SPDGEVIATGSMDNTIRLWDPKSG--QCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLA 252

Query: 216 SGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAV 275
           S S D T+++W        D    VC+  +   H   V  V WG  GL+ S   D  + V
Sbjct: 253 SSSKDGTIKIW--------DTVSRVCQYTM-SGHTNSVSCVKWGGQGLLYSGSHDRTVRV 303

Query: 276 YE 277
           ++
Sbjct: 304 WD 305

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 70.9 bits (172), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 99/204 (48%), Gaps = 20/204 (9%)

Query: 27  LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWA 86
           +  GS D +I++ +    +     V+D  AH   IRS+A  P    + +GS D TV +W 
Sbjct: 70  IIVGSDDFRIRVFNYNTGE----KVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWN 125

Query: 87  KEE--SADRTFEMDLLAIIEGHENEVKGVAWS-NDGYYLATCSRDKSVWIWETDESGEEY 143
            E   + ++TF        EGHE+ V  VA++  D    A+   D++V +W   +S   +
Sbjct: 126 WENNWALEQTF--------EGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNF 177

Query: 144 ECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSS 203
             ++  QE   +       P +  + ++S D T++IW DY     CVA L GH   V  +
Sbjct: 178 -TLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIW-DYQTK-SCVATLEGHMSNVSFA 234

Query: 204 DFDKTEGVFRLCSGSDDSTVRVWK 227
            F  T  +  + SGS+D T+++W 
Sbjct: 235 VFHPTLPI--IISGSEDGTLKIWN 256

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 77/184 (41%), Gaps = 26/184 (14%)

Query: 56  AHKKAIRSVAWRPH-TSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
            H+  +  VA+ P   S  A+G  D TV +W+  +S           +  G E  V  V 
Sbjct: 138 GHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPN------FTLTTGQERGVNYVD 191

Query: 115 WSN--DGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSS 172
           +    D  Y+ T S D ++ IW+     +   C++ L+ H  +V   ++HP+  ++ S S
Sbjct: 192 YYPLPDKPYMITASDDLTIKIWDY----QTKSCVATLEGHMSNVSFAVFHPTLPIIISGS 247

Query: 173 YDDTVRIWKDYDDDWE-----------CVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDS 221
            D T++IW       E           C+A          +S FD   G   L  G+D+ 
Sbjct: 248 EDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDN--GFTVLSLGNDEP 305

Query: 222 TVRV 225
           T+ +
Sbjct: 306 TLSL 309

>Kwal_23.6324
          Length = 514

 Score = 70.5 bits (171), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 85/179 (47%), Gaps = 23/179 (12%)

Query: 56  AHKKAIRSVAWRPHTS-LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
            H   I   A+ PHTS  +  GS D+T  IW    +         +  ++GH N V  VA
Sbjct: 140 GHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCNTNTP-------MYTLKGHFNWVLCVA 192

Query: 115 WSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-------SEAL 167
           W  DG  +AT S D ++ +W++++ GE Y     L+ H++ +  + W P        +  
Sbjct: 193 WCPDGELIATGSMDNTIRLWDSNK-GESYG--EALRGHAKWITSLTWEPMHLVKAGDQPR 249

Query: 168 LASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           LAS+S D T++IW        CV  L+GH  +V      K  G   L SGS D T+R W
Sbjct: 250 LASASKDGTIKIWDTTRR--VCVLTLSGHTNSV---SCVKWGGRGILYSGSHDKTIRAW 303

 Score = 60.1 bits (144), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 73/154 (47%), Gaps = 22/154 (14%)

Query: 37  KLVSVKYDDFTLI---------DVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAK 87
           +L+    DDFT+           +   T H+K +  VA+ P    + + SFD+++ +W  
Sbjct: 371 ELMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW-- 428

Query: 88  EESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECIS 147
            +  + TF    +A   GH   V  VAWS+D   L +CS+D ++ +W+        + +S
Sbjct: 429 -DGRNGTF----IATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDV-----RTKKLS 478

Query: 148 V-LQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
           V L  H+ +V  V W      + S+  D  VRIW
Sbjct: 479 VDLPGHNDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 75/158 (47%), Gaps = 16/158 (10%)

Query: 72  LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSV 131
           L+   S D T+ +W   +++     M       GH+  V  VA+S DG Y+ + S D S+
Sbjct: 372 LMVTASDDFTMYLWDPLKASKPITRM------TGHQKLVNHVAFSPDGRYIVSASFDNSI 425

Query: 132 WIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVA 191
            +W+    G     I+  + H   V  V W     LL S S D T+++W   D   + ++
Sbjct: 426 KLWD----GRNGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW---DVRTKKLS 478

Query: 192 V-LNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKY 228
           V L GH   V++ D+   +G  R+CS   D  VR+W +
Sbjct: 479 VDLPGHNDEVYTVDWS-VDGK-RVCSAGKDKMVRIWTH 514

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 88/351 (25%), Positives = 140/351 (39%), Gaps = 87/351 (24%)

Query: 26  ILATGSTDRKIKL-VSVKYDDFTLIDVLDETAHKKAIRSVAWRPH-------TSLLAAGS 77
           ++ATGS D  I+L  S K + +   + L    H K I S+ W P           LA+ S
Sbjct: 199 LIATGSMDNTIRLWDSNKGESYG--EAL--RGHAKWITSLTWEPMHLVKAGDQPRLASAS 254

Query: 78  FDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETD 137
            D T+ IW      D T  + +L +  GH N V  V W   G  L + S DK++  W+  
Sbjct: 255 KDGTIKIW------DTTRRVCVLTL-SGHTNSVSCVKWGGRGI-LYSGSHDKTIRAWDMA 306

Query: 138 ESGEEYECISVLQEHSQDVKHVIWH-------------------PSEA------------ 166
             G+   CI++L+ H+  + H+  +                   P EA            
Sbjct: 307 AGGK---CINILKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPEEARAKALKNYEKIA 363

Query: 167 --------LLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGS 218
                   L+ ++S D T+ +W D     + +  + GH+  V    F   +G + + S S
Sbjct: 364 KKNGQLEELMVTASDDFTMYLW-DPLKASKPITRMTGHQKLVNHVAFSP-DGRY-IVSAS 420

Query: 219 DDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFN-GLIASVGADGVLAVYE 277
            D+++++W        D +     A     H   VY VAW  +  L+ S   D  L V  
Sbjct: 421 FDNSIKLW--------DGRNGTFIATFRG-HVASVYQVAWSSDCRLLVSCSKDTTLKV-- 469

Query: 278 EVDGEWKVFAKRA---LCHGVYEINVVKWLELNGKTILATGGDDGIVNFWS 325
                W V  K+    L     E+  V W  ++GK +  + G D +V  W+
Sbjct: 470 -----WDVRTKKLSVDLPGHNDEVYTVDW-SVDGKRV-CSAGKDKMVRIWT 513

>CAGL0I03454g 292823..293734 similar to sp|Q04491 Saccharomyces
           cerevisiae YLR208w SEC13 protein transport protein,
           start by similarity
          Length = 303

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 89/299 (29%), Positives = 125/299 (41%), Gaps = 41/299 (13%)

Query: 54  ETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGV 113
           E AH+  I   A   + + LA  S D TV I+   E  D      LL  + GHE  V   
Sbjct: 5   ENAHEGVIHHAALNYYGTRLATCSSDKTVKIF---EINDVNNSSSLLETLVGHEGPVWYA 61

Query: 114 AWSNDGY---YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSE--ALL 168
            W +       LATC  D  V IW+    G + + I     HS  V  V W P E   +L
Sbjct: 62  DWCHPSLGENLLATCGYDGKVLIWKESGHGGKMQIIGKHAVHSASVNCVKWAPHEYGLIL 121

Query: 169 ASSSYDDTVRIWKDYDDDWECVAVL-NGHEGTV----W--------SSDFDKTEGVFRLC 215
              S D  + + +  D       +L N H+  V    W        S D D+T  V +  
Sbjct: 122 LCGSADGKISVVELKDGQIASTKILDNAHKFGVNSISWAPLMKTDSSDDGDETTAVKQFI 181

Query: 216 SGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGL----IASVGADG 271
           SG +D+ V++WK+    +DDQ+ +V    L + HK  V  V W    L    +ASV  D 
Sbjct: 182 SGGNDNLVKIWKF----DDDQETYVVADTL-EGHKDAVTAVDWSPTTLLQSYVASVSNDK 236

Query: 272 VLAVYEE----VDGEWKVFAKRALCHGVYE--INVVKWLELNGKTILATGGDDGIVNFW 324
              V+ +       +WK   K ++  G +E  +  V W  L+G  +LA   DD  V  W
Sbjct: 237 QCLVWTQDHSSKKNDWK---KISVNEGKFEQKLGSVSW-SLSG-NLLAVSDDDKNVTIW 290

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 59/186 (31%), Positives = 83/186 (44%), Gaps = 25/186 (13%)

Query: 26  ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRP--------------HTS 71
           IL  GS D KI +V +K        +LD  AHK  + S++W P                 
Sbjct: 120 ILLCGSADGKISVVELKDGQIASTKILD-NAHKFGVNSISWAPLMKTDSSDDGDETTAVK 178

Query: 72  LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY---YLATCSRD 128
              +G  D+ V IW  ++  +     D L   EGH++ V  V WS       Y+A+ S D
Sbjct: 179 QFISGGNDNLVKIWKFDDDQETYVVADTL---EGHKDAVTAVDWSPTTLLQSYVASVSND 235

Query: 129 KSVWIWETDESGE--EYECISVLQ-EHSQDVKHVIWHPSEALLASSSYDDTVRIWKDY-D 184
           K   +W  D S +  +++ ISV + +  Q +  V W  S  LLA S  D  V IWK+  D
Sbjct: 236 KQCLVWTQDHSSKKNDWKKISVNEGKFEQKLGSVSWSLSGNLLAVSDDDKNVTIWKESGD 295

Query: 185 DDWECV 190
             WE V
Sbjct: 296 GKWEEV 301

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 73/166 (43%), Gaps = 13/166 (7%)

Query: 99  LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKH 158
           ++ I   HE  +   A +  G  LATCS DK+V I+E ++       +  L  H   V +
Sbjct: 1   MVKIENAHEGVIHHAALNYYGTRLATCSSDKTVKIFEINDVNNSSSLLETLVGHEGPVWY 60

Query: 159 VIW-HPS--EALLASSSYDDTVRIWKD--YDDDWECVAVLNGHEGTVWSSDFDKTE-GVF 212
             W HPS  E LLA+  YD  V IWK+  +    + +     H  +V    +   E G+ 
Sbjct: 61  ADWCHPSLGENLLATCGYDGKVLIWKESGHGGKMQIIGKHAVHSASVNCVKWAPHEYGLI 120

Query: 213 RLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAW 258
            LC GS D  + V       E    +     IL + HK  V +++W
Sbjct: 121 LLC-GSADGKISVV------ELKDGQIASTKILDNAHKFGVNSISW 159

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 65/127 (51%), Gaps = 13/127 (10%)

Query: 29  TGSTDRKIKLVSVKYDD----FTLIDVLDETAHKKAIRSVAWRPHT---SLLAAGSFDST 81
           +G  D  +K+   K+DD    + + D L+   HK A+ +V W P T   S +A+ S D  
Sbjct: 182 SGGNDNLVKIW--KFDDDQETYVVADTLE--GHKDAVTAVDWSPTTLLQSYVASVSNDKQ 237

Query: 82  VSIWAKEESADRTFEMDLLAIIEGH-ENEVKGVAWSNDGYYLATCSRDKSVWIWETDESG 140
             +W ++ S+ +  +   +++ EG  E ++  V+WS  G  LA    DK+V IW+    G
Sbjct: 238 CLVWTQDHSSKKN-DWKKISVNEGKFEQKLGSVSWSLSGNLLAVSDDDKNVTIWKESGDG 296

Query: 141 EEYECIS 147
           +  E ++
Sbjct: 297 KWEEVVN 303

>Scas_679.28
          Length = 815

 Score = 70.5 bits (171), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 72/147 (48%), Gaps = 13/147 (8%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           AH+K I ++A  P+ S+ A  S+D T  IW  E         +L A +  H+  +  VA+
Sbjct: 489 AHEKDINALAISPNDSIFATASYDKTCKIWDLENG-------ELTATLSNHKRGLWDVAF 541

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
                 +ATCS DK++ IW  D     +  +  L+ H+  V+  ++   +  L SS  D 
Sbjct: 542 CQYDKLIATCSGDKTIKIWSLD----TFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADG 597

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWS 202
            ++IW     D  C+  L+GH+  +W+
Sbjct: 598 LIKIWDCSTGD--CLKTLDGHDNRIWA 622

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/273 (21%), Positives = 117/273 (42%), Gaps = 34/273 (12%)

Query: 68  PHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSR 127
           P+   LA  +   T+ I     S      +++  + EGHE+ +  +  ++DG ++AT S+
Sbjct: 348 PNHDKLALATNSPTLRIIPVPSSEQEELPINV-EMYEGHEDLLNSLDTTDDGLWMATASK 406

Query: 128 DKSVWIWETDESGEEYECISVLQEHSQDV-----KHVIWHPSEALLASSSYDDTVRIWK- 181
           D +  +W+ +    +++       HS  V      +V+       L ++S D T++ WK 
Sbjct: 407 DHTAIVWKYNSIINKFQPYVKFIGHSATVTAVGLPNVMLRGYPEFLLTASNDLTIKKWKI 466

Query: 182 -----DYDDDWECVAV----LNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDD 232
                  ++D + V V       HE  + +      + +F   + S D T ++W      
Sbjct: 467 PKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIF--ATASYDKTCKIW------ 518

Query: 233 EDDQQEWVCEAILPDVHKRQVYNVAW-GFNGLIASVGADGVLAVYEEVDGEWKVFAKRAL 291
             D +     A L + HKR +++VA+  ++ LIA+   D  + ++         F+    
Sbjct: 519 --DLENGELTATLSN-HKRGLWDVAFCQYDKLIATCSGDKTIKIW-----SLDTFSVMKT 570

Query: 292 CHGVYEINVVKWLELNGKTILATGGDDGIVNFW 324
             G +   V + + +N +  L + G DG++  W
Sbjct: 571 LEG-HTNAVQRCMFINKQLQLVSSGADGLIKIW 602

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 76/178 (42%), Gaps = 11/178 (6%)

Query: 58  KKAIRSVAWRP---HTSLLAAGSFDSTVSIWAKEESAD----RTFEMDLLAIIEGHENEV 110
           K + +S   RP    +S +A  S D TV      +  +     T +  L +I    E E+
Sbjct: 4   KTSYQSTTLRPIYAGSSAIATVSADGTVLATPILDDIEIISLTTPQRRLHSIANDDEQEI 63

Query: 111 KGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLAS 170
             +  + D  YL+  S+++ + I++ D+  ++   I    + S     +    +  L+A 
Sbjct: 64  TALKLTPDAQYLSFISQNQLLKIFKLDQEKKDQGKIIRSMKMSSPCYIMDCDSTSTLVAL 123

Query: 171 SSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDF--DKTEGVFRLCSGSDDSTVRVW 226
              D ++ +  D ++ +     L GH  T+ +  F       V+ LCSG  +  V+VW
Sbjct: 124 GGTDGSITVV-DIENGF-ITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVW 179

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 68.9 bits (167), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 83/173 (47%), Gaps = 14/173 (8%)

Query: 54  ETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGV 113
           +  H KA+ ++A++   +LLA+   D+  +IW            + +  +EGH   + GV
Sbjct: 294 QEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSG-------EPIMKLEGHAGAISGV 346

Query: 114 AWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSY 173
            WS +GY LAT   D +V +W+    G E   ++  Q  + DVK      +   L S  +
Sbjct: 347 DWSPNGYQLATAGADGTVRVWDIRNVGTESALLA-HQVAALDVK--FKKNNGTFLVSCGH 403

Query: 174 DDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           D  V I+    D+W+ +A L GH   V++ D   TE    + SG  D +++ W
Sbjct: 404 DRLVNIFN--ADNWQKLASLEGHTDRVFTVDI--TEDGSTIYSGGKDRSLKQW 452

 Score = 62.8 bits (151), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 81/193 (41%), Gaps = 18/193 (9%)

Query: 27  LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWA 86
           L +G  D  +KL  +  + F  +       H   +  V   P   L A+ SFD T  +W 
Sbjct: 230 LLSGGGDNLVKLWDMTSNSFEEL-----RGHAGRVSRVKVHPSGRLAASASFDLTWILWD 284

Query: 87  KEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECI 146
            E   +       L + EGH   V  +A+ +DG  LA+   D    IW+   SGE    I
Sbjct: 285 LERKVE-------LQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDL-RSGEP---I 333

Query: 147 SVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFD 206
             L+ H+  +  V W P+   LA++  D TVR+W   +   E  + L  H+       F 
Sbjct: 334 MKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTE--SALLAHQVAALDVKFK 391

Query: 207 KTEGVFRLCSGSD 219
           K  G F +  G D
Sbjct: 392 KNNGTFLVSCGHD 404

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 108/230 (46%), Gaps = 32/230 (13%)

Query: 101 AIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWE-TDESGEEYECISVLQEHSQDVKHV 159
           +I   HE ++ G+ W  DG +L +   D  V +W+ T  S EE      L+ H+  V  V
Sbjct: 209 SIDAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLWDMTSNSFEE------LRGHAGRVSRV 262

Query: 160 IWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSD 219
             HPS  L AS+S+D T  +W D +   E + +  GH   V++  F +++G   L S   
Sbjct: 263 KVHPSGRLAASASFDLTWILW-DLERKVE-LQLQEGHSKAVYTIAF-QSDGAL-LASAGL 318

Query: 220 DSTVRVWKYMGDDEDDQQEWVCEAILP-DVHKRQVYNVAWGFNGL-IASVGADGVLAVYE 277
           D+   +W               E I+  + H   +  V W  NG  +A+ GADG + V++
Sbjct: 319 DAVCAIWDLRSG----------EPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWD 368

Query: 278 --EVDGEWKVFAKRALCHGVYEINVVKWLELNGKTILATGGDDGIVNFWS 325
              V  E  + A     H V  ++ VK+ + NG T L + G D +VN ++
Sbjct: 369 IRNVGTESALLA-----HQVAALD-VKFKKNNG-TFLVSCGHDRLVNIFN 411

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 87/200 (43%), Gaps = 19/200 (9%)

Query: 27  LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWA 86
           LATG     IK+VS   +   +   +D  AH+  I  + W P  + L +G  D+ V +W 
Sbjct: 187 LATGCWGGSIKVVSC--ETLGIAKSID-AAHEGKIGGLDWHPDGNHLLSGGGDNLVKLW- 242

Query: 87  KEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECI 146
             +    +FE      + GH   V  V     G   A+ S D +  +W+ +   E    +
Sbjct: 243 --DMTSNSFEE-----LRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVE----L 291

Query: 147 SVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFD 206
            + + HS+ V  + +    ALLAS+  D    IW       E +  L GH G +  S  D
Sbjct: 292 QLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSG--EPIMKLEGHAGAI--SGVD 347

Query: 207 KTEGVFRLCSGSDDSTVRVW 226
            +   ++L +   D TVRVW
Sbjct: 348 WSPNGYQLATAGADGTVRVW 367

>CAGL0J10340g complement(1008637..1009653) highly similar to
           sp|P53011 Saccharomyces cerevisiae YGL100w SEH1 nuclear
           pore protein, start by similarity
          Length = 338

 Score = 68.2 bits (165), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 105/241 (43%), Gaps = 25/241 (10%)

Query: 105 GHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPS 164
           GHE+ V  VA+   G  +ATCS D+ + +++ D+    +E     + H   +  + W   
Sbjct: 7   GHEDIVHDVAYDFYGRTMATCSSDQHIKVFKLDKDATRWEVNDSWRAHDSSIVSLDWASP 66

Query: 165 E--ALLASSSYDDTVRIWKDYDDDWEC-------VAVLNGHEGTVWSSDFDKTEGVFRLC 215
           E   ++AS+SYD T++IW++  +  EC       +  LN  +G+++   F  +    R+ 
Sbjct: 67  EYGRIIASASYDKTIKIWEEDPNQEECSGRRWTRLCTLNDSKGSLYCVKFAPSHLGLRIA 126

Query: 216 SGSDDSTVRVWKYMGDDEDDQQEWVCEA------ILPDVHKRQVYNVAWGFNGL----IA 265
           S  +D  +R++  +  D  + + W   A      + P  + +  + ++W F       IA
Sbjct: 127 SIGNDGIMRMYDAL--DPSNLRSWTMTAEVKVLPVAPANNLQSAFGLSWCFTRFSPEKIA 184

Query: 266 SVGADGVLAVYEEVDGEWKVFAKRALCHGVYEINVVKWLELNGKT--ILATGGDDGIVNF 323
               D         DG +    K  L      I  + W  L G+   ++ATG  DG V  
Sbjct: 185 VCALDQAYIYQRGKDGHFYQAGK--LPGHTSLIRSISWAPLIGRPYHLIATGCKDGRVRI 242

Query: 324 W 324
           +
Sbjct: 243 F 243

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 57/132 (43%), Gaps = 32/132 (24%)

Query: 55  TAHKKAIRSVAWRP----HTSLLAAGSFDSTVSIWAKEESADRT---------------- 94
             H   IRS++W P       L+A G  D  V I+   +S  ++                
Sbjct: 209 PGHTSLIRSISWAPLIGRPYHLIATGCKDGRVRIFRVNDSPSKSNTPNLSDSDDYNMEDQ 268

Query: 95  ----------FEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYE 144
                      E++LL+  + H+ EV  V+W+  G  L++   D  V +W++  S  EY+
Sbjct: 269 GIKQRQNNTDLEVELLSEHDDHKGEVWSVSWNLTGTILSSTGEDGKVRLWKSTYS-NEYK 327

Query: 145 CISVLQEHSQDV 156
           C+S++    QD+
Sbjct: 328 CMSIITS-KQDI 338

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 4/77 (5%)

Query: 19 SFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDE-TAHKKAIRSVAW--RPHTSLLAA 75
          ++DF    +AT S+D+ IK+  +   D T  +V D   AH  +I S+ W    +  ++A+
Sbjct: 16 AYDFYGRTMATCSSDQHIKVFKLD-KDATRWEVNDSWRAHDSSIVSLDWASPEYGRIIAS 74

Query: 76 GSFDSTVSIWAKEESAD 92
           S+D T+ IW ++ + +
Sbjct: 75 ASYDKTIKIWEEDPNQE 91

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 99/206 (48%), Gaps = 24/206 (11%)

Query: 27  LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWA 86
           +  GS D KI++ +    +     V+D  AH   IR++A  P  S + + S D TV +W 
Sbjct: 70  IIVGSDDFKIRVFNYNTGE----KVVDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLWN 125

Query: 87  KEE--SADRTFEMDLLAIIEGHENEVKGVAWS-NDGYYLATCSRDKSVWIWETDESGEEY 143
            E+  + ++TF        EGHE+ V  V ++  D    AT   D +V IW     G+E 
Sbjct: 126 WEKNWALEQTF--------EGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSL---GQET 174

Query: 144 ECISVLQEHSQDVKHVIWHPSE--ALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVW 201
              ++     + V  V ++P +    L +SS D TV++W DY     CVA L GH   V 
Sbjct: 175 SNFTLRAHLEKGVNFVDYYPFQDKPYLITSSDDRTVKVW-DYQTK-SCVATLEGHLSNVS 232

Query: 202 SSDFDKTEGVFRLCSGSDDSTVRVWK 227
            + +     +  + SGS+D TV++W 
Sbjct: 233 YAVYHPMLPI--IISGSEDGTVKIWN 256

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 62/270 (22%), Positives = 109/270 (40%), Gaps = 33/270 (12%)

Query: 60  AIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDG 119
            +R+  + P  S +  GS D  + ++    + ++  +       E H + ++ +A     
Sbjct: 57  PVRAGKFIPRKSWIIVGSDDFKIRVF-NYNTGEKVVDF------EAHPDYIRALAVHPTR 109

Query: 120 YYLATCSRDKSV--WIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA-LLASSSYDDT 176
            Y+ + S D +V  W WE + + E+       + H   V  V ++P +    A++  D T
Sbjct: 110 SYVLSASDDLTVKLWNWEKNWALEQ-----TFEGHEHFVMSVTFNPKDPNTFATACLDHT 164

Query: 177 VRIWKDYDDDWECVAVLNGH-EGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDD 235
           V+IW    +       L  H E  V   D+   +    L + SDD TV+VW Y       
Sbjct: 165 VKIWSLGQETSNFT--LRAHLEKGVNFVDYYPFQDKPYLITSSDDRTVKVWDY------- 215

Query: 236 QQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYE----EVDGEWKVFAKRAL 291
            Q   C A L        Y V      +I S   DG + ++     +++    +  +R+ 
Sbjct: 216 -QTKSCVATLEGHLSNVSYAVYHPMLPIIISGSEDGTVKIWNSNTYKLERTLNLGLERSW 274

Query: 292 C---HGVYEINVVKWLELNGKTILATGGDD 318
           C   H   + N +     NG T+LA G D+
Sbjct: 275 CVAAHPTGKRNFIAAGFDNGFTVLAIGNDE 304

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 94/203 (46%), Gaps = 20/203 (9%)

Query: 27  LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWA 86
           +  GS D K+++ +      T   V D  AH   IRS+A  P    +  GS D TV +W 
Sbjct: 70  IVVGSDDNKVRVFNYN----TGEKVADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKLWN 125

Query: 87  KEE--SADRTFEMDLLAIIEGHENEVKGVAWS-NDGYYLATCSRDKSVWIWETDESGEEY 143
            E   S ++TF        +GHE+ V  VA++  D    A+   D  V +W   +S   +
Sbjct: 126 WENDWSLEQTF--------KGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNF 177

Query: 144 ECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSS 203
             +   QE   +       P +  + +SS D TV+I+ DY     CVA L GH   V  +
Sbjct: 178 -TLHTGQEKGVNYVDYYPLPDKPYMITSSDDTTVKIF-DYQTK-SCVATLEGHMSNVSFA 234

Query: 204 DFDKTEGVFRLCSGSDDSTVRVW 226
            F  T  +  + SGS+D TV++W
Sbjct: 235 VFHPTLPI--IISGSEDGTVKLW 255

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 80/164 (48%), Gaps = 22/164 (13%)

Query: 23  SQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPH-TSLLAAGSFDST 81
           S+  + TGS D  +KL + + +D++L        H+  +  VA+ P   ++ A+G  D  
Sbjct: 108 SKPYILTGSDDLTVKLWNWE-NDWSLEQTF--KGHEHFVMCVAFNPKDPNVFASGCLDHK 164

Query: 82  VSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSN-----DGYYLATCSRDKSVWIWET 136
           V +W+  +S    F +        H  + KGV + +     D  Y+ T S D +V I++ 
Sbjct: 165 VKVWSLGQSTPN-FTL--------HTGQEKGVNYVDYYPLPDKPYMITSSDDTTVKIFDY 215

Query: 137 DESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
               +   C++ L+ H  +V   ++HP+  ++ S S D TV++W
Sbjct: 216 ----QTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTVKLW 255

 Score = 29.6 bits (65), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 10/84 (11%)

Query: 148 VLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDK 207
              + S  VK +  HPSE  + ++ Y   V IW +Y+   E  ++       V  +    
Sbjct: 8   TFSKRSNRVKGIDLHPSEPWVLTTLYSGRVEIW-NYETQQEVRSI------QVTDTPVRA 60

Query: 208 TEGVFR---LCSGSDDSTVRVWKY 228
            + + R   +  GSDD+ VRV+ Y
Sbjct: 61  GKFITRKNWIVVGSDDNKVRVFNY 84

>Kwal_55.22067
          Length = 451

 Score = 67.4 bits (163), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 79/171 (46%), Gaps = 14/171 (8%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           AH  A+  + +      L +G  D T+ IW         F M +  + E H   ++G+++
Sbjct: 123 AHDSAVAVMKYSHAGDWLISGDSDGTIKIWQPN------FNM-VKVLDEAHTQCIRGISF 175

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
           S       TCS D  + IW      +E    S L  H  DV+   WHP+  L+AS S D+
Sbjct: 176 SGTDSKFVTCSDDNILKIWNFSNGQQE----STLSGHHWDVRSCDWHPTMGLIASGSKDN 231

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            V++W       +C++ + G + T+ S+ F  T+G   L   S D + R++
Sbjct: 232 LVKLWDPRAG--QCISTILGCKHTIISTKFQPTKGNM-LAVISKDKSCRIF 279

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 85/170 (50%), Gaps = 17/170 (10%)

Query: 58  KKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSN 117
           K  I ++ W P    L   ++    S+W        TF  +  +I++ H++ V  + +S+
Sbjct: 83  KHVIPALEWTPEGRRLVVATYSGEFSLWNGS-----TFNFE--SIMQAHDSAVAVMKYSH 135

Query: 118 DGYYLATCSRDKSVWIWETDESGEEYECISVLQE-HSQDVKHVIWHPSEALLASSSYDDT 176
            G +L +   D ++ IW+ +     +  + VL E H+Q ++ + +  +++   + S D+ 
Sbjct: 136 AGDWLISGDSDGTIKIWQPN-----FNMVKVLDEAHTQCIRGISFSGTDSKFVTCSDDNI 190

Query: 177 VRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           ++IW   +   E  + L+GH   V S D+  T G+  + SGS D+ V++W
Sbjct: 191 LKIWNFSNGQQE--STLSGHHWDVRSCDWHPTMGL--IASGSKDNLVKLW 236

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 79/173 (45%), Gaps = 20/173 (11%)

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW-SNDG 119
           +RS  W P   L+A+GS D+ V +W              ++ I G ++ +    +    G
Sbjct: 212 VRSCDWHPTMGLIASGSKDNLVKLWDPRAG-------QCISTILGCKHTIISTKFQPTKG 264

Query: 120 YYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-SEALLASSSYDDTVR 178
             LA  S+DKS  I++  ++ +E   ++V ++ S D   + WHP +E++     YD +++
Sbjct: 265 NMLAVISKDKSCRIFDIRQNMKE---LAVYRDES-DYMSLTWHPINESMFTVGCYDGSMK 320

Query: 179 ----IWKDYDDDWECV-AVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
               + +  D    C   +   H+  + S  ++    +  L S S D T+R W
Sbjct: 321 HFDLLQEPQDSSSGCFHNIPYAHDKCITSLAYNPVGHI--LASASKDRTIRFW 371

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/249 (21%), Positives = 107/249 (42%), Gaps = 22/249 (8%)

Query: 27  LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWA 86
           L +G +D  IK+      +F ++ VLDE AH + IR +++    S     S D+ + IW 
Sbjct: 140 LISGDSDGTIKIWQ---PNFNMVKVLDE-AHTQCIRGISFSGTDSKFVTCSDDNILKIWN 195

Query: 87  KEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECI 146
                         + + GH  +V+   W      +A+ S+D  V +W+        +CI
Sbjct: 196 FSNGQQE-------STLSGHHWDVRSCDWHPTMGLIASGSKDNLVKLWDPRAG----QCI 244

Query: 147 SVLQEHSQDVKHVIWHPSEA-LLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDF 205
           S +      +    + P++  +LA  S D + RI+ D   + + +AV       +  +  
Sbjct: 245 STILGCKHTIISTKFQPTKGNMLAVISKDKSCRIF-DIRQNMKELAVYRDESDYMSLTWH 303

Query: 206 DKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNG-LI 264
              E +F +  G  D +++ +  + + +D      C   +P  H + + ++A+   G ++
Sbjct: 304 PINESMFTV--GCYDGSMKHFDLLQEPQDSSSG--CFHNIPYAHDKCITSLAYNPVGHIL 359

Query: 265 ASVGADGVL 273
           AS   D  +
Sbjct: 360 ASASKDRTI 368

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 78/177 (44%), Gaps = 24/177 (13%)

Query: 110 VKGVAWSNDGYYL--ATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEAL 167
           +  + W+ +G  L  AT S + S+W      +G  +   S++Q H   V  + +  +   
Sbjct: 86  IPALEWTPEGRRLVVATYSGEFSLW------NGSTFNFESIMQAHDSAVAVMKYSHAGDW 139

Query: 168 LASSSYDDTVRIWKDYDDDWECVAVLN-GHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           L S   D T++IW+    ++  V VL+  H   +    F  T+  F  C  SDD+ +++W
Sbjct: 140 LISGDSDGTIKIWQ---PNFNMVKVLDEAHTQCIRGISFSGTDSKFVTC--SDDNILKIW 194

Query: 227 KYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFN-GLIASVGADGVLAVYEEVDGE 282
            +     + QQE          H   V +  W    GLIAS   D ++ +++   G+
Sbjct: 195 NF----SNGQQESTLSG-----HHWDVRSCDWHPTMGLIASGSKDNLVKLWDPRAGQ 242

 Score = 32.0 bits (71), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESAD 92
           AH K I S+A+ P   +LA+ S D T+  W +    D
Sbjct: 342 AHDKCITSLAYNPVGHILASASKDRTIRFWTRARPYD 378

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 92/220 (41%), Gaps = 29/220 (13%)

Query: 23  SQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRP-HTSLLAAGSFDST 81
           + G++A+GS D  +KL    +D      +      K  I S  ++P   ++LA  S D +
Sbjct: 220 TMGLIASGSKDNLVKL----WDPRAGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKS 275

Query: 82  VSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS--NDGYYLATCSRDKSVWIWETDES 139
             I+      D    M  LA+    E++   + W   N+  +   C  D S+  ++  + 
Sbjct: 276 CRIF------DIRQNMKELAVYRD-ESDYMSLTWHPINESMFTVGC-YDGSMKHFDLLQE 327

Query: 140 GEEYE--CI-SVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW---KDYDDDWECVAVL 193
            ++    C  ++   H + +  + ++P   +LAS+S D T+R W   + YD +       
Sbjct: 328 PQDSSSGCFHNIPYAHDKCITSLAYNPVGHILASASKDRTIRFWTRARPYDPNSFDDPTY 387

Query: 194 NGHEGTVW--------SSDFDKTEGVFRLCSGSDDSTVRV 225
           N  +   W        ++   KTE    L   S+DST  +
Sbjct: 388 NNKKVNAWYFGINNNINAIRPKTEDGIALPPASNDSTASI 427

>Scas_630.6
          Length = 621

 Score = 67.4 bits (163), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 93/182 (51%), Gaps = 27/182 (14%)

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120
           IRS+ + P    LA G+ D  + IW  +E         ++ +++GHE ++  + +  DG 
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNIKERK-------IVMVLKGHEQDIYSLDYFPDGQ 396

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA-LLASSSYDDTVRI 179
            L + S D+S+ IW+  ++G+    +S+       V  V   P+E  L+A+ S D +VRI
Sbjct: 397 KLVSGSGDRSIRIWDL-KTGQCSLTLSI----EDGVTTVAVSPNEGKLIAAGSLDRSVRI 451

Query: 180 W--------KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGD 231
           W        +  D D E     NGH+ +V+S  F K +G   + SGS D TV++W  +GD
Sbjct: 452 WDSSTGFLVERLDSDNESG---NGHQDSVYSVAFTK-DGQ-HVVSGSLDRTVKLWN-LGD 505

Query: 232 DE 233
            +
Sbjct: 506 TQ 507

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 109/242 (45%), Gaps = 28/242 (11%)

Query: 6   LIKSLKLYKEKIWSFD-FSQGI-LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRS 63
           ++  LK +++ I+S D F  G  L +GS DR I++  +K    +L   +++      + +
Sbjct: 375 IVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTLSIED-----GVTT 429

Query: 64  VAWRPHT-SLLAAGSFDSTVSIWAKE-----ESADRTFEMDLLAIIEGHENEVKGVAWSN 117
           VA  P+   L+AAGS D +V IW        E  D   E        GH++ V  VA++ 
Sbjct: 430 VAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNESG-----NGHQDSVYSVAFTK 484

Query: 118 DGYYLATCSRDKSVWIWET-DESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDT 176
           DG ++ + S D++V +W   D      +C      H   V  V     +  + S S D  
Sbjct: 485 DGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRG 544

Query: 177 VRIWKDYDDDWECVAVLNGHEGTVWS-----SDFDKTEGVFRLCSGSDDSTVRVWKY--M 229
           V IW    D    + +L GH  +V S     S+ D  +      +GS D   R+WKY  M
Sbjct: 545 VIIWDK--DSGNPILMLQGHRKSVISVATVNSNVDDGKNYKLFATGSGDCKARIWKYFKM 602

Query: 230 GD 231
           G+
Sbjct: 603 GE 604

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 72/153 (47%), Gaps = 31/153 (20%)

Query: 95  FEMDLLAIIEGHENEVKGVAWSNDGYYLAT-CSRDKSVWIWETDESGEEYECISVLQEHS 153
            ++DLL  +  H++ V  V +S DG YLAT C+R   ++   T   GE Y  + +L +  
Sbjct: 268 LDVDLLHSLP-HDSVVCCVKFSQDGKYLATGCNRTTQIFDVAT---GELY--VKLLDDTV 321

Query: 154 QD--------------------VKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVL 193
                                 ++ + + P    LA+ + D  +RIW     + + V VL
Sbjct: 322 NTAIVTTTTENNETVTTTADLYIRSICFSPDGEFLATGAEDKLIRIWN--IKERKIVMVL 379

Query: 194 NGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            GHE  ++S D+   +G  +L SGS D ++R+W
Sbjct: 380 KGHEQDIYSLDY-FPDGQ-KLVSGSGDRSIRIW 410

>Scas_624.11
          Length = 1205

 Score = 67.4 bits (163), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 92/201 (45%), Gaps = 43/201 (21%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H+  +RSV + P   +  +G  D T+ +W+ E +         L  + GH + ++ V + 
Sbjct: 52  HEGPVRSVDFHPTQPIFVSGGDDYTIKVWSLETN-------KCLYTLNGHLDYIRTVFFH 104

Query: 117 NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDT 176
            +  ++ + S D+++ IW      E    I+ L  H+  V    +HP++ L+ S+S D+T
Sbjct: 105 KELPWIISASDDQTIRIWNWQNRKE----IACLTGHNHFVMCAQFHPTDDLVVSASLDET 160

Query: 177 VRIW--------------KDYDDDW------------ECVA--VLNGH-EGTVWSSDFDK 207
           +R+W                +DD              +CV   +L GH  G  W+S F  
Sbjct: 161 IRVWDISGLRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCVVKFILEGHTRGVNWAS-FHP 219

Query: 208 TEGVFRLCSGSDDSTVRVWKY 228
           T  +  + SGSDD  V++WKY
Sbjct: 220 TLPM--IVSGSDDRQVKLWKY 238

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 75/173 (43%), Gaps = 23/173 (13%)

Query: 62  RSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEM-DLLAIIEGHENEVKGVAWSNDGY 120
           + +A+ P    +    F ST+ +W         + M  LL   E HE  V+ V +     
Sbjct: 15  KGIAFHPSRPWVLVALFSSTIQLW--------DYRMGTLLHRFEDHEGPVRSVDFHPTQP 66

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
              +   D ++ +W    S E  +C+  L  H   ++ V +H     + S+S D T+RIW
Sbjct: 67  IFVSGGDDYTIKVW----SLETNKCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIRIW 122

Query: 181 KDYDDDWEC---VAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMG 230
                +W+    +A L GH   V  + F  T+ +  + S S D T+RVW   G
Sbjct: 123 -----NWQNRKEIACLTGHNHFVMCAQFHPTDDL--VVSASLDETIRVWDISG 168

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 64/140 (45%), Gaps = 14/140 (10%)

Query: 97  MDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVL---QEHS 153
           M +L   E      KG+A+     ++       ++ +W+       Y   ++L   ++H 
Sbjct: 1   MKMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWD-------YRMGTLLHRFEDHE 53

Query: 154 QDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFR 213
             V+ V +HP++ +  S   D T+++W    +  +C+  LNGH   + +  F K   +  
Sbjct: 54  GPVRSVDFHPTQPIFVSGGDDYTIKVWSLETN--KCLYTLNGHLDYIRTVFFHKE--LPW 109

Query: 214 LCSGSDDSTVRVWKYMGDDE 233
           + S SDD T+R+W +    E
Sbjct: 110 IISASDDQTIRIWNWQNRKE 129

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 68/152 (44%), Gaps = 31/152 (20%)

Query: 55  TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIW-----AKEESAD--RTFEMDLLA------ 101
           T H   +    + P   L+ + S D T+ +W      K+ SA    TF+  + A      
Sbjct: 134 TGHNHFVMCAQFHPTDDLVVSASLDETIRVWDISGLRKKHSAPGTSTFDDQMAAQQNLLD 193

Query: 102 ----------IIEGHENEVKGVAWSNDGYYLATC---SRDKSVWIWETDESGEEYECISV 148
                     I+EGH    +GV W++    L      S D+ V +W+ + S + +E +  
Sbjct: 194 GGFGDCVVKFILEGH---TRGVNWASFHPTLPMIVSGSDDRQVKLWKYN-STKAWE-VDT 248

Query: 149 LQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
            + H+ +V  VI+HP++  + S   D T+RIW
Sbjct: 249 CRGHTNNVDCVIFHPTQKFILSVGEDKTLRIW 280

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 69/159 (43%), Gaps = 21/159 (13%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H + +   ++ P   ++ +GS D  V +W  + ++ + +E+D      GH N V  V + 
Sbjct: 208 HTRGVNWASFHPTLPMIVSGSDDRQVKLW--KYNSTKAWEVD---TCRGHTNNVDCVIFH 262

Query: 117 NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKH--VIWHPSEALLASSSYD 174
               ++ +   DK++ IW+ D+       I V Q   ++ +   +  HP+  L   +++D
Sbjct: 263 PTQKFILSVGEDKTLRIWDLDKR------IPVKQFKRENDRFWLIASHPNINLFG-AAHD 315

Query: 175 DTVRIWKDYDDDWECVAVLNGH------EGTVWSSDFDK 207
             + ++K  D +  C  +          E  V   DF K
Sbjct: 316 AGIMVFK-LDRERPCNVIYQNQLIFVNKEKHVQMFDFQK 353

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 67.0 bits (162), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 74/147 (50%), Gaps = 13/147 (8%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           AH+K I +++  P+ S+ A  S+D T  IW  +     T E++  A +  H+  + GVA+
Sbjct: 486 AHEKDINAISMSPNDSIFATASYDKTCKIWNVD-----TGEVE--ATLANHKRGLWGVAF 538

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
               + LATCS D+S+ +W    S E +  +  L+ H+  V+ V +      L S+  D 
Sbjct: 539 CEYDWLLATCSGDRSINLW----SLESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADG 594

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWS 202
            V+IW       ECV  L+ H   +W+
Sbjct: 595 LVKIWD--CSTGECVRTLDAHNNRIWA 619

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/277 (23%), Positives = 121/277 (43%), Gaps = 39/277 (14%)

Query: 68  PHTSLLAAGSFDSTVSIWAKEESADRTFEMDL-LAIIEGHENEVKGVAWSNDGYYLATCS 126
           P  + LA  +   T+ I    ++++    M++   + EGH + +  +  ++DG +LAT S
Sbjct: 342 PSLNRLALATNSPTLRIIPTPQASEDKEVMEIETEMYEGHTDLLNSLDATSDGLWLATAS 401

Query: 127 RDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPS------EALLASSSYDDTVRIW 180
           +D SV +W  +E+   +E  +    H+  V   I  P+         L ++S D T++ W
Sbjct: 402 KDHSVILWRYNEASSSFEPFTKFLGHAGPVT-AIALPNVMNRNWPEFLLTASNDLTIKRW 460

Query: 181 K-DYDDDWECVAVLN----------GHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYM 229
           K    +D + + + +           HE  + +      + +F   + S D T ++W   
Sbjct: 461 KVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPNDSIF--ATASYDKTCKIWNV- 517

Query: 230 GDDEDDQQEWVCEAILPDVHKRQVYNVAWG-FNGLIASVGADGVLAVYEEVDGEWKVFAK 288
                D  E   EA L + HKR ++ VA+  ++ L+A+   D  + +       W + + 
Sbjct: 518 -----DTGE--VEATLAN-HKRGLWGVAFCEYDWLLATCSGDRSINL-------WSLESF 562

Query: 289 RALCHGVYEINVVKWLE-LNGKTILATGGDDGIVNFW 324
             L       N V+ +  +NG   L + G DG+V  W
Sbjct: 563 TVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIW 599

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 66.6 bits (161), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 57/179 (31%), Positives = 83/179 (46%), Gaps = 23/179 (12%)

Query: 56  AHKKAIRSVAWRPHTS-LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
            H   I   A+ PHTS  +  G+ D+T  IW  +           L  ++GH N V  VA
Sbjct: 139 GHGATILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTP-------LCTLKGHSNWVLCVA 191

Query: 115 WSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-------SEAL 167
           WS DG  +AT S D ++ +W++ E G+       L+ H++ +  + W P        +  
Sbjct: 192 WSADGEVIATGSMDATIRLWDS-EKGQSLG--DALRGHTKWITSLSWEPIHLVKPGEKPR 248

Query: 168 LASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           LAS+S D T++IW        C+  L+GH  +V      K  G   L S S D TVR W
Sbjct: 249 LASASKDGTIKIWDTTRR--VCIYTLSGHTSSV---SCIKWGGRNVLYSASHDRTVRCW 302

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 95/204 (46%), Gaps = 23/204 (11%)

Query: 31  STDRKIKLVSVKYDDFTLIDVLDETAHKKAIRS---VAWRPHT--SLLAAGSFDSTVSIW 85
           STD  +++    +D         E A  +A+R+   VA +  T   L+  GS D T+ +W
Sbjct: 327 STDYALRMGP--FDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLW 384

Query: 86  AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYEC 145
              + +     M       GH+  V  VA+S DG Y+ + S D S+ +W+    G + + 
Sbjct: 385 NPLKGSKPILRM------TGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD----GRDGKF 434

Query: 146 ISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAV-LNGHEGTVWSSD 204
           I+  + H   V  V W     LL S S D T+++W   D     + V L GH   V++ D
Sbjct: 435 IATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW---DVKTRKLTVDLPGHNDEVYTVD 491

Query: 205 FDKTEGVFRLCSGSDDSTVRVWKY 228
           +   +G  R+CSG  D  VR+W +
Sbjct: 492 WS-VDGK-RVCSGGKDKMVRLWTH 513

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 67/267 (25%), Positives = 111/267 (41%), Gaps = 56/267 (20%)

Query: 24  QGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSL-----LAAGSF 78
           + +L + S DR ++   +       I++L   AH        W  H SL     L  G F
Sbjct: 287 RNVLYSASHDRTVRCWDMAAGG-KCINILKSHAH--------WVNHLSLSTDYALRMGPF 337

Query: 79  DSTVSIWAKEESAD----RTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIW 134
           D T +  A  E A     R +E   +A   G   E+           + T S D ++++W
Sbjct: 338 DHTGTKPASPEDAQARALRNYEK--VAKKNGTMEEL-----------MVTGSDDFTMYLW 384

Query: 135 ETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLN 194
              +  +    I  +  H + V HV + P    + S+S+D+++++W   D  +  +A   
Sbjct: 385 NPLKGSKP---ILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKF--IATFR 439

Query: 195 GHEGTV----WSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHK 250
           GH  +V    WSSD         L S S D+T++VW        D +       LP  H 
Sbjct: 440 GHVASVYQVAWSSD------CRLLVSCSKDTTLKVW--------DVKTRKLTVDLPG-HN 484

Query: 251 RQVYNVAWGFNG-LIASVGADGVLAVY 276
            +VY V W  +G  + S G D ++ ++
Sbjct: 485 DEVYTVDWSVDGKRVCSGGKDKMVRLW 511

>Scas_720.95
          Length = 515

 Score = 65.9 bits (159), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 107/245 (43%), Gaps = 58/245 (23%)

Query: 24  QGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSL-----LAAGSF 78
           QGI+ +GS D+ +++  +  D    I++L   AH        W  H SL     L  G+F
Sbjct: 289 QGIIYSGSHDKTVRVWDMNADG-KCINILKSHAH--------WVNHLSLSTDYALRVGAF 339

Query: 79  DSTVSIWAKEE-------------------------SADRTFEMDL---------LAIIE 104
           D T +  A  +                         +A   F M L         +A + 
Sbjct: 340 DHTGAQPASAKDARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNKPIARMT 399

Query: 105 GHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPS 164
           GH+  V  VA+S DG Y+ + S D S+ +W+    G + + IS  + H   V  V W   
Sbjct: 400 GHQKLVNHVAFSPDGRYIVSASFDNSIKLWD----GRDGKFISTFRGHVASVYQVAWSAD 455

Query: 165 EALLASSSYDDTVRIWKDYDDDWECVAV-LNGHEGTVWSSDFDKTEGVFRLCSGSDDSTV 223
             LL S S D T+++W   D     ++V L GH+  V++ D+   +G  R+CSG  D  V
Sbjct: 456 CRLLVSCSKDTTLKVW---DVRTRKLSVDLPGHKDEVYTVDWS-VDGK-RVCSGGKDKMV 510

Query: 224 RVWKY 228
           R+W +
Sbjct: 511 RIWTH 515

 Score = 57.0 bits (136), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 85/188 (45%), Gaps = 31/188 (16%)

Query: 56  AHKKAIRSVAWRPHTS-LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
            H   I   A+ P+TS  +  G+ D+T  IW  +    +       A + GH N V  V+
Sbjct: 141 GHGSTILCSAFAPNTSSRMVTGAGDNTARIWDCDTQTPK-------ATLTGHFNWVLCVS 193

Query: 115 WSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-------SEAL 167
           +  +G  +AT S D ++ +W++ +     +    L+ H + +  + W P           
Sbjct: 194 YCPNGEVIATGSMDNTIRLWDSKDGKPLGD---ALRGHLKWITSLAWEPIHLVKPGESPR 250

Query: 168 LASSSYDDTVRIWKDYDDDWECVAVLNGHEGTV----WSSDFDKTEGVFRLCSGSDDSTV 223
           LAS+S D T+RIW        C+  ++GH  +V    WS      +G+  + SGS D TV
Sbjct: 251 LASASKDGTIRIWDITRR--VCLYTMSGHTNSVSCIKWSG-----QGI--IYSGSHDKTV 301

Query: 224 RVWKYMGD 231
           RVW    D
Sbjct: 302 RVWDMNAD 309

 Score = 57.0 bits (136), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 70/149 (46%), Gaps = 19/149 (12%)

Query: 55  TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
           T H   +  V++ P+  ++A GS D+T+ +W  ++         L   + GH   +  +A
Sbjct: 183 TGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDGK------PLGDALRGHLKWITSLA 236

Query: 115 W-------SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEAL 167
           W         +   LA+ S+D ++ IW+         C+  +  H+  V  + W   + +
Sbjct: 237 WEPIHLVKPGESPRLASASKDGTIRIWDI----TRRVCLYTMSGHTNSVSCIKWS-GQGI 291

Query: 168 LASSSYDDTVRIWKDYDDDWECVAVLNGH 196
           + S S+D TVR+W D + D +C+ +L  H
Sbjct: 292 IYSGSHDKTVRVW-DMNADGKCINILKSH 319

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 97/204 (47%), Gaps = 23/204 (11%)

Query: 31  STDRKIKLVSVKYDDFTLIDVLDETAHKKAIRS---VAWRP--HTSLLAAGSFDSTVSIW 85
           STD  ++L +  +D         E A +KA+++   VA R      L+   S D T+ +W
Sbjct: 329 STDYALRLGA--FDHKGETPASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLW 386

Query: 86  AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYEC 145
              +S      M       GH+  V  VA+S DG Y+ + S D S+ +W+    G + + 
Sbjct: 387 NPLKSTKPITRM------TGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD----GRDGKF 436

Query: 146 ISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAV-LNGHEGTVWSSD 204
           +S  + H   V  V W     LL S S D T+++W   D     ++V L GH+  V++ D
Sbjct: 437 LSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW---DVKTRKLSVDLPGHQDEVYTVD 493

Query: 205 FDKTEGVFRLCSGSDDSTVRVWKY 228
           +   +G  R+CSG  D  VR+W +
Sbjct: 494 WS-VDGK-RVCSGGKDKMVRIWTH 515

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/220 (29%), Positives = 99/220 (45%), Gaps = 29/220 (13%)

Query: 21  DFSQGILATG--STDRKIKLVSVKYDDFTLIDVLDETA----HKKAIRSVAWRPHTS-LL 73
           +  Q IL  G  +T+  + LV      F +  V   ++    H   I   A+ P+TS  +
Sbjct: 100 NLYQSILKPGLKTTEDFLTLVYTPRAIFKVKPVTRSSSAIAGHGSTILCSAFAPNTSSRM 159

Query: 74  AAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWI 133
             G+ D+T  IW      D    M     ++GH N V   +WS DG  +AT S D ++ +
Sbjct: 160 VTGAGDNTACIW----DCDTQTRM---CTLQGHHNWVLCCSWSPDGELIATGSMDNTIRL 212

Query: 134 WETDESGEEYECISVLQEHSQDVKHVIWHP-------SEALLASSSYDDTVRIWKDYDDD 186
           WE+ + G+ Y     L+ HS+ +  + W P        +  LA++S D T++IW      
Sbjct: 213 WESSK-GKPYG--DALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRR- 268

Query: 187 WECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
             C+  L GH  +V      K  G   L SGS D T+R W
Sbjct: 269 -VCLLTLCGHTSSV---SCVKWGGKNVLYSGSHDKTIRCW 304

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 115/265 (43%), Gaps = 52/265 (19%)

Query: 24  QGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSL-----LAAGSF 78
           + +L +GS D+ I+   +  +    I++L   AH        W  H SL     L  G+F
Sbjct: 289 KNVLYSGSHDKTIRCWDMNLNG-KCINILKSHAH--------WVNHLSLSTDYALRLGAF 339

Query: 79  DSTVSIWAKEESADRTF--EMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWET 136
           D      A  E A +      + +A  +G   E+           + T S D ++++W  
Sbjct: 340 DHKGETPASPEEAQQKALKNYEKVAKRKGDFEEL-----------MVTASDDFTMYLWNP 388

Query: 137 DESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGH 196
            +S +    I+ +  H + V HV + P    + S+S+D+++++W   D  +  ++   GH
Sbjct: 389 LKSTKP---ITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKF--LSTFRGH 443

Query: 197 EGTV----WSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQ 252
             +V    WSSD         L S S D+T++VW        D +       LP  H+ +
Sbjct: 444 VASVYQVAWSSD------CRLLVSCSKDTTLKVW--------DVKTRKLSVDLPG-HQDE 488

Query: 253 VYNVAWGFNG-LIASVGADGVLAVY 276
           VY V W  +G  + S G D ++ ++
Sbjct: 489 VYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 68/170 (40%), Gaps = 29/170 (17%)

Query: 164 SEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTV----WSSDFDKTEGVFRLCSGSD 219
           + + + + + D+T  IW D D     +  L GH   V    WS D +       + +GS 
Sbjct: 155 TSSRMVTGAGDNTACIW-DCDTQTR-MCTLQGHHNWVLCCSWSPDGE------LIATGSM 206

Query: 220 DSTVRVW-----KYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLA 274
           D+T+R+W     K  GD      +W+       +H      V  G    +A+   DG + 
Sbjct: 207 DNTIRLWESSKGKPYGDALRGHSKWITSLSWEPIHL-----VKPGDKPRLATASKDGTIK 261

Query: 275 VYEEVDGEWKVFAKRALCHGVYEINVVKWLELNGKTILATGGDDGIVNFW 324
           +++      +      LC     ++ VKW    GK +L +G  D  +  W
Sbjct: 262 IWDTT----RRVCLLTLCGHTSSVSCVKW---GGKNVLYSGSHDKTIRCW 304

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 78/188 (41%), Gaps = 25/188 (13%)

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIW---------AKEESADRTFEMDLLAIIEGHENEVK 111
           I +V   P    +A G  D  + IW         A E   DR     L A +  H   V 
Sbjct: 20  IYTVDVSPDGKRVATGGLDGKIRIWSVDALVSAAAGESGVDRDTHRPL-ASMSRHTGSVT 78

Query: 112 GVAWSNDGYYLATCSRDKSVWIWETDESG-----------EEYECISVLQEHSQDVKHVI 160
            V +S DG YLA+ S D+ + IW  DE             E +     L  H  D++ + 
Sbjct: 79  CVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVRKRLVAHDNDIQDIC 138

Query: 161 WHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDD 220
           W P  ++L +   D +V +W     ++E +   + H+  V    FD     F   + SDD
Sbjct: 139 WAPDSSILVTVGLDRSVIVWNGL--NFERLKRFDVHQSLVKGVIFDPANKYF--ATASDD 194

Query: 221 STVRVWKY 228
            T+RV++Y
Sbjct: 195 RTMRVFRY 202

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 62/147 (42%), Gaps = 22/147 (14%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           AH   I+ + W P +S+L     D +V +W            + L   + H++ VKGV +
Sbjct: 129 AHDNDIQDICWAPDSSILVTVGLDRSVIVW-------NGLNFERLKRFDVHQSLVKGVIF 181

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
                Y AT S D+++ ++   ++GE           S  ++ VI  P    +AS     
Sbjct: 182 DPANKYFATASDDRTMRVFRYHKTGEV----------SFTIEQVIVEP---FIASPLTTY 228

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWS 202
             R+   +  D + +AV N   G V S
Sbjct: 229 FRRL--SWSPDGQHIAVPNATNGPVSS 253

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 37/189 (19%), Positives = 77/189 (40%), Gaps = 34/189 (17%)

Query: 20  FDFSQGILATGSTDRKIKLVSVKYD---DFTLIDVLDETAHKKAI----RSVAWRP---- 68
           FD +    AT S DR +++          FT+  V+ E      +    R ++W P    
Sbjct: 181 FDPANKYFATASDDRTMRVFRYHKTGEVSFTIEQVIVEPFIASPLTTYFRRLSWSPDGQH 240

Query: 69  ------------HTSLLAAGSFDSTVSIWAKEESAD------RTFEMDLLAIIEGHENEV 110
                         +++  G++DS++S+   +   +      R F+ D+    +  ++E+
Sbjct: 241 IAVPNATNGPVSSVAIINRGTWDSSISLIGHDAPTEVARFNPRLFKSDVEKKAKNAKDEL 300

Query: 111 KGVAWSNDGY--YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALL 168
                +N      +AT  +DKS+ +W T      +    + Q+   D+    W+P+  +L
Sbjct: 301 SKDTKNNKKLESIIATAGQDKSLALWITSRPRPIFVAYDIAQKSITDMA---WNPNGNIL 357

Query: 169 ASSSYDDTV 177
             +S D ++
Sbjct: 358 FVTSLDSSI 366

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 84/181 (46%), Gaps = 16/181 (8%)

Query: 46  FTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEG 105
           FT   ++   AH  ++ ++ +      + +G  D T+ IW  + + +   E+D +     
Sbjct: 114 FTFETIMQ--AHDTSVTTMKYSHAGDWMISGDADGTIKIW--QPNFNMVKELDRI----- 164

Query: 106 HENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSE 165
           H   ++ VA+SN+     TCS D  + IW      +E     VL  H  DV+   WHP  
Sbjct: 165 HTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQE----RVLSGHHWDVRSCDWHPEL 220

Query: 166 ALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRV 225
            L+ S S D+ V++W       +CV+ L   + TV  + F  T+G   L + S D + RV
Sbjct: 221 GLIVSGSKDNLVKLWDPRSG--QCVSTLLKFKHTVLKTRFQPTKGNL-LAAISKDKSCRV 277

Query: 226 W 226
           +
Sbjct: 278 F 278

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 70/168 (41%), Gaps = 14/168 (8%)

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120
           +RS  W P   L+ +GS D+ V +W      D      +  +++     +K       G 
Sbjct: 211 VRSCDWHPELGLIVSGSKDNLVKLW------DPRSGQCVSTLLKFKHTVLKTRFQPTKGN 264

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-SEALLASSSYDDTVRI 179
            LA  S+DKS  +++   S  E  C+        D   + W   +E++     YD +++ 
Sbjct: 265 LLAAISKDKSCRVFDLRASMNELMCV----RDEVDFMELEWSTINESMFTVGCYDGSLKH 320

Query: 180 WKDYDDDWECVAVLN-GHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           +    D  + + ++   HE  + +  ++    +  L + + D T+R W
Sbjct: 321 FDLGQDTEKPIHIIPFAHEKCISAIAYNPVGHI--LATAAKDRTIRFW 366

 Score = 36.2 bits (82), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 76/177 (42%), Gaps = 24/177 (13%)

Query: 110 VKGVAWSNDGYYL--ATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEAL 167
           +  + WS +G  L  AT S + S+W      +G  +   +++Q H   V  + +  +   
Sbjct: 85  IPAIQWSPEGRRLIVATFSGEFSLW------NGSSFTFETIMQAHDTSVTTMKYSHAGDW 138

Query: 168 LASSSYDDTVRIWKDYDDDWECVAVLNG-HEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           + S   D T++IW+    ++  V  L+  H   +    F   +  F  C  SDD+ +++W
Sbjct: 139 MISGDADGTIKIWQ---PNFNMVKELDRIHTEGIRDVAFSNNDSKFVTC--SDDNILKIW 193

Query: 227 KYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFN-GLIASVGADGVLAVYEEVDGE 282
            +     + QQE V        H   V +  W    GLI S   D ++ +++   G+
Sbjct: 194 NF----SNGQQERVLSG-----HHWDVRSCDWHPELGLIVSGSKDNLVKLWDPRSGQ 241

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 36/80 (45%), Gaps = 2/80 (2%)

Query: 13  YKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSL 72
           + E  WS   ++ +   G  D  +K   +  D    I ++   AH+K I ++A+ P   +
Sbjct: 296 FMELEWS-TINESMFTVGCYDGSLKHFDLGQDTEKPIHII-PFAHEKCISAIAYNPVGHI 353

Query: 73  LAAGSFDSTVSIWAKEESAD 92
           LA  + D T+  W +    D
Sbjct: 354 LATAAKDRTIRFWTRARPVD 373

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 83/180 (46%), Gaps = 25/180 (13%)

Query: 56  AHKKAIRSVAWRPHTS-LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
            H   I   A+ PHTS  +  G+ D+T  IW              ++ ++GH N V  V+
Sbjct: 141 GHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTP-------MSTLKGHFNWVLCVS 193

Query: 115 WSNDGYYLATCSRDKSVWIWETDESGEEYECIS-VLQEHSQDVKHVIWHP-------SEA 166
           WS DG  +AT S D ++ +WE    G + + +   L+ H + +  + W P        + 
Sbjct: 194 WSPDGELIATGSMDNTIRLWE----GNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKP 249

Query: 167 LLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            LAS+S D T++IW        C+  L+GH  +V      K  G   L SGS D T+R W
Sbjct: 250 RLASASKDGTIKIWDTTRR--VCLITLSGHTSSV---SCIKWGGQGVLYSGSHDKTIRAW 304

 Score = 63.9 bits (154), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 99/204 (48%), Gaps = 23/204 (11%)

Query: 31  STDRKIKLVSVKYDDFTLIDVLDETAHKKAIRS---VAWRPHT--SLLAAGSFDSTVSIW 85
           STD  +++ +  +D  +      E A K+A+++   +A R      L+   S D T+ +W
Sbjct: 329 STDYALRIGA--FDHTSEKPSTPEEAQKRALKNYEKIAKRNGEVEELMVTASDDFTMYLW 386

Query: 86  AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYEC 145
              +S      M       GH+  V  VA+S DG ++ + S D S+ +W    +G + + 
Sbjct: 387 NPLKSTKPITRM------TGHQKLVNHVAFSPDGRHIVSASFDNSIKLW----NGRDGKF 436

Query: 146 ISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAV-LNGHEGTVWSSD 204
           IS  + H   V  V W     LL S S D T+++W   D   + +AV L GH+  V++ D
Sbjct: 437 ISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW---DVKTKKLAVDLPGHKDEVYTVD 493

Query: 205 FDKTEGVFRLCSGSDDSTVRVWKY 228
           +   +G  R+CSG  D  VR+W +
Sbjct: 494 WS-VDGK-RVCSGGKDKMVRLWTH 515

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/263 (25%), Positives = 116/263 (44%), Gaps = 48/263 (18%)

Query: 24  QGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSL-----LAAGSF 78
           QG+L +GS D+ I+   +       I++L   AH        W  H SL     L  G+F
Sbjct: 289 QGVLYSGSHDKTIRAWDMNLGG-KCINILKSHAH--------WVNHLSLSTDYALRIGAF 339

Query: 79  DSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDE 138
           D T    +  E A +    +   I +    EV+ +        + T S D ++++W   +
Sbjct: 340 DHTSEKPSTPEEAQKRALKNYEKIAK-RNGEVEEL--------MVTASDDFTMYLWNPLK 390

Query: 139 SGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEG 198
           S +    I+ +  H + V HV + P    + S+S+D+++++W   D  +  ++   GH  
Sbjct: 391 STKP---ITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGRDGKF--ISTFRGHVA 445

Query: 199 TV----WSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVY 254
           +V    WSSD         L S S D+T++VW        D +       LP  HK +VY
Sbjct: 446 SVYQVAWSSD------CRLLVSCSKDTTLKVW--------DVKTKKLAVDLPG-HKDEVY 490

Query: 255 NVAWGFNG-LIASVGADGVLAVY 276
            V W  +G  + S G D ++ ++
Sbjct: 491 TVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 69/170 (40%), Gaps = 29/170 (17%)

Query: 164 SEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTV----WSSDFDKTEGVFRLCSGSD 219
           + + + + + D+T RIW    +    ++ L GH   V    WS D +       + +GS 
Sbjct: 155 TSSRMITGAGDNTARIWDC--NTQTPMSTLKGHFNWVLCVSWSPDGE------LIATGSM 206

Query: 220 DSTVRVW-----KYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLA 274
           D+T+R+W     + +GD      +W+       +H      V  G    +AS   DG + 
Sbjct: 207 DNTIRLWEGNKGQPVGDALRGHGKWITSLSWEPIHL-----VKPGQKPRLASASKDGTIK 261

Query: 275 VYEEVDGEWKVFAKRALCHGVYEINVVKWLELNGKTILATGGDDGIVNFW 324
           +++      +      L      ++ +KW    G+ +L +G  D  +  W
Sbjct: 262 IWDTT----RRVCLITLSGHTSSVSCIKW---GGQGVLYSGSHDKTIRAW 304

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 77/183 (42%), Gaps = 26/183 (14%)

Query: 68  PHTSLLAAGSFDSTVSIWA----------KEESADRTFEMDLLAIIEGHENEVKGVAWSN 117
           P +  LA G  D  + IW+             S D+   M  L+ +  H   V  V +S 
Sbjct: 27  PDSQRLATGGLDGKIRIWSIPDILKFASNPNASTDKDILMKPLSTMSRHAGSVTTVKFSP 86

Query: 118 DGYYLATCSRDKSVWIWETD----------ESG--EEYECISVLQEHSQDVKHVIWHPSE 165
           DG YLA+ S D+ + IWE +          ES   E +     L  H  D++ + W P  
Sbjct: 87  DGKYLASGSDDRILLIWELEGGTTQPMFGAESTDIEHWNVRRRLVAHDNDIQDICWAPDS 146

Query: 166 ALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRV 225
           +++ S   D  + IW      +E V   + H+  V    FD     F   + SDD T+++
Sbjct: 147 SIMVSVGLDRAIIIWN--GSTFEKVKRFDVHQSHVKGVVFDPANKYF--ATASDDRTIKM 202

Query: 226 WKY 228
           ++Y
Sbjct: 203 FRY 205

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 83/179 (46%), Gaps = 30/179 (16%)

Query: 27  LATGSTDRKIKLVSV----KY---------DDFTLIDVLDETAHKKAIRSVAWRPHTSLL 73
           LATG  D KI++ S+    K+          D  +  +   + H  ++ +V + P    L
Sbjct: 32  LATGGLDGKIRIWSIPDILKFASNPNASTDKDILMKPLSTMSRHAGSVTTVKFSPDGKYL 91

Query: 74  AAGSFDSTVSIWAKE----------ESADRTFEM-DLLAIIEGHENEVKGVAWSNDGYYL 122
           A+GS D  + IW  E          ES D   E  ++   +  H+N+++ + W+ D   +
Sbjct: 92  ASGSDDRILLIWELEGGTTQPMFGAESTD--IEHWNVRRRLVAHDNDIQDICWAPDSSIM 149

Query: 123 ATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWK 181
            +   D+++ IW    +G  +E +     H   VK V++ P+    A++S D T+++++
Sbjct: 150 VSVGLDRAIIIW----NGSTFEKVKRFDVHQSHVKGVVFDPANKYFATASDDRTIKMFR 204

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 50/108 (46%), Gaps = 17/108 (15%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           AH   I+ + W P +S++ +   D  + IW        TFE   +   + H++ VKGV +
Sbjct: 132 AHDNDIQDICWAPDSSIMVSVGLDRAIIIWNGS-----TFEK--VKRFDVHQSHVKGVVF 184

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP 163
                Y AT S D+++ ++   ++GE           S  V+HVI  P
Sbjct: 185 DPANKYFATASDDRTIKMFRYHKTGET----------SFSVEHVITEP 222

 Score = 31.6 bits (70), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 55/137 (40%), Gaps = 27/137 (19%)

Query: 163 PSEALLASSSYDDTVRIWK---------------DYDDDWECVAVLNGHEGTVWSSDFDK 207
           P    LA+   D  +RIW                D D   + ++ ++ H G+V +  F  
Sbjct: 27  PDSQRLATGGLDGKIRIWSIPDILKFASNPNASTDKDILMKPLSTMSRHAGSVTTVKFSP 86

Query: 208 TEGVFRLCSGSDDSTVRVWK--------YMGDDEDDQQEWVCEAILPDVHKRQVYNVAWG 259
            +G + L SGSDD  + +W+          G +  D + W     L   H   + ++ W 
Sbjct: 87  -DGKY-LASGSDDRILLIWELEGGTTQPMFGAESTDIEHWNVRRRL-VAHDNDIQDICWA 143

Query: 260 FN-GLIASVGADGVLAV 275
            +  ++ SVG D  + +
Sbjct: 144 PDSSIMVSVGLDRAIII 160

>Scas_652.16
          Length = 345

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 111/241 (46%), Gaps = 25/241 (10%)

Query: 105 GHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPS 164
           GHE+ +  V +   G ++ATCS D+ + +++ D+   E+E     + H   +  V W   
Sbjct: 10  GHEDLIHDVVYDFYGRHVATCSSDQHIKVFKLDKETSEWELSDSWKAHDSSIVSVDWASP 69

Query: 165 E--ALLASSSYDDTVRIWKDYDDD-------WECVAVLNGHEGTVWSSDFDKTEGVFRLC 215
           E   ++ S+SYD TV++W++  D        W  +  LN  +G++++  F       +L 
Sbjct: 70  EYGRIIVSASYDKTVKLWEEDPDQPEGSGRRWTKLCTLNDSKGSLYTVKFAPPHLGLKLA 129

Query: 216 SGSDDSTVRVWKYMGDDEDDQQEWVCEA------ILPDVHKRQVYNVAW---GFNGLIAS 266
              +D+T+R+++ +  +  D + W   +      + P  H +  + +AW    F+     
Sbjct: 130 CIGNDATLRIYEAL--EPSDLRSWTLTSEVKVLPVPPANHLQSDFCIAWCPSRFSPEKLV 187

Query: 267 VGADGVLAVYEE-VDGEWKVFAKRALCHGVYEINVVKWLELNGK--TILATGGDDGIVNF 323
           V      ++Y+   DG+  + AK     G+  I  + W    G+   ++ATG  DG +  
Sbjct: 188 VSTLDQASIYQRGKDGKLYIVAKLNGHKGL--IRDISWAPSIGRWYHLIATGCKDGKLRI 245

Query: 324 W 324
           +
Sbjct: 246 F 246

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 80/312 (25%), Positives = 128/312 (41%), Gaps = 57/312 (18%)

Query: 20  FDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDET--AHKKAIRSVAW--RPHTSLLAA 75
           +DF    +AT S+D+ IK+   K D  T    L ++  AH  +I SV W    +  ++ +
Sbjct: 20  YDFYGRHVATCSSDQHIKVF--KLDKETSEWELSDSWKAHDSSIVSVDWASPEYGRIIVS 77

Query: 76  GSFDSTVSIW-----AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKS 130
            S+D TV +W       E S  R  ++  L   +G    VK  A  + G  LA    D +
Sbjct: 78  ASYDKTVKLWEEDPDQPEGSGRRWTKLCTLNDSKGSLYTVK-FAPPHLGLKLACIGNDAT 136

Query: 131 VWIWETDESGE--------EYECISVLQ-EHSQDVKHVIWHPSE---ALLASSSYDDTVR 178
           + I+E  E  +        E + + V    H Q    + W PS      L  S+ D    
Sbjct: 137 LRIYEALEPSDLRSWTLTSEVKVLPVPPANHLQSDFCIAWCPSRFSPEKLVVSTLDQASI 196

Query: 179 IWKDYDDDWECVAVLNGHEGTV----WSSDF------------DKTEGVFRLCSG-SDDS 221
             +  D     VA LNGH+G +    W+               D    +FRL    SD+S
Sbjct: 197 YQRGKDGKLYIVAKLNGHKGLIRDISWAPSIGRWYHLIATGCKDGKLRIFRLVEKLSDNS 256

Query: 222 TVRVWKYMGDDEDDQQEWVCE----AILP-----------DVHKRQVYNVAWGFNG-LIA 265
           +        DDED   E + E    ++L            D H  ++++V+W   G +++
Sbjct: 257 SKDAINDSYDDEDVDMEDIAENKEKSLLGSSVSVELLSEHDDHNAEIWSVSWNLTGTILS 316

Query: 266 SVGADGVLAVYE 277
           S G DG + +++
Sbjct: 317 SAGDDGKVRLWK 328

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 70/160 (43%), Gaps = 25/160 (15%)

Query: 45  DFTLIDVLDETAHKKAIRSVAWRPHTS----LLAAGSFDSTVSIWAKEESADRTFEMDLL 100
           D  L  V     HK  IR ++W P       L+A G  D  + I+   E        D  
Sbjct: 202 DGKLYIVAKLNGHKGLIRDISWAPSIGRWYHLIATGCKDGKLRIFRLVEKLSDNSSKD-- 259

Query: 101 AIIEGHENE---VKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVK 157
           AI + +++E   ++ +A + +   L                S    E +S   +H+ ++ 
Sbjct: 260 AINDSYDDEDVDMEDIAENKEKSLLG---------------SSVSVELLSEHDDHNAEIW 304

Query: 158 HVIWHPSEALLASSSYDDTVRIWKD-YDDDWECVAVLNGH 196
            V W+ +  +L+S+  D  VR+WK  Y ++++C++V+  +
Sbjct: 305 SVSWNLTGTILSSAGDDGKVRLWKSTYSNEFKCMSVITSN 344

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 109/244 (44%), Gaps = 25/244 (10%)

Query: 33  DRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRP-HTSLLAAGSFDSTVSIWAKEESA 91
           +R I+L+    +   L   L+   H   + S++  P   ++L +GS D T+  W K    
Sbjct: 10  ERTIELIMSTDEILVLRGTLE--GHNGWVTSLSTSPAQPNMLLSGSRDKTLITW-KLTGE 66

Query: 92  DRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQE 151
           D+ + + + +  +GH + V+    ++DG Y  + S DK++ +W+  +SG+   CI     
Sbjct: 67  DQQYGVPVRSF-KGHSHIVQDCTVTHDGKYALSASWDKTLRLWDL-QSGK---CIKRFVG 121

Query: 152 HSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHE---GTVWSSDFDKT 208
           H  DV  V   P    + S+S D TV++W    D   CV  L GH      V  +  +K+
Sbjct: 122 HKSDVMSVSIDPRATQIVSASRDKTVKVWNTVGD---CVVTLLGHNDWVSNVRIAPSEKS 178

Query: 209 EGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNG-LIASV 267
           +    + S   D  V+VW        D Q +  EA     H   V  V    +G + AS 
Sbjct: 179 DDAVTVISAGMDKVVKVW--------DLQSFTIEADFIG-HNNYVTTVTPSPDGSIFASA 229

Query: 268 GADG 271
           G DG
Sbjct: 230 GKDG 233

 Score = 31.6 bits (70), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 8/73 (10%)

Query: 71  SLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKS 130
           ++++AG  D  V +W  +     T E D +    GH N V  V  S DG   A+  +D  
Sbjct: 183 TVISAG-MDKVVKVWDLQS---FTIEADFI----GHNNYVTTVTPSPDGSIFASAGKDGQ 234

Query: 131 VWIWETDESGEEY 143
           + +W  +E    Y
Sbjct: 235 IILWNLNEKTALY 247

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 93/212 (43%), Gaps = 24/212 (11%)

Query: 16  KIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDE-TAHKKAIRSVAWRPHTSLLA 74
           KIWS D        GS+    K  S ++D F+  +       H   + S ++ P    L 
Sbjct: 498 KIWSLD--------GSSLINPKYSSSQFDRFSQDNTCSTLVGHSGTVYSTSFSPDNMYLV 549

Query: 75  AGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIW 134
           +GS D TV +W+ +           L   +GH + V  V +S  G+Y A+ S D++  +W
Sbjct: 550 SGSEDKTVKLWSMDTHT-------ALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLW 602

Query: 135 ETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLN 194
             D        + +   H+ DV  V +HP+   + + S D T R+W     D   V +  
Sbjct: 603 ACD----HIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGD--SVRLFL 656

Query: 195 GHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           GH   V S+     +G + L +GS+D  + +W
Sbjct: 657 GHTAPVLSTQV-SPDGRW-LATGSEDGVICLW 686

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 70/266 (26%), Positives = 111/266 (41%), Gaps = 36/266 (13%)

Query: 72  LLAAGSFDSTVSIWAKEESA-----------DRTFEMDLLAIIEGHENEVKGVAWSNDGY 120
           L AAG  DS + IW+ + S+           DR  + +  + + GH   V   ++S D  
Sbjct: 487 LAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGTVYSTSFSPDNM 546

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
           YL + S DK+V +W  D     +  +   + H+  V  V + P     AS+S+D T R+W
Sbjct: 547 YLVSGSEDKTVKLWSMD----THTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLW 602

Query: 181 KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWV 240
               D    + +  GH   V +  F    G + + +GS D T R+W     D        
Sbjct: 603 A--CDHIYPLRIFAGHTNDVDTVSF-HPNGCY-VFTGSSDKTCRMWDVSTGDS------- 651

Query: 241 CEAILPDVHKRQVYNVAWGFNGL-IASVGADGVLAVYEEVDGEWKVFAKRALCHGVYEIN 299
               L   H   V +     +G  +A+   DGV+ +++   G+     K+   HG    N
Sbjct: 652 VRLFL--GHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKR---IKQMRGHGK---N 703

Query: 300 VVKWLELNGK-TILATGGDDGIVNFW 324
            V  L  N +  +L +GG D  V  W
Sbjct: 704 AVHSLSFNKEGNVLISGGADHSVRVW 729

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 64.3 bits (155), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 69/133 (51%), Gaps = 12/133 (9%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRT-FEM-------DLLAIIEGHEN 108
           H  ++ ++ + P    LA+GS D  + IW KEE A +  F+M       ++   +  H+N
Sbjct: 76  HTGSVTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDMENDLEHWNVRRRLVAHDN 135

Query: 109 EVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALL 168
           +++ + W+ D   L T   D+S+ +W    +G  +E I     H   VK V++ P+    
Sbjct: 136 DIQDICWAPDSSILVTVGLDRSIIVW----NGSTFEKIKRFDVHQSHVKGVVFDPANKYF 191

Query: 169 ASSSYDDTVRIWK 181
           A++S D TV++++
Sbjct: 192 ATASDDRTVKVFR 204

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 74/183 (40%), Gaps = 36/183 (19%)

Query: 73  LAAGSFDSTVSIW----------------AKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           +A G  D  + IW                A+EE   +      LA +  H   V  + +S
Sbjct: 32  VATGGLDGKIRIWSVADILVFAKPKVSWPAREEQLRKP-----LANMSRHTGSVTALKFS 86

Query: 117 NDGYYLATCSRDKSVWIWETDESG-----------EEYECISVLQEHSQDVKHVIWHPSE 165
            D  YLA+ S DK + IWE +E             E +     L  H  D++ + W P  
Sbjct: 87  PDNKYLASGSDDKILLIWEKEEGAVQPLFDMENDLEHWNVRRRLVAHDNDIQDICWAPDS 146

Query: 166 ALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRV 225
           ++L +   D ++ +W      +E +   + H+  V    FD     F   + SDD TV+V
Sbjct: 147 SILVTVGLDRSIIVWN--GSTFEKIKRFDVHQSHVKGVVFDPANKYF--ATASDDRTVKV 202

Query: 226 WKY 228
           ++Y
Sbjct: 203 FRY 205

>Scas_673.11
          Length = 434

 Score = 63.5 bits (153), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 105/238 (44%), Gaps = 35/238 (14%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H  ++ ++A  P   L+  G  D+   +W       +         +EGH   V   A++
Sbjct: 68  HTDSVFTIAHHPTLPLVVTGGGDNVAHLWTSHSQPPK-----FAGTLEGHTESVVASAFT 122

Query: 117 NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIW---HPS-EALLASSS 172
           +DG +L T      + + ++++SG ++   S LQE    V+ V+W   HP    + A  +
Sbjct: 123 HDGQFLVTADMTGKIMVHKSNKSGSQWSLTSTLQE----VEEVVWLKCHPVISGVFAFGA 178

Query: 173 YDDTVRIWKDYDDDWECVAVLNG--HEGTVWSSDF---DKTEGVFRLCSGSDDSTVRVW- 226
            D +V  ++  D+D     +++G  H+      +F   D+ E V  L + S DS++  W 
Sbjct: 179 TDGSVWCYQINDNDGSVEQLMSGFIHQQDCTMGEFINIDQGENVLELVTCSVDSSIVGWN 238

Query: 227 --------KYMGDD-EDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAV 275
                   K   D+ +  +  WV  A+ P         +  G +G+IA+   +GVLA+
Sbjct: 239 CFTAQPTFKITKDEIKGLEAPWVSLAVAPS-------KMTNGNSGIIAAGANNGVLAI 289

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/60 (21%), Positives = 27/60 (45%)

Query: 146 ISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDF 205
           ++   +H+  V  +  HP+  L+ +   D+   +W  +    +    L GH  +V +S F
Sbjct: 62  VAYFDKHTDSVFTIAHHPTLPLVVTGGGDNVAHLWTSHSQPPKFAGTLEGHTESVVASAF 121

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 63.9 bits (154), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 80/172 (46%), Gaps = 15/172 (8%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           AH+K I +++  P+ S+ A  S+D T  +W  +         + +A +  H+  +  V++
Sbjct: 493 AHEKDINAISMAPNDSIFATASYDKTCKLWNVDTG-------EPVATLANHKRGLWDVSF 545

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
                ++ATCS DK+V IW    S E +  +  L+ H+  V+   +   +  L S+  D 
Sbjct: 546 CESEKWIATCSGDKTVKIW----SLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADG 601

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
            +++W     D  C+  L+GH   +W+      E    + S   DS  + WK
Sbjct: 602 LIKVWDIASGD--CIKNLDGHSNRIWA--LSVLEDGDLIISADADSVFQFWK 649

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 67/157 (42%), Gaps = 15/157 (9%)

Query: 26  ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIW 85
           I AT S D+  KL +V   +     V     HK+ +  V++      +A  S D TV IW
Sbjct: 509 IFATASYDKTCKLWNVDTGE----PVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIW 564

Query: 86  AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYEC 145
           + E          +L  +EGH N V+  ++ N    L +   D  + +W+   SG   +C
Sbjct: 565 SLES-------FTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDI-ASG---DC 613

Query: 146 ISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKD 182
           I  L  HS  +  +       L+ S+  D   + WKD
Sbjct: 614 IKNLDGHSNRIWALSVLEDGDLIISADADSVFQFWKD 650

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 63/295 (21%), Positives = 120/295 (40%), Gaps = 44/295 (14%)

Query: 47  TLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGH 106
           T+ D+   T +K  I      P   ++     D      A  +  D   E++L    EGH
Sbjct: 339 TVADLCLVTKNKDCIALATNSPSLRIIPLPKID------ADTQDTDLPIEVNLY---EGH 389

Query: 107 ENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDV-----KHVIW 161
            + +  +A + DG +LAT S+DK+  +W  + + + +   +    H+  V      +V+ 
Sbjct: 390 SDLLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAVCLPNVME 449

Query: 162 HPSEALLASSSYDDTVRIWK--DYDDDWECVAVL--------NGHEGTVWSSDFDKTEGV 211
                 + ++S D TV+ W+     +D   V  +        + HE  + +      + +
Sbjct: 450 KNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPNDSI 509

Query: 212 FRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGL-IASVGAD 270
           F   + S D T ++W        D  E V  A L + HKR +++V++  +   IA+   D
Sbjct: 510 F--ATASYDKTCKLWNV------DTGEPV--ATLAN-HKRGLWDVSFCESEKWIATCSGD 558

Query: 271 GVLAVYEEVDGEWKVFAKRALCHGVYEINVVKWLE-LNGKTILATGGDDGIVNFW 324
             + +       W + +   L       N V+    +N +  L + G DG++  W
Sbjct: 559 KTVKI-------WSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVW 606

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 63.9 bits (154), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 77/173 (44%), Gaps = 23/173 (13%)

Query: 62  RSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMD-LLAIIEGHENEVKGVAWSNDGY 120
           +++A+ P    +    F ST+ +W         + M  LL   E HE  V+GV +     
Sbjct: 15  KAIAFHPSRPWVLVALFSSTIQLW--------DYRMGVLLHRFEEHEGPVRGVDFHPTQP 66

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
              +   D S+ +W    S   ++C+  L  H   V+ V +H     + S+S D T+RIW
Sbjct: 67  LFVSAGDDYSIKVW----SLSTHKCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIRIW 122

Query: 181 KDYDDDWEC---VAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMG 230
                +W+    +A L GH   V  + F  TE +  + S S D TVR+W   G
Sbjct: 123 -----NWQNRREIACLTGHNHFVMCAQFHPTEDL--VVSASLDETVRIWDISG 168

 Score = 60.1 bits (144), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 105/252 (41%), Gaps = 57/252 (22%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H+  +R V + P   L  +   D ++ +W+             L  + GH + V+ V + 
Sbjct: 52  HEGPVRGVDFHPTQPLFVSAGDDYSIKVWSLSTH-------KCLFTLNGHLDYVRTVFFH 104

Query: 117 NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDT 176
            +  ++ + S D+++ IW      E    I+ L  H+  V    +HP+E L+ S+S D+T
Sbjct: 105 TELPWIISASDDQTIRIWNWQNRRE----IACLTGHNHFVMCAQFHPTEDLVVSASLDET 160

Query: 177 VRIW--------------KDYDDDW------------ECVA--VLNGH-EGTVWSSDFDK 207
           VRIW              + +++              +CV   +L GH  G  W+S F  
Sbjct: 161 VRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGGFGDCVVKFILEGHTRGVNWAS-FHP 219

Query: 208 TEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEW---VCEAILPDVHKRQVYNVAW-GFNGL 263
           T  +  + SGSDD  V++W+         + W    C       H   V +V +  F  L
Sbjct: 220 TLPL--IVSGSDDRQVKLWRM-----SSTKAWEVDTCRG-----HTNNVDSVIFHPFQNL 267

Query: 264 IASVGADGVLAV 275
           I SVG D  + V
Sbjct: 268 IISVGEDSTIRV 279

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 67/152 (44%), Gaps = 31/152 (20%)

Query: 55  TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIW-----AKEESAD--RTFEMDLLA------ 101
           T H   +    + P   L+ + S D TV IW      K  SA   ++FE  ++       
Sbjct: 134 TGHNHFVMCAQFHPTEDLVVSASLDETVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFD 193

Query: 102 ----------IIEGHENEVKGVAWSNDGYYLA---TCSRDKSVWIWETDESGEEYECISV 148
                     I+EGH    +GV W++    L    + S D+ V +W    S + +E +  
Sbjct: 194 GGFGDCVVKFILEGH---TRGVNWASFHPTLPLIVSGSDDRQVKLWRM-SSTKAWE-VDT 248

Query: 149 LQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
            + H+ +V  VI+HP + L+ S   D T+R+W
Sbjct: 249 CRGHTNNVDSVIFHPFQNLIISVGEDSTIRVW 280

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 61/137 (44%), Gaps = 8/137 (5%)

Query: 97  MDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDV 156
           M +L   E      K +A+     ++       ++ +W+          +   +EH   V
Sbjct: 1   MKMLTKFESKSTRAKAIAFHPSRPWVLVALFSSTIQLWDYRMG----VLLHRFEEHEGPV 56

Query: 157 KHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCS 216
           + V +HP++ L  S+  D ++++W       +C+  LNGH   V +  F  TE  + + S
Sbjct: 57  RGVDFHPTQPLFVSAGDDYSIKVWS--LSTHKCLFTLNGHLDYVRTV-FFHTELPW-IIS 112

Query: 217 GSDDSTVRVWKYMGDDE 233
            SDD T+R+W +    E
Sbjct: 113 ASDDQTIRIWNWQNRRE 129

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 96/236 (40%), Gaps = 45/236 (19%)

Query: 20  FDFSQGILATGSTDRKIKL--VSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGS 77
           F  +Q +  +   D  IK+  +S     FTL        H   +R+V +      + + S
Sbjct: 61  FHPTQPLFVSAGDDYSIKVWSLSTHKCLFTL------NGHLDYVRTVFFHTELPWIISAS 114

Query: 78  FDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETD 137
            D T+ IW  +   +       +A + GH + V    +      + + S D++V IW+  
Sbjct: 115 DDQTIRIWNWQNRRE-------IACLTGHNHFVMCAQFHPTEDLVVSASLDETVRIWDIS 167

Query: 138 -----------ESGEEY-------------ECIS--VLQEHSQDVKHVIWHPSEALLASS 171
                      +S EE              +C+   +L+ H++ V    +HP+  L+ S 
Sbjct: 168 GLRKRHSAPGSQSFEEQMITQQNLFDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSG 227

Query: 172 SYDDTVRIWK-DYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           S D  V++W+      WE V    GH   V S  F   + +  + S  +DST+RVW
Sbjct: 228 SDDRQVKLWRMSSTKAWE-VDTCRGHTNNVDSVIFHPFQNL--IISVGEDSTIRVW 280

 Score = 32.0 bits (71), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 38/82 (46%), Gaps = 5/82 (6%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H + +   ++ P   L+ +GS D  V +W    S+ + +E+D      GH N V  V + 
Sbjct: 208 HTRGVNWASFHPTLPLIVSGSDDRQVKLW--RMSSTKAWEVD---TCRGHTNNVDSVIFH 262

Query: 117 NDGYYLATCSRDKSVWIWETDE 138
                + +   D ++ +W+ D+
Sbjct: 263 PFQNLIISVGEDSTIRVWDLDK 284

>CAGL0J08778g 866175..867071 highly similar to sp|Q04491
           Saccharomyces cerevisiae YLR208w SEC13, start by
           similarity
          Length = 298

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 75/289 (25%), Positives = 127/289 (43%), Gaps = 38/289 (13%)

Query: 20  FDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAW-RPH-TSLLAAGS 77
            D+    LAT S+D+ IK+  V+ +   L+D L    H+  +  V W  P   ++LA+ S
Sbjct: 17  LDYYGKKLATCSSDKTIKIFEVEGESHKLVDTL--VGHEGPVWRVDWAHPKFGTILASCS 74

Query: 78  FDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSND--GYYLATCSRDKSVWIWE 135
           +D  V IW +E   DR  ++ + A+   H   V  V W+    G  L   S D  V + E
Sbjct: 75  YDGKVIIWKEEN--DRWSQIAVHAV---HTASVNSVQWAPHEYGALLLAASSDGKVSVVE 129

Query: 136 TDESGEEYECISVLQEHSQDVKHVIW---------HPSEAL-----LASSSYDDTVRIWK 181
             E+G     I     H+  V    W         +P EA        +   D+ V+IW+
Sbjct: 130 FKENGTATPLI--FDAHAIGVNAASWAPATVEGGNNPGEAPKEVRRFVTGGADNLVKIWR 187

Query: 182 DYDDDWECVAVLNGHEG-TVWSSDFDKTEGVF---RLCSGSDDSTVRVWKYMGDDEDDQQ 237
            Y+ + +   V +  EG + W  D   +  V     + S S D T  +W      ED+  
Sbjct: 188 -YNPETQSYLVEDTLEGHSDWVRDVAWSPSVLLRSYIASVSQDRTCNIWT----QEDNTG 242

Query: 238 EWVCEAILPDVHKRQVYNVAWGFNGLIASV-GADGVLAVYEE-VDGEWK 284
            WV   + P+     ++  +W  +G I ++ G D  + +++E ++G+W+
Sbjct: 243 PWVKTQLTPEEFPDVLWRASWSLSGNILAISGGDNKVTLWKENLNGKWE 291

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 62/129 (48%), Gaps = 4/129 (3%)

Query: 99  LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKH 158
           ++ I   H + +        G  LATCS DK++ I+E +  GE ++ +  L  H   V  
Sbjct: 1   MVEIANAHNDLIHDAVLDYYGKKLATCSSDKTIKIFEVE--GESHKLVDTLVGHEGPVWR 58

Query: 159 VIW-HPS-EALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCS 216
           V W HP    +LAS SYD  V IWK+ +D W  +AV   H  +V S  +   E    L +
Sbjct: 59  VDWAHPKFGTILASCSYDGKVIIWKEENDRWSQIAVHAVHTASVNSVQWAPHEYGALLLA 118

Query: 217 GSDDSTVRV 225
            S D  V V
Sbjct: 119 ASSDGKVSV 127

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 102/251 (40%), Gaps = 35/251 (13%)

Query: 3   SINLIKSLKLYKEKIWSFDFSQG----ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHK 58
           S  L+ +L  ++  +W  D++      ILA+ S D K+ +   + D ++ I V     H 
Sbjct: 42  SHKLVDTLVGHEGPVWRVDWAHPKFGTILASCSYDGKVIIWKEENDRWSQIAV--HAVHT 99

Query: 59  KAIRSVAWRPHT--SLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
            ++ SV W PH   +LL A S D  VS+   +E+   T       I + H   V   +W+
Sbjct: 100 ASVNSVQWAPHEYGALLLAASSDGKVSVVEFKENGTAT-----PLIFDAHAIGVNAASWA 154

Query: 117 --------NDG------YYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWH 162
                   N G          T   D  V IW  +   + Y     L+ HS  V+ V W 
Sbjct: 155 PATVEGGNNPGEAPKEVRRFVTGGADNLVKIWRYNPETQSYLVEDTLEGHSDWVRDVAWS 214

Query: 163 PSEAL---LASSSYDDTVRIWKDYDDDWECVAVLNGHE---GTVWSSDFDKTEGVFRLCS 216
           PS  L   +AS S D T  IW   D+    V      E     +W + +  +  +  +  
Sbjct: 215 PSVLLRSYIASVSQDRTCNIWTQEDNTGPWVKTQLTPEEFPDVLWRASWSLSGNILAISG 274

Query: 217 GSDDSTVRVWK 227
           G  D+ V +WK
Sbjct: 275 G--DNKVTLWK 283

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 63.2 bits (152), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 84/186 (45%), Gaps = 18/186 (9%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           AH  A+ ++ +   +  + +G  D  + IW         F M +  I   H   ++ +A+
Sbjct: 133 AHDSAVTTMKYSHDSDWMISGDADGMIKIWQPN------FSM-VKEIDAAHTESIRDMAF 185

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
           S++     TCS D  + IW      +E     VL  H  DVK   WHP   L+AS+S D+
Sbjct: 186 SSNDSKFVTCSDDNILKIWNFSNGKQE----RVLSGHHWDVKSCDWHPEMGLIASASKDN 241

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDD 235
            V++W     +  C++ +   + TV  + F  T+G   L + S D + RV+    D    
Sbjct: 242 LVKLWDPRSGN--CISSILKFKHTVLKTRFQPTKGNL-LMAISKDKSCRVF----DIRYS 294

Query: 236 QQEWVC 241
            +E +C
Sbjct: 295 MKELMC 300

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 73/168 (43%), Gaps = 14/168 (8%)

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120
           ++S  W P   L+A+ S D+ V +W      D      + +I++     +K       G 
Sbjct: 222 VKSCDWHPEMGLIASASKDNLVKLW------DPRSGNCISSILKFKHTVLKTRFQPTKGN 275

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-SEALLASSSYDDTVRI 179
            L   S+DKS  +++   S +E  C+        D   + WHP +E++   + YD +++ 
Sbjct: 276 LLMAISKDKSCRVFDIRYSMKELMCV----RDETDYMTLEWHPINESMFTLACYDGSLKH 331

Query: 180 WKDYDDDWECVAVLN-GHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           +    +  E +  +   H+  + S  ++    +F   + + D T+R W
Sbjct: 332 FDLLQNLNEPILTIPYAHDKCITSLSYNPVGHIF--ATAAKDRTIRFW 377

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 70/148 (47%), Gaps = 21/148 (14%)

Query: 38  LVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIW----AKEESADR 93
           ++ +   +F+++  +D  AH ++IR +A+  + S     S D+ + IW     K+E    
Sbjct: 158 MIKIWQPNFSMVKEID-AAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQER--- 213

Query: 94  TFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHS 153
                   ++ GH  +VK   W  +   +A+ S+D  V +W+   SG    CIS + +  
Sbjct: 214 --------VLSGHHWDVKSCDWHPEMGLIASASKDNLVKLWDP-RSG---NCISSILKFK 261

Query: 154 QDVKHVIWHPSEA-LLASSSYDDTVRIW 180
             V    + P++  LL + S D + R++
Sbjct: 262 HTVLKTRFQPTKGNLLMAISKDKSCRVF 289

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 63.5 bits (153), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 99/205 (48%), Gaps = 24/205 (11%)

Query: 27  LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWA 86
           +  GS D K+++    Y+  T   V +  AH   IRS+A  P    +  GS D T+ +W 
Sbjct: 70  VVVGSDDFKLRV----YNYNTGEKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWN 125

Query: 87  KEES--ADRTFEMDLLAIIEGHENEVKGVAWS-NDGYYLATCSRDKSVWIWETDESGEEY 143
            E++    +TF         GHE+ V  VA++  D    A+   D ++ +W     G++ 
Sbjct: 126 WEKNWGCQQTF--------TGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSI---GQDV 174

Query: 144 ECISVLQEHSQDVKHVIWHP--SEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVW 201
              ++    ++ V +V ++P   +  L ++S D T+++W DY      VA L GH   V 
Sbjct: 175 PNFTLKAHETKGVNYVDYYPLQDKPYLITTSDDGTIKVW-DYQTK-SNVATLEGHMANVS 232

Query: 202 SSDFDKTEGVFRLCSGSDDSTVRVW 226
            + F  T  +  + SGS+D T+++W
Sbjct: 233 YAVFHPTLPI--IISGSEDGTLKIW 255

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 55/129 (42%), Gaps = 7/129 (5%)

Query: 103 IEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWH 162
            E H + ++ +A      ++ T S D ++ +W  +++   + C      H   V  V ++
Sbjct: 93  FEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKN---WGCQQTFTGHEHFVMSVAFN 149

Query: 163 PSEA-LLASSSYDDTVRIWKDYDDDWECVAVLNGHEGT-VWSSDFDKTEGVFRLCSGSDD 220
           P +    AS   D T+++W    D       L  HE   V   D+   +    L + SDD
Sbjct: 150 PKDPNQFASGCLDHTIKVWSIGQDVPNFT--LKAHETKGVNYVDYYPLQDKPYLITTSDD 207

Query: 221 STVRVWKYM 229
            T++VW Y 
Sbjct: 208 GTIKVWDYQ 216

>YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in
           complex with nuclear pore proteins, member of WD (WD-40)
           repeat family [1050 bp, 349 aa]
          Length = 349

 Score = 62.4 bits (150), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 109/241 (45%), Gaps = 25/241 (10%)

Query: 105 GHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPS 164
           GH++ V  V +   G ++ATCS D+ + +++ D+    +E     + H   +  + W   
Sbjct: 7   GHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASP 66

Query: 165 E--ALLASSSYDDTVRIWKDYDDDWEC-------VAVLNGHEGTVWSSDFDKTEGVFRLC 215
           E   ++AS+SYD TV++W++  D  EC       +  LN  +G+++S  F       +L 
Sbjct: 67  EYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLA 126

Query: 216 SGSDDSTVRVWKYMGDDEDDQQEWVCE------AILPDVHKRQVYNVAW---GFNGLIAS 266
              +D  +R++  +  +  D + W         +I P  H +  + ++W    F+    +
Sbjct: 127 CLGNDGILRLYDAL--EPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPEKLA 184

Query: 267 VGADGVLAVYEE-VDGEWKVFAKRALCHGVYEINVVKWLELNGK--TILATGGDDGIVNF 323
           V A     +Y+   DG+  V AK  L      I  + W    G+   ++ATG  DG +  
Sbjct: 185 VSALEQAIIYQRGKDGKLHVAAK--LPGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRI 242

Query: 324 W 324
           +
Sbjct: 243 F 243

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 66/150 (44%), Gaps = 16/150 (10%)

Query: 55  TAHKKAIRSVAWRPHT----SLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEV 110
             HK  IRS++W P       L+A G  D  + I+   E          L+ +   E+  
Sbjct: 209 PGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRIFKITEK---------LSPLASEESLT 259

Query: 111 KGVAWSN--DGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALL 168
               + N  D    A    D +       +S  + E +S   +H+ +V  V W+ +  +L
Sbjct: 260 NSNMFDNSADVDMDAQGRSDSNTEEKAELQSNLQVELLSEHDDHNGEVWSVSWNLTGTIL 319

Query: 169 ASSSYDDTVRIWK-DYDDDWECVAVLNGHE 197
           +S+  D  VR+WK  Y ++++C++V+   +
Sbjct: 320 SSAGDDGKVRLWKATYSNEFKCMSVITAQQ 349

 Score = 32.0 bits (71), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 104/236 (44%), Gaps = 27/236 (11%)

Query: 58  KKAIRSVAWRP-HTSL-LAAGSFDSTVSIWAKEESADR-----TFEMDLLAIIEG-HENE 109
           K ++ SV + P H  L LA    D  + ++   E +D      T EM +L+I    H   
Sbjct: 108 KGSLYSVKFAPAHLGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQS 167

Query: 110 VKGVAWSNDGY---YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPS-- 164
              ++W    +    LA  + ++++ I++  + G+ +   + L  H   ++ + W PS  
Sbjct: 168 DFCLSWCPSRFSPEKLAVSALEQAI-IYQRGKDGKLH-VAAKLPGHKSLIRSISWAPSIG 225

Query: 165 --EALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDST 222
               L+A+   D  +RI+K      E ++ L   E    S+ FD +  V     G  DS 
Sbjct: 226 RWYQLIATGCKDGRIRIFKIT----EKLSPLASEESLTNSNMFDNSADVDMDAQGRSDSN 281

Query: 223 VRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNG-LIASVGADGVLAVYE 277
                 +    + Q E + E    D H  +V++V+W   G +++S G DG + +++
Sbjct: 282 TEEKAEL--QSNLQVELLSEH---DDHNGEVWSVSWNLTGTILSSAGDDGKVRLWK 332

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 75/161 (46%), Gaps = 14/161 (8%)

Query: 72  LLAAGSFDSTVSIWAKEESA------DRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATC 125
           L AAG  DST+ +W  + S        +  +    A + GH   V  VA+S D  YL + 
Sbjct: 512 LTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLSA 571

Query: 126 SRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDD 185
           S DK+V +W  D     + C+   + H+  V +V + P      ++S+D T R+W    D
Sbjct: 572 SEDKTVRLWSLD----TFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWS--CD 625

Query: 186 DWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
               + + +GH   V  S F    G + + +GS D T R+W
Sbjct: 626 HIYPLRIFSGHLNDVDCSTF-HPNGCY-VFTGSSDKTCRMW 664

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 93/213 (43%), Gaps = 31/213 (14%)

Query: 16  KIWSFDFS--QGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLL 73
           K+W  D S  Q IL + + D+         +  TL+       H   + SVA+ P    L
Sbjct: 523 KVWYLDGSPLQSILPSKAKDQS--------NSATLV------GHSGPVYSVAFSPDNRYL 568

Query: 74  AAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWI 133
            + S D TV +W+ +     TF    L   +GH + V  V +S  G+Y  T S D++  +
Sbjct: 569 LSASEDKTVRLWSLD-----TFT--CLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARL 621

Query: 134 WETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVL 193
           W  D        + +   H  DV    +HP+   + + S D T R+W     D   V + 
Sbjct: 622 WSCD----HIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGD--SVRLF 675

Query: 194 NGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            GH   V + +    +G + L +GS+D T+ VW
Sbjct: 676 LGHTSPVTALEVSP-DGRW-LTTGSEDGTIIVW 706

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 55/127 (43%), Gaps = 12/127 (9%)

Query: 55  TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
           + H   +    + P+   +  GS D T  +W  +         D + +  GH + V  + 
Sbjct: 634 SGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTG-------DSVRLFLGHTSPVTALE 686

Query: 115 WSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA-LLASSSY 173
            S DG +L T S D ++ +W+   +G+    I  ++ H ++  + I    E   L +   
Sbjct: 687 VSPDGRWLTTGSEDGTIIVWDIG-TGKR---IKQMKGHGKNPIYSITFNKEGNCLVTGGA 742

Query: 174 DDTVRIW 180
           D +VR+W
Sbjct: 743 DQSVRVW 749

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 56/121 (46%), Gaps = 16/121 (13%)

Query: 29  TGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKE 88
           TGS+D+  ++  ++  D   + +     H   + ++   P    L  GS D T+ +W   
Sbjct: 654 TGSSDKTCRMWDIQTGDSVRLFL----GHTSPVTALEVSPDGRWLTTGSEDGTIIVW-DI 708

Query: 89  ESADRTFEMDLLAIIEGH-ENEVKGVAWSNDGYYLATCSRDKSVWIWE----TDESGEEY 143
            +  R  +M      +GH +N +  + ++ +G  L T   D+SV +W+    T+E G E 
Sbjct: 709 GTGKRIKQM------KGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIKRFTNEPGMEP 762

Query: 144 E 144
           E
Sbjct: 763 E 763

>KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomyces
           cerevisiae YLR222c, start by similarity
          Length = 814

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 77/172 (44%), Gaps = 19/172 (11%)

Query: 31  STDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEES 90
           ++D    L+ VK  ++T        AH+K I +++  P+ SL A  S+D T  IW  ++ 
Sbjct: 474 TSDEPEDLILVKTSEYT------RRAHEKDINAISISPNDSLFATASYDKTCKIWNLDDG 527

Query: 91  ADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQ 150
                  +  A +  H+  +  VA+      LATCS DK++ IW    S E Y  +  L+
Sbjct: 528 -------EFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIW----SLESYAVVKTLE 576

Query: 151 EHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWS 202
            H+  V+   +      L S+  D  V IW       E V  L+ H   +W+
Sbjct: 577 GHTNAVQRCSFINKNKQLISTGADGLVIIWD--LSTGESVKTLDAHNNRIWA 626

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 85/192 (44%), Gaps = 27/192 (14%)

Query: 105 GHENEVKGVAWSND-----GYYLATCSRDKSVWIWETDE--SGEEYECISV------LQE 151
           GH   V  V   N        ++ T S D ++  W+  +  S E  + I V       + 
Sbjct: 434 GHVGSVNAVGLPNVMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRA 493

Query: 152 HSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGV 211
           H +D+  +   P+++L A++SYD T +IW    DD E  A L  H+  +W   F + + +
Sbjct: 494 HEKDINAISISPNDSLFATASYDKTCKIWN--LDDGEFQATLANHKRGLWDVAFCQYDKL 551

Query: 212 FRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAW-GFNGLIASVGAD 270
              CSG  D T+++W          + +     L + H   V   ++   N  + S GAD
Sbjct: 552 LATCSG--DKTIKIWSL--------ESYAVVKTL-EGHTNAVQRCSFINKNKQLISTGAD 600

Query: 271 GVLAVYEEVDGE 282
           G++ +++   GE
Sbjct: 601 GLVIIWDLSTGE 612

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 63/282 (22%), Positives = 114/282 (40%), Gaps = 43/282 (15%)

Query: 68  PHTSLLAAGSFDSTVSIWAKEESADRTFEMDL--------LAIIEGHENEVKGVAWSNDG 119
           P    LA  +   T+ I     S++  FE           + + EGH + +  +  + DG
Sbjct: 343 PKRDKLALATNSPTLRIIPTPTSSEEEFENGENKETFPIEVKMYEGHTDLLNSLDATADG 402

Query: 120 YYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDV-----KHVIWHPSEALLASSSYD 174
            ++AT S+D SV +W      E++   +    H   V      +V+       + ++S D
Sbjct: 403 LWVATASKDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAVGLPNVMPRSWPEFIITASND 462

Query: 175 DTVRIWK------DYDDDWECVA----VLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVR 224
            T++ WK      D  +D   V         HE  + +      + +F   + S D T +
Sbjct: 463 LTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISPNDSLF--ATASYDKTCK 520

Query: 225 VWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAW-GFNGLIASVGADGVLAVYEEVDGEW 283
           +W    DD + Q      A L + HKR +++VA+  ++ L+A+   D  + ++       
Sbjct: 521 IWNL--DDGEFQ------ATLAN-HKRGLWDVAFCQYDKLLATCSGDKTIKIW-----SL 566

Query: 284 KVFAKRALCHGVYEINVVKWLE-LNGKTILATGGDDGIVNFW 324
           + +A      G    N V+    +N    L + G DG+V  W
Sbjct: 567 ESYAVVKTLEG--HTNAVQRCSFINKNKQLISTGADGLVIIW 606

 Score = 35.0 bits (79), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 61/140 (43%), Gaps = 18/140 (12%)

Query: 9   SLKLYKEKIWSFDFSQ--GILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAW 66
           +L  +K  +W   F Q   +LAT S D+ IK+ S+  + + ++  L+   H  A++  ++
Sbjct: 532 TLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSL--ESYAVVKTLE--GHTNAVQRCSF 587

Query: 67  RPHTSLLAAGSFDSTVSIW--AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLAT 124
                 L +   D  V IW  +  ES         +  ++ H N +  +A  NDG    T
Sbjct: 588 INKNKQLISTGADGLVIIWDLSTGES---------VKTLDAHNNRIWALAVMNDGESFVT 638

Query: 125 CSRDKSVWIWETDESGEEYE 144
              D     W  D S EE+E
Sbjct: 639 ADADGFFEFWR-DNSEEEHE 657

>Scas_585.8
          Length = 460

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 78/186 (41%), Gaps = 18/186 (9%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           AH  A+  + +      + +G  D  + IW    +  + FE         H   ++ +++
Sbjct: 129 AHDSAVSCIQYSHAGDWMCSGDADGGIKIWQPNFNMVKEFE-------NAHTECIRDISF 181

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
           SN+     TCS D  + IW       E      L  H  D+K   WHP   L+ S+S D+
Sbjct: 182 SNNDSKFVTCSDDNVLKIWNFSNGQVE----RTLSGHHWDIKSCDWHPEMGLIVSASKDN 237

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDD 235
            V++W       +C++ +   + TV  + F  T G   L + S D + RV+    D    
Sbjct: 238 LVKLWDPRSG--QCISTIIKFKHTVLKTRFQPTRGNL-LAAISKDKSCRVF----DIRHS 290

Query: 236 QQEWVC 241
            +E +C
Sbjct: 291 MKELMC 296

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 72/169 (42%), Gaps = 16/169 (9%)

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120
           I+S  W P   L+ + S D+ V +W      D      +  II+     +K       G 
Sbjct: 218 IKSCDWHPEMGLIVSASKDNLVKLW------DPRSGQCISTIIKFKHTVLKTRFQPTRGN 271

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-SEALLASSSYDDTVRI 179
            LA  S+DKS  +++   S +E  C+        D   + W+P +E++    +YD  ++ 
Sbjct: 272 LLAAISKDKSCRVFDIRHSMKELMCV----RDEVDYMTLTWNPINESMFTVGNYDGAMKY 327

Query: 180 WKDYDDDWECVA--VLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           + D   D E  +  +   H+  V S  ++    +  L S S D T+R W
Sbjct: 328 F-DLLQDLEGPSHVIPYAHDKCVTSMAYNPAGNI--LASASKDRTIRFW 373

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/252 (21%), Positives = 107/252 (42%), Gaps = 32/252 (12%)

Query: 27  LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWA 86
           + +G  D  IK+      +F ++    E AH + IR +++  + S     S D+ + IW 
Sbjct: 146 MCSGDADGGIKIWQ---PNFNMVKEF-ENAHTECIRDISFSNNDSKFVTCSDDNVLKIWN 201

Query: 87  -KEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYEC 145
                 +RT        + GH  ++K   W  +   + + S+D  V +W+   SG   +C
Sbjct: 202 FSNGQVERT--------LSGHHWDIKSCDWHPEMGLIVSASKDNLVKLWDP-RSG---QC 249

Query: 146 ISVLQEHSQDVKHVIWHPSEA-LLASSSYDDTVRIW--KDYDDDWECVAVLNGHEGTVWS 202
           IS + +    V    + P+   LLA+ S D + R++  +    +  CV     +    W+
Sbjct: 250 ISTIIKFKHTVLKTRFQPTRGNLLAAISKDKSCRVFDIRHSMKELMCVRDEVDYMTLTWN 309

Query: 203 SDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNG 262
                 E +F +  G+ D  ++ +  + D E          ++P  H + V ++A+   G
Sbjct: 310 P---INESMFTV--GNYDGAMKYFDLLQDLEGPSH------VIPYAHDKCVTSMAYNPAG 358

Query: 263 -LIASVGADGVL 273
            ++AS   D  +
Sbjct: 359 NILASASKDRTI 370

 Score = 33.5 bits (75), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 22/37 (59%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESAD 92
           AH K + S+A+ P  ++LA+ S D T+  W + +  D
Sbjct: 344 AHDKCVTSMAYNPAGNILASASKDRTIRFWTRAKPVD 380

>Kwal_47.17465
          Length = 800

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 67/135 (49%), Gaps = 12/135 (8%)

Query: 55  TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTF---EMD-----LLAIIEGH 106
           + H  ++  V + P  + LA+GS D  + IW K+E   +     E D     +   +  H
Sbjct: 19  SRHTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVRRRLVAH 78

Query: 107 ENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA 166
           +N+++ + W+ D   L T   D+SV +W    +G  +E I     H   VK VI+ P+  
Sbjct: 79  DNDIQDICWAPDSSILVTVGLDRSVIVW----NGSTFEKIKRFDVHQSLVKGVIFDPANK 134

Query: 167 LLASSSYDDTVRIWK 181
             A++S D TVRI++
Sbjct: 135 YFATASDDRTVRIFR 149

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 63/140 (45%), Gaps = 15/140 (10%)

Query: 100 LAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDE-----------SGEEYECISV 148
           LA +  H   V  V +S DG +LA+ S D+ + IWE DE             E +     
Sbjct: 15  LASMSRHTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVRRR 74

Query: 149 LQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKT 208
           L  H  D++ + W P  ++L +   D +V +W      +E +   + H+  V    FD  
Sbjct: 75  LVAHDNDIQDICWAPDSSILVTVGLDRSVIVWN--GSTFEKIKRFDVHQSLVKGVIFDPA 132

Query: 209 EGVFRLCSGSDDSTVRVWKY 228
              F   + SDD TVR+++Y
Sbjct: 133 NKYF--ATASDDRTVRIFRY 150

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 63/147 (42%), Gaps = 22/147 (14%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           AH   I+ + W P +S+L     D +V +W        TFE   +   + H++ VKGV +
Sbjct: 77  AHDNDIQDICWAPDSSILVTVGLDRSVIVWNGS-----TFEK--IKRFDVHQSLVKGVIF 129

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
                Y AT S D++V I+   ++G          + S  ++HV+  P +    ++ +  
Sbjct: 130 DPANKYFATASDDRTVRIFRYHKAG----------DMSFSIEHVVSEPFKGSPITTYFRR 179

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWS 202
                  +  D + +A  N   G V S
Sbjct: 180 L-----SWSPDGQHIAAPNATNGPVSS 201

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 105/231 (45%), Gaps = 39/231 (16%)

Query: 17  IWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAG 76
           I    F    + TG+ D+ I++    YD      +L  + H   + ++ +  H  +L +G
Sbjct: 385 ITCLQFEDNYVITGADDKMIRV----YDSINKKFLLQLSGHDGGVWALKYA-HGGILVSG 439

Query: 77  SFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVK--GVAWSNDGYYLATCSRDKSVWIW 134
           S D TV +W  ++            + +GH + V+   +    +  Y+ T SRD ++ +W
Sbjct: 440 STDRTVRVWDIKKGC-------CTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVW 492

Query: 135 E------TDESGEEYE-------------CISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
           +        + GEE++              + VL+ H   V+ V  H +  ++ S SYD+
Sbjct: 493 KLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTVSGHGN--IVVSGSYDN 550

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           T+ +W       +C+ +L+GH   ++S+ +D      R  S S D+T+R+W
Sbjct: 551 TLIVWDVAQ--MKCLYILSGHTDRIYSTIYDHERK--RCISASMDTTIRIW 597

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 89/200 (44%), Gaps = 33/200 (16%)

Query: 17  IWSFDFSQG-ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSL--L 73
           +W+  ++ G IL +GSTDR +++  +K    T +       H   +R +    + ++  +
Sbjct: 425 VWALKYAHGGILVSGSTDRTVRVWDIKKGCCTHV----FKGHNSTVRCLDIVEYKNIKYI 480

Query: 74  AAGSFDSTVSIW--AKEES-ADRTFEMD-------------LLAIIEGHENEVKGVAWSN 117
             GS D+T+ +W   KE S  D   E D              + ++ GH   V+ V  S 
Sbjct: 481 VTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTV--SG 538

Query: 118 DGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTV 177
            G  + + S D ++ +W+      + +C+ +L  H+  +   I+        S+S D T+
Sbjct: 539 HGNIVVSGSYDNTLIVWDV----AQMKCLYILSGHTDRIYSTIYDHERKRCISASMDTTI 594

Query: 178 RIWKDYDDDW---ECVAVLN 194
           RIW D ++ W   EC    N
Sbjct: 595 RIW-DLENIWNNGECSYATN 613

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 166 ALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRV 225
            +L S S D TVR+W D      C  V  GH  TV   D  + + +  + +GS D+T+ V
Sbjct: 434 GILVSGSTDRTVRVW-DIKKGC-CTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHV 491

Query: 226 WK 227
           WK
Sbjct: 492 WK 493

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 75/173 (43%), Gaps = 23/173 (13%)

Query: 62  RSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMD-LLAIIEGHENEVKGVAWSNDGY 120
           + +A+ P    +    F ST+ +W         + M  LL   E HE  V+G+ +     
Sbjct: 15  KGIAFHPSRPWVLVALFSSTIQLW--------DYRMGVLLHRFEDHEGPVRGIDFHPTQP 66

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
              +   D ++ +W    S E  +C+  L  H   V+ V +H     + SSS D T+RIW
Sbjct: 67  LFVSAGDDYTIKVW----SLESNKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRIW 122

Query: 181 KDYDDDWEC---VAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMG 230
                +W+    +A L GH   V  + F   E +  + S S D TVRVW   G
Sbjct: 123 -----NWQNRKEIACLTGHNHFVMCAQFHPVEDL--VVSASLDETVRVWDISG 168

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 91/200 (45%), Gaps = 43/200 (21%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H+  +R + + P   L  +   D T+ +W+ E +         L  ++GH + V+ V + 
Sbjct: 52  HEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLESNK-------CLFTLDGHLDYVRTVFFH 104

Query: 117 NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDT 176
           ++  ++ + S D+++ IW      E    I+ L  H+  V    +HP E L+ S+S D+T
Sbjct: 105 HELPWIISSSDDQTIRIWNWQNRKE----IACLTGHNHFVMCAQFHPVEDLVVSASLDET 160

Query: 177 VRIW--------------KDYDDDW------------ECVA--VLNGH-EGTVWSSDFDK 207
           VR+W              + +++              +CV   +L GH  G  W+S F  
Sbjct: 161 VRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLDGGFGDCVVKFILEGHTRGVNWAS-FHP 219

Query: 208 TEGVFRLCSGSDDSTVRVWK 227
           T  +  + SGSDD  V++W+
Sbjct: 220 TLPL--IVSGSDDRQVKLWR 237

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 66/152 (43%), Gaps = 31/152 (20%)

Query: 55  TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIW-----AKEESAD--RTFE------MDLL- 100
           T H   +    + P   L+ + S D TV +W      K  SA   ++FE       +LL 
Sbjct: 134 TGHNHFVMCAQFHPVEDLVVSASLDETVRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLD 193

Query: 101 ---------AIIEGHENEVKGVAWSNDGYYLA---TCSRDKSVWIWETDESGEEYECISV 148
                     I+EGH    +GV W++    L    + S D+ V +W    S  +   +  
Sbjct: 194 GGFGDCVVKFILEGH---TRGVNWASFHPTLPLIVSGSDDRQVKLWRM--SATKAWEVDT 248

Query: 149 LQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
            + H+ +V  VI+HP + L+ S   D TVR+W
Sbjct: 249 CRGHTNNVDSVIFHPQQNLIISVGEDKTVRVW 280

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/143 (21%), Positives = 60/143 (41%), Gaps = 20/143 (13%)

Query: 97  MDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDV 156
           M +L   E      KG+A+     ++       ++ +W+          +   ++H   V
Sbjct: 1   MKMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGV----LLHRFEDHEGPV 56

Query: 157 KHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFR--- 213
           + + +HP++ L  S+  D T+++W    +  +C+  L+GH         D    VF    
Sbjct: 57  RGIDFHPTQPLFVSAGDDYTIKVWSLESN--KCLFTLDGH--------LDYVRTVFFHHE 106

Query: 214 ---LCSGSDDSTVRVWKYMGDDE 233
              + S SDD T+R+W +    E
Sbjct: 107 LPWIISSSDDQTIRIWNWQNRKE 129

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 97/236 (41%), Gaps = 45/236 (19%)

Query: 20  FDFSQGILATGSTDRKIKLVSVKYDD--FTLIDVLDETAHKKAIRSVAWRPHTSLLAAGS 77
           F  +Q +  +   D  IK+ S++ +   FTL        H   +R+V +      + + S
Sbjct: 61  FHPTQPLFVSAGDDYTIKVWSLESNKCLFTL------DGHLDYVRTVFFHHELPWIISSS 114

Query: 78  FDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETD 137
            D T+ IW  +   +       +A + GH + V    +      + + S D++V +W+  
Sbjct: 115 DDQTIRIWNWQNRKE-------IACLTGHNHFVMCAQFHPVEDLVVSASLDETVRVWDIS 167

Query: 138 -----------ESGEEY-------------ECIS--VLQEHSQDVKHVIWHPSEALLASS 171
                      +S EE              +C+   +L+ H++ V    +HP+  L+ S 
Sbjct: 168 GLRKRHSAPGTQSFEEQMRQQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSG 227

Query: 172 SYDDTVRIWK-DYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           S D  V++W+      WE V    GH   V S  F   + +  + S  +D TVRVW
Sbjct: 228 SDDRQVKLWRMSATKAWE-VDTCRGHTNNVDSVIFHPQQNL--IISVGEDKTVRVW 280

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 5/82 (6%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H + +   ++ P   L+ +GS D  V +W    SA + +E+D      GH N V  V + 
Sbjct: 208 HTRGVNWASFHPTLPLIVSGSDDRQVKLW--RMSATKAWEVD---TCRGHTNNVDSVIFH 262

Query: 117 NDGYYLATCSRDKSVWIWETDE 138
                + +   DK+V +W+ D+
Sbjct: 263 PQQNLIISVGEDKTVRVWDLDK 284

>Scas_713.50
          Length = 983

 Score = 61.2 bits (147), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 94/217 (43%), Gaps = 24/217 (11%)

Query: 16  KIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAA 75
           K W+F   Q  L  G++D+ +  + + +D  T +++ D+      I SV   P    LA 
Sbjct: 536 KFWNFQLEQE-LVPGTSDKFVPKLGLHHD--TTLELSDD------ILSVRVSPEDKFLAV 586

Query: 76  GSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWE 135
              D+TV ++  +        M     + GH+  V  +  S D   + T S DK++ IW 
Sbjct: 587 SLLDNTVKVFFLDS-------MKFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWG 639

Query: 136 TDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNG 195
            D      +C   L  H   + +V + P      S S D  ++ W    D +EC+  L  
Sbjct: 640 LDFG----DCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDG--DKFECIQKLAA 693

Query: 196 HEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDD 232
           H+  VW+      +  F + S S D ++R+W+   D+
Sbjct: 694 HQSEVWALAI-ANDASF-VVSSSHDHSIRIWEETEDE 728

 Score = 37.4 bits (85), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 57/139 (41%), Gaps = 20/139 (14%)

Query: 102 IIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECIS------------VL 149
           I E H+  +  +  ++DG  L T S DKSV  W      E     S              
Sbjct: 506 IEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTT 565

Query: 150 QEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSD--FDK 207
            E S D+  V   P +  LA S  D+TV+++  + D  +    L GH+  V S D  FD 
Sbjct: 566 LELSDDILSVRVSPEDKFLAVSLLDNTVKVF--FLDSMKFFLSLYGHKLPVLSIDISFDS 623

Query: 208 TEGVFRLCSGSDDSTVRVW 226
                 + + S D  +++W
Sbjct: 624 K----MIITSSADKNIKIW 638

 Score = 35.8 bits (81), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 57/259 (22%), Positives = 99/259 (38%), Gaps = 43/259 (16%)

Query: 70  TSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDK 129
           T+LLA G  D  V +W         +   +L  + GH + +  + +   G  L + SRD 
Sbjct: 118 TNLLAVGYNDGVVKVW-------DLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDS 170

Query: 130 SVWIWETDESGEEYECIS-----------VLQEHSQDVKHVIWHPSEALLASSSYDDTVR 178
           ++ +W+       Y+  S            +  ++Q+   + W      L S+S D  ++
Sbjct: 171 NIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNNQEENELDW------LISTSKDGLIK 224

Query: 179 IWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDE--DDQ 236
           IW D     +CV     H G  WS           + + S DS V+ W+    D+   + 
Sbjct: 225 IW-DLKIQ-QCVETHIAHTGECWSLAVRND----LVITTSSDSQVKFWQLSLQDDTVPNG 278

Query: 237 QEWVCEAILPDVHKRQVYNVAW-----GFNGLIASVGADGVLAVY-----EEVDGEWKVF 286
            + + + I     K++  NV +     G  G      AD  + ++     EE+    K  
Sbjct: 279 SKLIEKGIYEKQSKQRGLNVEFIDSIDGV-GFFLIQNADRTVEIFRLRKEEEISKALKKR 337

Query: 287 AKRALCHGVYEINVVKWLE 305
            KR    G+    + K LE
Sbjct: 338 EKRLTEKGMTPDEIKKSLE 356

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 54/132 (40%), Gaps = 12/132 (9%)

Query: 103 IEGHENEVKGVAWSNDGYYLATCSRDK-SVWIWETDESGEEYECISVLQEHSQDVKHVIW 161
           ++G   +++ +  S+D   LAT S     +W  +T      +EC   L           +
Sbjct: 425 LQGQRTDIRSIDISDDNKLLATASNGSLKIWNLKTKLCIRTFECGYALT--------CKF 476

Query: 162 HPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDS 221
            P   L+   +    ++++ D     +   +   H+  +WS D   T    RL +GS D 
Sbjct: 477 LPGGMLVIIGTRAGELQLF-DLASSTQIANIEEAHDAAIWSLDL--TSDGKRLITGSADK 533

Query: 222 TVRVWKYMGDDE 233
           +V+ W +  + E
Sbjct: 534 SVKFWNFQLEQE 545

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 110/261 (42%), Gaps = 31/261 (11%)

Query: 72  LLAAGSFDSTVSIWA------KEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATC 125
           L+AAG  DS + +W+      + +   +  +      + GH   V  V++S D  YL + 
Sbjct: 501 LVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSA 560

Query: 126 SRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDD 185
           S DK+V +W  D     Y C+   + H+  V  V + P     A+ S+D T R+W    D
Sbjct: 561 SEDKTVRLWSLD----TYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWS--CD 614

Query: 186 DWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAIL 245
               + +  GH   V    F    G + L +GS D T R+W     D            L
Sbjct: 615 HIYPLRIFAGHLNDVDCVTFHP-NGTYVL-TGSSDKTCRMWDIQTGDS-------VRLFL 665

Query: 246 PDVHKRQVYNVAWGFNGLIASVGA-DGVLAVYEEVDGEWKVFAKRALCHGVYEINVVKWL 304
              H   V +VA   +G   + G+ DGV+ V++   G+     K+   HG    + V  L
Sbjct: 666 --GHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKR---IKQMRGHGK---SAVYSL 717

Query: 305 ELNGK-TILATGGDDGIVNFW 324
             N +  IL +GG D  V  W
Sbjct: 718 SFNKEGNILVSGGADQSVRVW 738

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 89/211 (42%), Gaps = 27/211 (12%)

Query: 16  KIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAA 75
           K+WS D   G         K K  S   +  TLI       H   + SV++ P    L +
Sbjct: 512 KLWSLD---GTPLESQLPSKAKDAS---NTVTLI------GHSGPVYSVSFSPDNRYLVS 559

Query: 76  GSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWE 135
            S D TV +W+ +           L   +GH + V  V +S  G+Y AT S D++  +W 
Sbjct: 560 ASEDKTVRLWSLD-------TYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWS 612

Query: 136 TDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNG 195
            D        + +   H  DV  V +HP+   + + S D T R+W     D   V +  G
Sbjct: 613 CD----HIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGD--SVRLFLG 666

Query: 196 HEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           H  +V S      +G + L +GS+D  + VW
Sbjct: 667 HTASVVSVAVSP-DGRW-LTTGSEDGVIIVW 695

>Kwal_27.12053
          Length = 755

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 76/171 (44%), Gaps = 15/171 (8%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
            H   + S ++ P    L + S D TV +W+ +           L   +GH + +  VA+
Sbjct: 480 GHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTS-------LVNYKGHNHPIWDVAF 532

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
           S  G+Y AT S D++  +W  D        + +   H  DV  V +HP+   + + S D 
Sbjct: 533 SPLGHYFATASHDQTARLWSCD----HIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDK 588

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           T R+W     D   V +  GH   V S+     +G + L +GS+D  + VW
Sbjct: 589 TCRMWDITSGD--SVRLFLGHTAPVTSTAVSP-DGRW-LSTGSEDGVINVW 635

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 71/263 (26%), Positives = 109/263 (41%), Gaps = 35/263 (13%)

Query: 72  LLAAGSFDSTVSIWA------KEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATC 125
           L AAG  DS + IW+      K +   +  E      + GH   V   ++S D  YL + 
Sbjct: 441 LAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYSTSFSPDNRYLLSA 500

Query: 126 SRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDD 185
           S DK+V +W TD     Y  +   + H+  +  V + P     A++S+D T R+W    D
Sbjct: 501 SEDKTVRLWSTD----TYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTARLWS--CD 554

Query: 186 DWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAIL 245
               + +  GH   V +  F    G + + +GS D T R+W     D            L
Sbjct: 555 HIYPLRIFAGHLNDVDTVSF-HPNGTY-VFTGSSDKTCRMWDITSGDS-------VRLFL 605

Query: 246 PDVHKRQVYNVAWGFNGLIASVGA-DGVLAVYEEVDGEWKVFAKRALCHG---VYEINVV 301
              H   V + A   +G   S G+ DGV+ V++   G+     K+   HG   VY ++  
Sbjct: 606 --GHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKR---LKQMRGHGKNAVYSLSYS 660

Query: 302 KWLELNGKTILATGGDDGIVNFW 324
           K        +L +GG D  V  W
Sbjct: 661 KEGH-----VLISGGADHSVRVW 678

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 108/239 (45%), Gaps = 29/239 (12%)

Query: 6   LIKSLKLYKEKIWSFDF--SQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRS 63
           ++ +LK +++ I+S D+  S   L +GS DR +++  +     +L   +++      + +
Sbjct: 440 IVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIED-----GVTT 494

Query: 64  VAWRP-HTSLLAAGSFDSTVSIWAKEESADRTFEMDLL----AIIEGHENEVKGVAWSND 118
           VA  P     +AAGS D TV +W     +D  F ++ L     +  GH + V  V ++ D
Sbjct: 495 VAVSPGEGKFIAAGSLDRTVRVW----DSDTGFLVERLDSENELGTGHRDSVYSVVFTRD 550

Query: 119 GYYLATCSRDKSVWIWETDE-SGEE--YECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
           G  + + S D+SV +W  +  SG++   EC      H   V  V    ++  + S S D 
Sbjct: 551 GKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDR 610

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWS------SDFDKTEGVFRLCSGSDDSTVRVWKY 228
            V  W     +   + +L GH  +V S             GVF   +GS D   R+WKY
Sbjct: 611 GVLFWDTKSGNP--LLMLQGHRNSVISVTVANGHPLGPEYGVF--ATGSGDCKARIWKY 665

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 60/117 (51%), Gaps = 8/117 (6%)

Query: 110 VKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLA 169
           ++ V +S DG +LAT + DK + IW+     E  + +  L+ H QD+  + + PS   L 
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDL----ETKKIVMTLKGHEQDIYSLDYFPSGNKLV 464

Query: 170 SSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           S S D TVRIW        C   L+  +G V +      EG F + +GS D TVRVW
Sbjct: 465 SGSGDRTVRIWDLT--TGTCSLTLSIEDG-VTTVAVSPGEGKF-IAAGSLDRTVRVW 517

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 83/179 (46%), Gaps = 26/179 (14%)

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120
           IRSV + P    LA G+ D  + IW  E          ++  ++GHE ++  + +   G 
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLETK-------KIVMTLKGHEQDIYSLDYFPSGN 461

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA-LLASSSYDDTVRI 179
            L + S D++V IW+   +G     +S+       V  V   P E   +A+ S D TVR+
Sbjct: 462 KLVSGSGDRTVRIWDL-TTGTCSLTLSI----EDGVTTVAVSPGEGKFIAAGSLDRTVRV 516

Query: 180 WKDYDDDWECVAVLN-------GHEGTVWSSDFDK-TEGVFRLCSGSDDSTVRVWKYMG 230
           W D D  +  V  L+       GH  +V+S  F +  +GV    SGS D +V++W   G
Sbjct: 517 W-DSDTGF-LVERLDSENELGTGHRDSVYSVVFTRDGKGVV---SGSLDRSVKLWNLNG 570

>Kwal_56.24596
          Length = 294

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 72/167 (43%), Gaps = 11/167 (6%)

Query: 99  LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKH 158
           ++ I   H   +        G  LATCS DK++ I+E +  GE ++ +  L  H   V  
Sbjct: 1   MVTITNAHTELIHDAVLDYYGKRLATCSSDKTIKIFEVE--GETHKLVETLHGHEGPVWQ 58

Query: 159 VIW-HPS-EALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCS 216
           V W HP    +LAS SYD  V IWK+ +  W  +AV   H  +V S  +   E    L +
Sbjct: 59  VDWAHPKFGVILASCSYDGKVLIWKEENGRWTQIAVHAVHSASVNSVQWAPHEYGPLLLA 118

Query: 217 GSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGL 263
            S D  V V ++       ++      IL D H   V   +W    L
Sbjct: 119 ASSDGKVSVVEF-------KENGTTSPILVDAHSIGVNTASWASAAL 158

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 123/286 (43%), Gaps = 36/286 (12%)

Query: 20  FDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAW-RPHTS-LLAAGS 77
            D+    LAT S+D+ IK+  V+ +   L++ L    H+  +  V W  P    +LA+ S
Sbjct: 17  LDYYGKRLATCSSDKTIKIFEVEGETHKLVETLH--GHEGPVWQVDWAHPKFGVILASCS 74

Query: 78  FDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSND--GYYLATCSRDKSVWIWE 135
           +D  V IW KEE+   T     +A+   H   V  V W+    G  L   S D  V + E
Sbjct: 75  YDGKVLIW-KEENGRWT----QIAVHAVHSASVNSVQWAPHEYGPLLLAASSDGKVSVVE 129

Query: 136 TDESGEEYECISVLQEHSQDVKHVIWHPSEAL-----------LASSSYDDTVRIWKDYD 184
             E+G     +  +  HS  V    W  S AL             +   D+ V++WK ++
Sbjct: 130 FKENGTTSPIL--VDAHSIGVNTASW-ASAALQGGAVSQQMRRFVTGGADNLVKVWK-FN 185

Query: 185 DDWECVAVLNGHEG-TVWSSDFDKTEGVF---RLCSGSDDSTVRVWKYMGDDEDDQQEWV 240
            D     + +  EG T W  D   +  V     L S S D T  +W      E++Q  W 
Sbjct: 186 PDANTYLLEDTLEGHTDWVRDVAWSPSVLLRSYLASVSQDRTCIIWT----QENNQGPWK 241

Query: 241 CEAILPDVHKRQVYNVAWGFNG-LIASVGADGVLAVYEE-VDGEWK 284
              +  D     ++  +W  +G ++A  G D  + +++E ++G+W+
Sbjct: 242 KTLLKEDKFSDVLWRASWSLSGNILALSGGDNKVTLWKENLEGKWE 287

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 99/244 (40%), Gaps = 31/244 (12%)

Query: 6   LIKSLKLYKEKIWSFDFSQG----ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAI 61
           L+++L  ++  +W  D++      ILA+ S D K+ +   +   +T I V     H  ++
Sbjct: 45  LVETLHGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWKEENGRWTQIAV--HAVHSASV 102

Query: 62  RSVAWRPHT--SLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW---- 115
            SV W PH    LL A S D  VS+   +E+   +       +++ H   V   +W    
Sbjct: 103 NSVQWAPHEYGPLLLAASSDGKVSVVEFKENGTTS-----PILVDAHSIGVNTASWASAA 157

Query: 116 ------SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEAL-- 167
                 S       T   D  V +W+ +     Y     L+ H+  V+ V W PS  L  
Sbjct: 158 LQGGAVSQQMRRFVTGGADNLVKVWKFNPDANTYLLEDTLEGHTDWVRDVAWSPSVLLRS 217

Query: 168 -LASSSYDDTVRIWKDYDDDWECVAVL---NGHEGTVWSSDFDKTEGVFRLCSGSDDSTV 223
            LAS S D T  IW   ++       L   +     +W + +  +  +  L  G  D+ V
Sbjct: 218 YLASVSQDRTCIIWTQENNQGPWKKTLLKEDKFSDVLWRASWSLSGNILALSGG--DNKV 275

Query: 224 RVWK 227
            +WK
Sbjct: 276 TLWK 279

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 73/169 (43%), Gaps = 22/169 (13%)

Query: 168 LASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
           LA+ S D T++I++   +  + V  L+GHEG VW  D+   +    L S S D  V +WK
Sbjct: 24  LATCSSDKTIKIFEVEGETHKLVETLHGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWK 83

Query: 228 YMGDDEDDQQEWVCEAILPDVHKRQVYNVAWG---FNGLIASVGADGVLAVYE-EVDGEW 283
                 ++   W   A+   VH   V +V W    +  L+ +  +DG ++V E + +G  
Sbjct: 84  ------EENGRWTQIAVHA-VHSASVNSVQWAPHEYGPLLLAASSDGKVSVVEFKENGTT 136

Query: 284 KVFAKRALCHGVYEINVVKWLE--LNGKTI------LATGGDDGIVNFW 324
                 A   GV   N   W    L G  +        TGG D +V  W
Sbjct: 137 SPILVDAHSIGV---NTASWASAALQGGAVSQQMRRFVTGGADNLVKVW 182

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 60.5 bits (145), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 92/211 (43%), Gaps = 27/211 (12%)

Query: 16  KIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAA 75
           K+WS D +       S  R+      K ++ TLI       H   + S ++ P    L +
Sbjct: 446 KLWSLDGTPLDSKLPSKQRE------KINNTTLI------GHSGTVYSTSFSPDNKYLLS 493

Query: 76  GSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWE 135
            S D TV +W+ +  +        L   +GH + V  V++S  G+Y AT S D++  +W 
Sbjct: 494 ASEDKTVRLWSMDTYSS-------LVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWS 546

Query: 136 TDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNG 195
            D        + +   H  DV  V +HP+   + + S D T R+W     D   V +  G
Sbjct: 547 CD----HIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGD--SVRLFLG 600

Query: 196 HEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           H   V S+     +G + L +GS+D  + VW
Sbjct: 601 HTAPVISTAVSP-DGRW-LSTGSEDGIINVW 629

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 95/262 (36%), Gaps = 74/262 (28%)

Query: 71  SLLAAGSFDSTVSIWA--------KEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYL 122
           +L AAG  DS + +W+        K  S  R  +++   +I GH   V   ++S D  YL
Sbjct: 434 TLAAAGFQDSYIKLWSLDGTPLDSKLPSKQRE-KINNTTLI-GHSGTVYSTSFSPDNKYL 491

Query: 123 ATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKD 182
            + S DK+V +W  D     Y  +   + H+  V  V + P     A++S+D T R+W  
Sbjct: 492 LSASEDKTVRLWSMDT----YSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSC 547

Query: 183 YDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCE 242
             D    + +  GH   V    F    G + + +GS D T R+W     D          
Sbjct: 548 --DHIYPLRIFAGHLNDVDCVSFHP-NGTY-VFTGSTDKTCRMWDIGTGDS--------- 594

Query: 243 AILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEWKVFAKRALCHGVYEINVVK 302
                            F G  A V +  V       DG W                   
Sbjct: 595 --------------VRLFLGHTAPVISTAV-----SPDGRW------------------- 616

Query: 303 WLELNGKTILATGGDDGIVNFW 324
                    L+TG +DGI+N W
Sbjct: 617 ---------LSTGSEDGIINVW 629

>Scas_603.5
          Length = 589

 Score = 60.1 bits (144), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 99/217 (45%), Gaps = 24/217 (11%)

Query: 20  FDFSQGILAT-GSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSF 78
           FD S  +L T G  +  IK+  ++ +D     V+D   H  ++  +   P +  L  GS 
Sbjct: 302 FDLSTKMLYTAGKYNTSIKVWDLETND----QVMDLDDHIASVTCMQLHPDSKTLITGSK 357

Query: 79  DSTVSIW----AKEESADRTFEMD-LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWI 133
           D+T+ +W    A + S D T  +D  +   E H  E+  V++ N+  YL + SRDKS+  
Sbjct: 358 DATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVSYDNE--YLLSASRDKSIRQ 415

Query: 134 WETDESGEEYECISVLQEHS-----QDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWE 188
           W+   +G   + +     H+     +D          A LA+ S D  +R+W       +
Sbjct: 416 WDL-TTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGAALATGSKDGIIRLWDLR--SGK 472

Query: 189 CVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRV 225
            V  L  H+G + S  FD T    ++ +GS D+ + V
Sbjct: 473 VVRTLLKHQGPITSLQFDST----KIITGSTDANISV 505

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 76/173 (43%), Gaps = 23/173 (13%)

Query: 62  RSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEM-DLLAIIEGHENEVKGVAWSNDGY 120
           + +A+ P    +    F ST+ +W         + M  LL   E HE  V+G+ +     
Sbjct: 15  KGIAFHPSRPWVLVALFSSTIQLW--------DYRMGTLLHRFEDHEGPVRGLDFHPTQP 66

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
              +   D ++ +W  D +    +C+  L  H   V+ V +H     + S+S D T+RIW
Sbjct: 67  IFVSAGDDYTIKVWSLDTN----KCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIW 122

Query: 181 KDYDDDWEC---VAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMG 230
                +W+    +A L GH   V  + F  T+ +  + S S D T+R+W   G
Sbjct: 123 -----NWQNRKEIACLTGHNHFVMCAQFHPTDDL--IVSASLDETIRIWDISG 168

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 105/252 (41%), Gaps = 57/252 (22%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H+  +R + + P   +  +   D T+ +W+ + +         L  + GH + V+ V + 
Sbjct: 52  HEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTN-------KCLYTLTGHLDYVRTVFFH 104

Query: 117 NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDT 176
            +  ++ + S D+++ IW      E    I+ L  H+  V    +HP++ L+ S+S D+T
Sbjct: 105 RELPWIISASDDQTIRIWNWQNRKE----IACLTGHNHFVMCAQFHPTDDLIVSASLDET 160

Query: 177 VRIW--------------KDYDDDW------------ECVA--VLNGH-EGTVWSSDFDK 207
           +RIW                +++              +CV   +L GH  G  W+S F  
Sbjct: 161 IRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWAS-FHP 219

Query: 208 TEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEW---VCEAILPDVHKRQVYNVAW-GFNGL 263
           T  +  + SGSDD  V++W+         + W    C       H   V +V +     L
Sbjct: 220 TLPL--IVSGSDDRQVKLWRMSA-----TKAWEVDTCRG-----HTNNVDSVIFHPHQNL 267

Query: 264 IASVGADGVLAV 275
           I SVG D  L V
Sbjct: 268 IISVGEDKTLRV 279

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 64/140 (45%), Gaps = 14/140 (10%)

Query: 97  MDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVL---QEHS 153
           M +L   E      KG+A+     ++       ++ +W+       Y   ++L   ++H 
Sbjct: 1   MKMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWD-------YRMGTLLHRFEDHE 53

Query: 154 QDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFR 213
             V+ + +HP++ +  S+  D T+++W    D  +C+  L GH   V +  F +   +  
Sbjct: 54  GPVRGLDFHPTQPIFVSAGDDYTIKVWS--LDTNKCLYTLTGHLDYVRTVFFHRE--LPW 109

Query: 214 LCSGSDDSTVRVWKYMGDDE 233
           + S SDD T+R+W +    E
Sbjct: 110 IISASDDQTIRIWNWQNRKE 129

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 64/152 (42%), Gaps = 31/152 (20%)

Query: 55  TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIW-----AKEESADRT--FEMDLLA------ 101
           T H   +    + P   L+ + S D T+ IW      K  SA  T  FE  + A      
Sbjct: 134 TGHNHFVMCAQFHPTDDLIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLD 193

Query: 102 ----------IIEGHENEVKGVAWSNDGYYLA---TCSRDKSVWIWETDESGEEYECISV 148
                     I+EGH    +GV W++    L    + S D+ V +W    S  +   +  
Sbjct: 194 GSLGDCVVKFILEGH---TRGVNWASFHPTLPLIVSGSDDRQVKLWRM--SATKAWEVDT 248

Query: 149 LQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
            + H+ +V  VI+HP + L+ S   D T+R+W
Sbjct: 249 CRGHTNNVDSVIFHPHQNLIISVGEDKTLRVW 280

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 96/236 (40%), Gaps = 45/236 (19%)

Query: 20  FDFSQGILATGSTDRKIKLVSVKYDD--FTLIDVLDETAHKKAIRSVAWRPHTSLLAAGS 77
           F  +Q I  +   D  IK+ S+  +   +TL      T H   +R+V +      + + S
Sbjct: 61  FHPTQPIFVSAGDDYTIKVWSLDTNKCLYTL------TGHLDYVRTVFFHRELPWIISAS 114

Query: 78  FDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETD 137
            D T+ IW  +   +       +A + GH + V    +      + + S D+++ IW+  
Sbjct: 115 DDQTIRIWNWQNRKE-------IACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDIS 167

Query: 138 -----------ESGEEY-------------ECIS--VLQEHSQDVKHVIWHPSEALLASS 171
                       S EE              +C+   +L+ H++ V    +HP+  L+ S 
Sbjct: 168 GLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVSG 227

Query: 172 SYDDTVRIWK-DYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           S D  V++W+      WE V    GH   V S  F   + +  + S  +D T+RVW
Sbjct: 228 SDDRQVKLWRMSATKAWE-VDTCRGHTNNVDSVIFHPHQNL--IISVGEDKTLRVW 280

 Score = 35.8 bits (81), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 39/82 (47%), Gaps = 5/82 (6%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H + +   ++ P   L+ +GS D  V +W    SA + +E+D      GH N V  V + 
Sbjct: 208 HTRGVNWASFHPTLPLIVSGSDDRQVKLW--RMSATKAWEVD---TCRGHTNNVDSVIFH 262

Query: 117 NDGYYLATCSRDKSVWIWETDE 138
                + +   DK++ +W+ D+
Sbjct: 263 PHQNLIISVGEDKTLRVWDLDK 284

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 60.1 bits (144), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 74/160 (46%), Gaps = 15/160 (9%)

Query: 45  DFTLIDVLDET--AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAI 102
           D  +I V + T  AH+K I +++  P+ S+ A  S+D T  IW  E         +L A 
Sbjct: 476 DVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENG-------ELEAT 528

Query: 103 IEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWH 162
           +  H+  +  V++      LAT S DK+V IW  D     +  +  L+ H+  V+   + 
Sbjct: 529 LANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLD----TFSVMKTLEGHTNAVQRCSFI 584

Query: 163 PSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWS 202
             +  L S   D  ++IW       EC+  L+GH   +W+
Sbjct: 585 NKQKQLISCGADGLIKIWD--CSSGECLKTLDGHNNRLWA 622

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/316 (20%), Positives = 134/316 (42%), Gaps = 43/316 (13%)

Query: 32  TDRKIKLVSVKYD---DFTLIDVLDETAHKKAI----RSVAWRPHTSLLAAGSFDSTVSI 84
           +D+ ++L++V+ D   D   I V    A    I    R V   P  + LA  +   ++ I
Sbjct: 307 SDQTLQLINVEEDLKNDEDTIQVTSSIAGNHGIIADMRYVG--PELNKLALATNSPSLRI 364

Query: 85  WAKEESADRTFEMDL-LAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEY 143
               + +     + L + I EGHE+ +  +  + DG ++AT S+D +  +W  +E+  ++
Sbjct: 365 IPVPDLSGPEASLPLDVEIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKF 424

Query: 144 ECISVLQEHSQDV-----KHVIWHPSEALLASSSYDDTVRIW----KDYDDDWECVAV-- 192
           +  +    HS  V      +++       L ++S D T++ W         D + + V  
Sbjct: 425 DIYAKYIGHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSE 484

Query: 193 --LNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHK 250
              + HE  + +      + +F   + S D T ++W          +    EA L + HK
Sbjct: 485 YTRHAHEKDINALSVSPNDSIF--ATASYDKTCKIWNL--------ENGELEATLAN-HK 533

Query: 251 RQVYNVAW-GFNGLIASVGADGVLAVYEEVDGEWKVFAKRALCHGVYEINVVKWLE-LNG 308
           R +++V++  ++ L+A+   D  + ++         F+      G    N V+    +N 
Sbjct: 534 RGLWDVSFCQYDKLLATSSGDKTVKIW-----SLDTFSVMKTLEG--HTNAVQRCSFINK 586

Query: 309 KTILATGGDDGIVNFW 324
           +  L + G DG++  W
Sbjct: 587 QKQLISCGADGLIKIW 602

>ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH]
           (698881..699768) [888 bp, 295 aa]
          Length = 295

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 59/124 (47%), Gaps = 5/124 (4%)

Query: 99  LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKH 158
           ++ I   H   +        G  LATCS DK++ I+E D  G+ ++ +  L  H   V  
Sbjct: 1   MVTITNAHTELIHDAVLDYYGKRLATCSSDKTIQIFEVD--GDSHKLVDSLHGHEGPVWQ 58

Query: 159 VIW-HPS-EALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTE-GVFRLC 215
           V W HP    +LAS SYD  V IWK+ +  W  +A    H  +V S  +   E G   LC
Sbjct: 59  VDWAHPKFGVILASCSYDGKVLIWKEENGRWSQIAAYEVHSASVNSVKWAPHEYGPLLLC 118

Query: 216 SGSD 219
           S SD
Sbjct: 119 SSSD 122

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 123/292 (42%), Gaps = 39/292 (13%)

Query: 20  FDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAW-RPHTS-LLAAGS 77
            D+    LAT S+D+ I++  V  D   L+D L    H+  +  V W  P    +LA+ S
Sbjct: 17  LDYYGKRLATCSSDKTIQIFEVDGDSHKLVDSLH--GHEGPVWQVDWAHPKFGVILASCS 74

Query: 78  FDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY--YLATCSRDKSVWIWE 135
           +D  V IW KEE+         +A  E H   V  V W+   Y   L   S D    + E
Sbjct: 75  YDGKVLIW-KEENG----RWSQIAAYEVHSASVNSVKWAPHEYGPLLLCSSSDGKFSVVE 129

Query: 136 TDESGEEYECISVLQEHSQDVKHVIWHP---------SEAL--LASSSYDDTVRIWKDYD 184
             E+G     I  +  H+  V    W P         S+ L  +A+   D+ V+IWK Y+
Sbjct: 130 FKENGTTSPII--IDAHAIGVNAACWAPATIEDDGQQSQHLRRIATGGADNLVKIWK-YN 186

Query: 185 DDWECVAV---LNGHEGTVWSSDFDKTEGVFR---LCSGSDDSTVRVWKYMGDDEDDQQE 238
            +     +   L  H    W  D   +  V     L + S D T  +W      E++Q  
Sbjct: 187 PEANTYLLEDTLAAHAD--WVRDVAWSPSVLPRAYLATVSQDRTCIIWT----QENNQGP 240

Query: 239 WVCEAILPDVHKRQVYNVAWGFNG-LIASVGADGVLAVYEE-VDGEWKVFAK 288
           W    +  D     ++  +W  +G ++A  G D  + +++E ++G+W+  A+
Sbjct: 241 WTKTLLKEDKFPDVLWRASWSLSGNILALSGGDNKVTLWKENLEGKWESAAE 292

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 100/248 (40%), Gaps = 32/248 (12%)

Query: 3   SINLIKSLKLYKEKIWSFDFSQG----ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHK 58
           S  L+ SL  ++  +W  D++      ILA+ S D K+ +   +   ++ I   +   H 
Sbjct: 42  SHKLVDSLHGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWKEENGRWSQIAAYE--VHS 99

Query: 59  KAIRSVAWRPHT--SLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
            ++ SV W PH    LL   S D   S+   +E+   +       II+ H   V    W+
Sbjct: 100 ASVNSVKWAPHEYGPLLLCSSSDGKFSVVEFKENGTTS-----PIIIDAHAIGVNAACWA 154

Query: 117 -----NDGYY------LATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPS- 164
                +DG        +AT   D  V IW+ +     Y     L  H+  V+ V W PS 
Sbjct: 155 PATIEDDGQQSQHLRRIATGGADNLVKIWKYNPEANTYLLEDTLAAHADWVRDVAWSPSV 214

Query: 165 --EALLASSSYDDTVRIWKDYDDDWECVAVL---NGHEGTVWSSDFDKTEGVFRLCSGSD 219
              A LA+ S D T  IW   ++       L   +     +W + +  +  +  L  G  
Sbjct: 215 LPRAYLATVSQDRTCIIWTQENNQGPWTKTLLKEDKFPDVLWRASWSLSGNILALSGG-- 272

Query: 220 DSTVRVWK 227
           D+ V +WK
Sbjct: 273 DNKVTLWK 280

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 83/192 (43%), Gaps = 23/192 (11%)

Query: 146 ISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDF 205
           +++   H++ +   +       LA+ S D T++I++   D  + V  L+GHEG VW  D+
Sbjct: 2   VTITNAHTELIHDAVLDYYGKRLATCSSDKTIQIFEVDGDSHKLVDSLHGHEGPVWQVDW 61

Query: 206 DKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWG---FNG 262
              +    L S S D  V +WK      ++   W   A   +VH   V +V W    +  
Sbjct: 62  AHPKFGVILASCSYDGKVLIWK------EENGRWSQIAAY-EVHSASVNSVKWAPHEYGP 114

Query: 263 LIASVGADGVLAVYE-EVDGEWKVFAKRALCHGVYEINVVKW----LELNGKTI-----L 312
           L+    +DG  +V E + +G        A   GV   N   W    +E +G+       +
Sbjct: 115 LLLCSSSDGKFSVVEFKENGTTSPIIIDAHAIGV---NAACWAPATIEDDGQQSQHLRRI 171

Query: 313 ATGGDDGIVNFW 324
           ATGG D +V  W
Sbjct: 172 ATGGADNLVKIW 183

>AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH]
           (367581..368573) [993 bp, 330 aa]
          Length = 330

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 102/246 (41%), Gaps = 23/246 (9%)

Query: 99  LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKH 158
           +     GHE+ V  + +   G ++ATCS D+ + ++  D+   E+      + H   V  
Sbjct: 1   MKPFTTGHEDLVHDICYDFYGRHVATCSSDQHIKVFRLDKDTNEWTLSDSWKGHDSSVVA 60

Query: 159 VIWHPSE--ALLASSSYDDTVRIWKDYDD-------DWECVAVLNGHEGTVWSSDFDKTE 209
           + W   E   +LAS SY+ T+++W++  D        W  +  LN   G ++S  F    
Sbjct: 61  LDWASPEYGRILASVSYNKTIKVWEEDPDAPEGSGRRWTRLCTLNDATGPLYSVKFAPGH 120

Query: 210 GVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCE------AILPDVHKRQVYNVAW---GF 260
              RL +  +D  +R++  +  +  D + W         A  P  H +  +++ W    F
Sbjct: 121 LGLRLGAIGNDGVLRIYDAL--EPSDLRSWTLTSEVKVLATPPASHLQSDFSLDWCPSRF 178

Query: 261 NGLIASVGADGVLAVYEEVDGEWKVFAKRALCHGVYEINVVKWLELNGK--TILATGGDD 318
           +     V A     VYE  +   K+F    L      I  V W    G+   ++ATG  D
Sbjct: 179 SAERLVVCALDQAFVYER-NKAGKLFQAARLPGHQGLIRSVSWAPSFGRWHQLIATGSKD 237

Query: 319 GIVNFW 324
           G V  +
Sbjct: 238 GRVRIF 243

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 50/117 (42%), Gaps = 23/117 (19%)

Query: 55  TAHKKAIRSVAWRPH----TSLLAAGSFDSTVSIWAKEE------------------SAD 92
             H+  IRSV+W P       L+A GS D  V I+   E                     
Sbjct: 209 PGHQGLIRSVSWAPSFGRWHQLIATGSKDGRVRIFQLTEKLDATDDASTDDASTDDAGPA 268

Query: 93  RTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVL 149
               + LL+    H+ EV  V+W+  G  L++   D  V +W++  S  E++C+SV+
Sbjct: 269 PHISVQLLSEHADHKGEVWSVSWNLTGTILSSSGDDGKVRLWKSSFS-NEFKCMSVI 324

 Score = 34.7 bits (78), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 56/119 (47%), Gaps = 26/119 (21%)

Query: 101 AIIEGHENEVKGVAWSND----GYYLATCSRDKSVWIWETDE------------------ 138
           A + GH+  ++ V+W+         +AT S+D  V I++  E                  
Sbjct: 206 ARLPGHQGLIRSVSWAPSFGRWHQLIATGSKDGRVRIFQLTEKLDATDDASTDDASTDDA 265

Query: 139 SGEEYECISVLQEHSQ---DVKHVIWHPSEALLASSSYDDTVRIWK-DYDDDWECVAVL 193
               +  + +L EH+    +V  V W+ +  +L+SS  D  VR+WK  + ++++C++V+
Sbjct: 266 GPAPHISVQLLSEHADHKGEVWSVSWNLTGTILSSSGDDGKVRLWKSSFSNEFKCMSVI 324

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 64/147 (43%), Gaps = 31/147 (21%)

Query: 122 LATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPS----EALLASSSYDDTV 177
           L  C+ D++ +++E +++G+ ++  + L  H   ++ V W PS      L+A+ S D  V
Sbjct: 183 LVVCALDQA-FVYERNKAGKLFQA-ARLPGHQGLIRSVSWAPSFGRWHQLIATGSKDGRV 240

Query: 178 RIWKDYDD-----------------------DWECVAVLNGHEGTVWSSDFDKTEGVFRL 214
           RI++  +                          + ++    H+G VWS  ++ T  +  L
Sbjct: 241 RIFQLTEKLDATDDASTDDASTDDAGPAPHISVQLLSEHADHKGEVWSVSWNLTGTI--L 298

Query: 215 CSGSDDSTVRVWKYMGDDEDDQQEWVC 241
            S  DD  VR+WK    +E      +C
Sbjct: 299 SSSGDDGKVRLWKSSFSNEFKCMSVIC 325

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 120/300 (40%), Gaps = 47/300 (15%)

Query: 20  FDFSQGILATGSTDRKIKLVSVKYD--DFTLIDVLDETAHKKAIRSVAW--RPHTSLLAA 75
           +DF    +AT S+D+ IK+  +  D  ++TL D      H  ++ ++ W    +  +LA+
Sbjct: 17  YDFYGRHVATCSSDQHIKVFRLDKDTNEWTLSDSWK--GHDSSVVALDWASPEYGRILAS 74

Query: 76  GSFDSTVSIW-----AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKS 130
            S++ T+ +W     A E S  R   +  L    G    VK  A  + G  L     D  
Sbjct: 75  VSYNKTIKVWEEDPDAPEGSGRRWTRLCTLNDATGPLYSVK-FAPGHLGLRLGAIGNDGV 133

Query: 131 VWIWETDESGE--------EYECISVLQ-EHSQDVKHVIWHPSE---ALLASSSYDDTVR 178
           + I++  E  +        E + ++     H Q    + W PS      L   + D    
Sbjct: 134 LRIYDALEPSDLRSWTLTSEVKVLATPPASHLQSDFSLDWCPSRFSAERLVVCALDQAFV 193

Query: 179 IWKDYDDDWECVAVLNGHEGTV----WSSDFDKTEGVFRLCSGSDDSTVRVWKYM----- 229
             ++        A L GH+G +    W+  F +   +  + +GS D  VR+++       
Sbjct: 194 YERNKAGKLFQAARLPGHQGLIRSVSWAPSFGRWHQL--IATGSKDGRVRIFQLTEKLDA 251

Query: 230 -GDDEDDQQEWVCEAILPDV----------HKRQVYNVAWGFNG-LIASVGADGVLAVYE 277
             D   D          P +          HK +V++V+W   G +++S G DG + +++
Sbjct: 252 TDDASTDDASTDDAGPAPHISVQLLSEHADHKGEVWSVSWNLTGTILSSSGDDGKVRLWK 311

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 90/195 (46%), Gaps = 31/195 (15%)

Query: 14  KEKIWSFDFSQ--GILATGSTDRKIK-------LVSVKYDDFTL---------IDVLDET 55
           K +I++ D S     LATG  D KI+       L  ++ +  T          + +   +
Sbjct: 17  KYEIYTVDVSHDGKRLATGGLDGKIRIWSIDSILRCMELESLTPEIPLPQDLQMPLCSMS 76

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWA--KEESADRTFEMD-------LLAIIEGH 106
            H  +I  V + P    LA+GS D  + IWA  +E+S+   F  +       +   +  H
Sbjct: 77  RHTGSITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWTVRKRLVAH 136

Query: 107 ENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA 166
           +N+++ + W+ D   L T   D+SV +W    +G  +E +     H   VK V++ P+  
Sbjct: 137 DNDIQDICWAPDSSILVTVGLDRSVIVW----NGSTFEKLKRFDVHQSLVKGVVFDPANK 192

Query: 167 LLASSSYDDTVRIWK 181
             A++S D T++I++
Sbjct: 193 YFATTSDDRTMKIFR 207

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 64/147 (43%), Gaps = 22/147 (14%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           AH   I+ + W P +S+L     D +V +W        TFE   L   + H++ VKGV +
Sbjct: 135 AHDNDIQDICWAPDSSILVTVGLDRSVIVWNGS-----TFEK--LKRFDVHQSLVKGVVF 187

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
                Y AT S D+++ I+   ++G          + S  ++H+I  P +    ++ +  
Sbjct: 188 DPANKYFATTSDDRTMKIFRYHKTG----------DISFTIEHIITEPFKESPLTTYFR- 236

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWS 202
                  +  D + +AV N   G V S
Sbjct: 237 ----RPSWSPDGQHIAVPNATNGPVSS 259

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 40/201 (19%), Positives = 77/201 (38%), Gaps = 42/201 (20%)

Query: 20  FDFSQGILATGSTDRKIKLVSV-KYDD--FTLIDVLDETAHKKAI----RSVAWRP---- 68
           FD +    AT S DR +K+    K  D  FT+  ++ E   +  +    R  +W P    
Sbjct: 187 FDPANKYFATTSDDRTMKIFRYHKTGDISFTIEHIITEPFKESPLTTYFRRPSWSPDGQH 246

Query: 69  ------------HTSLLAAGSFDSTVSIWAKEESAD------RTFEMDLLAIIEGHENEV 110
                         +++  G++D+ VS+   +   +      R FE +     +  ++  
Sbjct: 247 IAVPNATNGPVSSMAIVNRGTWDTNVSLIGHDAPTEVARFNPRLFERNAGVKQKKDDDPE 306

Query: 111 KGVAWSNDGYY----------LATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVI 160
             +   ND             +AT  +DKS+ +W T           +  +   D+    
Sbjct: 307 NALVGQNDDKVHHFDKNIDSVVATAGQDKSLAVWSTSRPRPILVAFDIANKSITDMS--- 363

Query: 161 WHPSEALLASSSYDDTVRIWK 181
           W+P  +LL  +S D ++ ++K
Sbjct: 364 WNPDGSLLFVASLDSSITLFK 384

 Score = 28.5 bits (62), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 43/115 (37%), Gaps = 16/115 (13%)

Query: 104 EGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQE------------ 151
           E  + E+  V  S+DG  LAT   D  + IW  D      E  S+  E            
Sbjct: 14  ESRKYEIYTVDVSHDGKRLATGGLDGKIRIWSIDSILRCMELESLTPEIPLPQDLQMPLC 73

Query: 152 ----HSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWS 202
               H+  +  V + P    LAS S D  + IW   ++     A  + HE   W+
Sbjct: 74  SMSRHTGSITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWT 128

>Kwal_23.6429
          Length = 750

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 111/250 (44%), Gaps = 36/250 (14%)

Query: 1   MASINLIKSLKLYKEKIWSFDF--SQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHK 58
           +A+  ++ +L+ +++ I+S D+  S   L +GS DR +++  ++    +L   +++    
Sbjct: 499 LATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIED---- 554

Query: 59  KAIRSVAWRPH-TSLLAAGSFDSTVSIWAKE-----ESADRTFEMDLLAIIEGHENEVKG 112
             + +VA  P    L+AAGS D TV IW  E     E  D   E+       GH++ V  
Sbjct: 555 -GVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGT-----GHKDSVYS 608

Query: 113 VAWSNDGYYLATCSRDKSVWIWETDESG---EEYECISVLQE-----HSQDVKHVIWHPS 164
           V ++ DG+ + + S D+SV +W    +     E +  +   E     H   V  V    +
Sbjct: 609 VVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQN 668

Query: 165 EALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWS------SDFDKTEGVFRLCSGS 218
           +  + S S D  V  W     +   + +L GH  +V S             GVF   +GS
Sbjct: 669 DEFILSGSKDRGVLFWDTPSGN--PLLMLQGHRNSVISVAVANDHPLGPEYGVF--ATGS 724

Query: 219 DDSTVRVWKY 228
            D   R+WKY
Sbjct: 725 GDCKARIWKY 734

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 74/158 (46%), Gaps = 20/158 (12%)

Query: 110 VKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLA 169
           ++ V +S DG +LAT + DK + IW+          +  LQ H QD+  + + PS   L 
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDL----ATRRIVMTLQGHEQDIYSLDYFPSGDKLV 528

Query: 170 SSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYM 229
           S S D TVRIW       +C   L+  +G V +      +G   + +GS D TVR+W   
Sbjct: 529 SGSGDRTVRIWDLR--TGQCSLTLSIEDG-VTTVAVSPGDGKL-IAAGSLDRTVRIW--- 581

Query: 230 GDDEDDQQEWVCEAI-----LPDVHKRQVYNVAWGFNG 262
               D +  ++ E +     L   HK  VY+V +  +G
Sbjct: 582 ----DSETGFLVERLDSENELGTGHKDSVYSVVFTRDG 615

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 83/175 (47%), Gaps = 26/175 (14%)

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120
           IRSV + P    LA G+ D  + IW   + A R   M L    +GHE ++  + +   G 
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIW---DLATRRIVMTL----QGHEQDIYSLDYFPSGD 525

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA-LLASSSYDDTVRI 179
            L + S D++V IW+   +G+    +S+       V  V   P +  L+A+ S D TVRI
Sbjct: 526 KLVSGSGDRTVRIWDL-RTGQCSLTLSI----EDGVTTVAVSPGDGKLIAAGSLDRTVRI 580

Query: 180 W--------KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           W        +  D + E   +  GH+ +V+S  F  T     + SGS D +V++W
Sbjct: 581 WDSETGFLVERLDSENE---LGTGHKDSVYSVVF--TRDGHGVVSGSLDRSVKLW 630

>YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the
           COPII coat of vesicles involved in endoplasmic reticulum
           to Golgi transport, contains six WD (WD-40) repeats [894
           bp, 297 aa]
          Length = 297

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 125/288 (43%), Gaps = 37/288 (12%)

Query: 20  FDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAW-RPH-TSLLAAGS 77
            D+    LAT S+D+ IK+  V+ +   LID L  T H+  +  V W  P   ++LA+ S
Sbjct: 17  LDYYGKRLATCSSDKTIKIFEVEGETHKLIDTL--TGHEGPVWRVDWAHPKFGTILASCS 74

Query: 78  FDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSND--GYYLATCSRDKSVWIWE 135
           +D  V IW KEE+         +A+   H   V  V W+    G  L   S D  V + E
Sbjct: 75  YDGKVLIW-KEENG----RWSQIAVHAVHSASVNSVQWAPHEYGPLLLVASSDGKVSVVE 129

Query: 136 TDESGEEYECISVLQEHSQDVKHVIWHPS-------------EALLASSSYDDTVRIWKD 182
             E+G     I  +  H+  V    W P+                  +   D+ V+IWK 
Sbjct: 130 FKENGTTSPII--IDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWK- 186

Query: 183 YDDDWECVAVLNGHEG-TVWSSDFDKTEGVF---RLCSGSDDSTVRVWKYMGDDEDDQQE 238
           Y+ D +   + +  EG + W  D   +  V     L S S D T  +W    +    ++ 
Sbjct: 187 YNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKT 246

Query: 239 WVCEAILPDVHKRQVYNVAWGFNG-LIASVGADGVLAVYEE-VDGEWK 284
            + E   PDV    ++  +W  +G ++A  G D  + +++E ++G+W+
Sbjct: 247 LLKEEKFPDV----LWRASWSLSGNVLALSGGDNKVTLWKENLEGKWE 290

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 71/163 (43%), Gaps = 11/163 (6%)

Query: 99  LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKH 158
           ++ I   H   +        G  LATCS DK++ I+E +  GE ++ I  L  H   V  
Sbjct: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVE--GETHKLIDTLTGHEGPVWR 58

Query: 159 VIW-HPS-EALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCS 216
           V W HP    +LAS SYD  V IWK+ +  W  +AV   H  +V S  +   E    L  
Sbjct: 59  VDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLV 118

Query: 217 GSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWG 259
            S D  V V ++       ++      I+ D H   V + +W 
Sbjct: 119 ASSDGKVSVVEF-------KENGTTSPIIIDAHAIGVNSASWA 154

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 102/247 (41%), Gaps = 34/247 (13%)

Query: 6   LIKSLKLYKEKIWSFDFSQG----ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAI 61
           LI +L  ++  +W  D++      ILA+ S D K+ +   +   ++ I V     H  ++
Sbjct: 45  LIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIAV--HAVHSASV 102

Query: 62  RSVAWRPHT--SLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS--- 116
            SV W PH    LL   S D  VS+   +E+   +       II+ H   V   +W+   
Sbjct: 103 NSVQWAPHEYGPLLLVASSDGKVSVVEFKENGTTS-----PIIIDAHAIGVNSASWAPAT 157

Query: 117 --NDGYY--------LATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA 166
              DG +          T   D  V IW+ +   + Y   S L+ HS  V+ V W P+  
Sbjct: 158 IEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVL 217

Query: 167 L---LASSSYDDTVRIWKDYDDDWECVAVLNGHEG---TVWSSDFDKTEGVFRLCSGSDD 220
           L   LAS S D T  IW   ++       L   E     +W + +  +  V  L  G  D
Sbjct: 218 LRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGG--D 275

Query: 221 STVRVWK 227
           + V +WK
Sbjct: 276 NKVTLWK 282

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 79/157 (50%), Gaps = 18/157 (11%)

Query: 110 VKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLA 169
           ++ V +S DG +LAT + DK + IW+     E+ + + VL+ H QD+  + + PS   L 
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIWDI----EQKKIVMVLKGHEQDIYSLDYFPSGDKLV 613

Query: 170 SSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK-- 227
           S S D TVRIW D     +C   L+  +G V +      +G F + +GS D  VRVW   
Sbjct: 614 SGSGDRTVRIW-DL-KTGQCTLTLSIEDG-VTTVAVSPGDGKF-IAAGSLDRAVRVWDSD 669

Query: 228 --YMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNG 262
             ++ +  D + E      L   HK  VY+V +  +G
Sbjct: 670 TGFLVERLDSENE------LGTGHKDSVYSVVFTRDG 700

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 102/243 (41%), Gaps = 30/243 (12%)

Query: 6   LIKSLKLYKEKIWSFDF--SQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRS 63
           ++  LK +++ I+S D+  S   L +GS DR +++  +K    TL   +++      + +
Sbjct: 589 IVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIED-----GVTT 643

Query: 64  VAWRP-HTSLLAAGSFDSTVSIWAKEESADRTFEMDLL----AIIEGHENEVKGVAWSND 118
           VA  P     +AAGS D  V +W     +D  F ++ L     +  GH++ V  V ++ D
Sbjct: 644 VAVSPGDGKFIAAGSLDRAVRVW----DSDTGFLVERLDSENELGTGHKDSVYSVVFTRD 699

Query: 119 GYYLATCSRDKSVWIWE--------TDESGEEYECISVLQEHSQDVKHVIWHPSEALLAS 170
           G  + + S D+SV +W          D       C      H   V  V     +  + S
Sbjct: 700 GNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILS 759

Query: 171 SSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFR----LCSGSDDSTVRVW 226
            S D  V  W     +   + +L GH  +V S   +    +        +GS D   R+W
Sbjct: 760 GSKDRGVLFWDKVSGNP--LLMLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIW 817

Query: 227 KYM 229
           KY+
Sbjct: 818 KYI 820

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 85/175 (48%), Gaps = 26/175 (14%)

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120
           IRSV + P    LA G+ D  + IW  E+         ++ +++GHE ++  + +   G 
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIWDIEQK-------KIVMVLKGHEQDIYSLDYFPSGD 610

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA-LLASSSYDDTVRI 179
            L + S D++V IW+  ++G+    +S+       V  V   P +   +A+ S D  VR+
Sbjct: 611 KLVSGSGDRTVRIWDL-KTGQCTLTLSI----EDGVTTVAVSPGDGKFIAAGSLDRAVRV 665

Query: 180 WKDYDDDWECVAVLN-------GHEGTVWSSDFDK-TEGVFRLCSGSDDSTVRVW 226
           W D D  +  V  L+       GH+ +V+S  F +   GV    SGS D +V++W
Sbjct: 666 W-DSDTGF-LVERLDSENELGTGHKDSVYSVVFTRDGNGV---VSGSLDRSVKLW 715

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 95/215 (44%), Gaps = 30/215 (13%)

Query: 27  LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWA 86
           LATG+ D+ I++  ++     ++       H++ I S+ + P    L +GS D TV IW 
Sbjct: 570 LATGAEDKLIRIWDIEQKKIVMV----LKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 625

Query: 87  KEESADRTFEMDLLAIIEGHENEVKGVAWS-NDGYYLATCSRDKSVWIWETDESGEEYEC 145
                 +T +  L   I   E+ V  VA S  DG ++A  S D++V +W++D +G   E 
Sbjct: 626 L-----KTGQCTLTLSI---EDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSD-TGFLVER 676

Query: 146 ISVLQE----HSQDVKHVIWHPSEALLASSSYDDTVRIWK----DYDD------DWECVA 191
           +    E    H   V  V++      + S S D +V++W     ++++         C  
Sbjct: 677 LDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEV 736

Query: 192 VLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
              GH+  V S     TE    + SGS D  V  W
Sbjct: 737 TYTGHKDFVLS--VATTEDDEYILSGSKDRGVLFW 769

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 76/171 (44%), Gaps = 15/171 (8%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
            H   + S ++ P    L +GS D TV +W+ +           L   +GH + V  V++
Sbjct: 523 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHT-------ALVSYKGHNHPVWDVSF 575

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
           S  G+Y AT S D++  +W  D        + +   H  DV  V +HP+   + + S D 
Sbjct: 576 SPLGHYFATASHDQTARLWSCD----HIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDK 631

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           T R+W     D   V +  GH   V S      +G + L +GS+D  + VW
Sbjct: 632 TCRMWDVSTGD--SVRLFLGHTAPVISIAV-CPDGRW-LSTGSEDGIINVW 678

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 84/234 (35%), Gaps = 53/234 (22%)

Query: 115 WSNDGYYLATCSRDKSVWIWETDESG-------------EEYECISVLQEHSQDVKHVIW 161
           +S+D    A   +D  + IW  D S              +E      L  HS  V    +
Sbjct: 474 FSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSF 533

Query: 162 HPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDS 221
            P    L S S D TVR+W    D    +    GH   VW   F      F   + S D 
Sbjct: 534 SPDNKYLLSGSEDKTVRLWSM--DTHTALVSYKGHNHPVWDVSFSPLGHYF--ATASHDQ 589

Query: 222 TVRVWKYMGDDEDDQQEWVCEAILP----DVHKRQVYNVAWGFNGLIASVGA-DGVLAVY 276
           T R+W              C+ I P      H   V  V++  NG     G+ D    ++
Sbjct: 590 TARLWS-------------CDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMW 636

Query: 277 EEVDGEW-KVFAKRALCHGVYEINVV-----KWLELNGKTILATGGDDGIVNFW 324
           +   G+  ++F    L H    I++      +WL        +TG +DGI+N W
Sbjct: 637 DVSTGDSVRLF----LGHTAPVISIAVCPDGRWL--------STGSEDGIINVW 678

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 124/275 (45%), Gaps = 26/275 (9%)

Query: 55  TAHKKAIRSVAWRPHTSLLAAGSFDSTVSI---WAKEESADRTF-EMDLLAIIEGHENEV 110
           +A +  +++   R +  + A  +   T SI     K  +A++ +   DLLA        +
Sbjct: 156 SARQYILKNSIARANKRIAAQKTISQTYSIQNVLNKRRAANKYWCSFDLLATQVVSTRPI 215

Query: 111 KGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLAS 170
             V + N+G Y+A+ S +  V I +++      E    LQ H   V  + W  ++++L +
Sbjct: 216 STVTFCNNGNYVASGSWNGEVSIIDSNT----LEVTQTLQNHDGKVGGIAWTSNDSVLIT 271

Query: 171 SSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMG 230
              D  + +    D ++     + GHEG +  +D         + + S DST R+W    
Sbjct: 272 GGEDHLITVSNRSDGEFITSNSIGGHEGRI--TDLQVHPSGKFIGTSSFDSTWRLW---- 325

Query: 231 DDEDDQQEWVCEAILPDVHKRQVYNVAWGFNG-LIASVGADGVLAVYEEVDGEWKVFAKR 289
           D E  +Q      +L + H +++Y +A+  +G L+++ G D    +++   G+    A  
Sbjct: 326 DIEKQKQ-----LLLQEGHSKELYCLAFQADGALVSTAGTDKTAIIWDLRSGK----AVS 376

Query: 290 ALCHGVYEINVVKWLELNGKTILATGGDDGIVNFW 324
            L      I  + W  ++G T LATGG DG++  W
Sbjct: 377 QLQGHAKTIYCMDW-SIDGHT-LATGGGDGVITIW 409

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 83/196 (42%), Gaps = 15/196 (7%)

Query: 26  ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIW 85
           +L TG  D  I + +    +F   + +    H+  I  +   P    +   SFDST  +W
Sbjct: 268 VLITGGEDHLITVSNRSDGEFITSNSIG--GHEGRITDLQVHPSGKFIGTSSFDSTWRLW 325

Query: 86  AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYEC 145
             E+          L + EGH  E+  +A+  DG  ++T   DK+  IW+   SG   + 
Sbjct: 326 DIEKQKQ-------LLLQEGHSKELYCLAFQADGALVSTAGTDKTAIIWDL-RSG---KA 374

Query: 146 ISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDF 205
           +S LQ H++ +  + W      LA+   D  + IW     D   +  +  H+  V S  F
Sbjct: 375 VSQLQGHAKTIYCMDWSIDGHTLATGGGDGVITIWDLRKSD--KLTKITEHKSIVTSLKF 432

Query: 206 DKTEGVFRLCSGSDDS 221
           DK      + SG D S
Sbjct: 433 DKANDHNLISSGYDRS 448

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 92/233 (39%), Gaps = 37/233 (15%)

Query: 17  IWSFDFSQ--GILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIR------------ 62
           IWS D +     L T S D+ +K    K +   +   LD+   K  +             
Sbjct: 470 IWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLW 529

Query: 63  SVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYL 122
            V   P    LA    D+TV ++  +        M     + GH+  V  +  S+D   +
Sbjct: 530 CVKISPEDRFLAVSLLDNTVKVFFLDS-------MKFFLSLYGHKLPVLSMDISHDSKLI 582

Query: 123 ATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKD 182
            T S DK++ IW  D      +C   L  H   + +V + P      S S D TV+ W  
Sbjct: 583 ITSSADKNIKIWGLDFG----DCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDG 638

Query: 183 YDDDWECVAVLNGHEGTVW----SSDFDKTEGVFRLCSGSDDSTVRVWKYMGD 231
             + ++C+  L GH+G VW    SSD      V      S D ++RVW+   D
Sbjct: 639 --NSFDCIQKLYGHQGEVWALAVSSDGQAVVSV------SHDRSIRVWEETED 683

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 65/140 (46%), Gaps = 17/140 (12%)

Query: 3   SINLIKSLKLYKEKIWSFDFSQ--GILATGSTDRKIKLVSVKYDDF--TLIDVLDETAHK 58
           S+    SL  +K  + S D S    ++ T S D+ IK+  + + D   +L       AH+
Sbjct: 556 SMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLF------AHQ 609

Query: 59  KAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSND 118
            +I +V + P +    + S D TV  W            D +  + GH+ EV  +A S+D
Sbjct: 610 DSIMNVKFLPESHNFFSCSKDGTVKYWDGNS-------FDCIQKLYGHQGEVWALAVSSD 662

Query: 119 GYYLATCSRDKSVWIWETDE 138
           G  + + S D+S+ +WE  E
Sbjct: 663 GQAVVSVSHDRSIRVWEETE 682

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 82/204 (40%), Gaps = 46/204 (22%)

Query: 16  KIWSFDFSQGILATGSTDR---KIKLV------------SVKY---DDFTLIDVLDET-- 55
           K W F   Q ++A G+ D+   K+KL+             VK    D F  + +LD T  
Sbjct: 492 KFWDFKVEQELVA-GTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVK 550

Query: 56  --------------AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLA 101
                          HK  + S+     + L+   S D  + IW  +         D   
Sbjct: 551 VFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFG-------DCHK 603

Query: 102 IIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIW 161
            +  H++ +  V +  + +   +CS+D +V  W+    G  ++CI  L  H  +V  +  
Sbjct: 604 SLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWD----GNSFDCIQKLYGHQGEVWALAV 659

Query: 162 HPSEALLASSSYDDTVRIWKDYDD 185
                 + S S+D ++R+W++ +D
Sbjct: 660 SSDGQAVVSVSHDRSIRVWEETED 683

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 66/153 (43%), Gaps = 17/153 (11%)

Query: 52  LDETAHKKAIRS-VAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEV 110
           +D  A K A  + + +   T +LA G  D T+ IW  +          +L +   H + +
Sbjct: 68  IDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQT-------VLIVFHSHSSAI 120

Query: 111 KGVAWSNDGYYLATCSRDKSVWIWE-TDESGEEYECISVLQEHSQDVKHVIWHPSEALLA 169
             + +   G  L + SRD ++ +W+   E+G     +  L+ H +D    IW  ++  L 
Sbjct: 121 TILRFDQTGTRLISGSRDATIILWDLVAETG-----LCKLRSH-KDAITGIWCENDDWLI 174

Query: 170 SSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWS 202
           S S D  +++W       +CV     H G  WS
Sbjct: 175 SVSKDGLIKLWD--MKVHQCVETHMAHTGECWS 205

 Score = 35.4 bits (80), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 59/137 (43%), Gaps = 16/137 (11%)

Query: 102 IIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEE--------YECISVLQEHS 153
           I E H   +  +  ++DG  L T S DK+V  W+     E            + ++ + +
Sbjct: 462 IEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTT 521

Query: 154 QDVKHVIW----HPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTE 209
            D+   +W     P +  LA S  D+TV+++  + D  +    L GH+  V S D     
Sbjct: 522 LDLGEDLWCVKISPEDRFLAVSLLDNTVKVF--FLDSMKFFLSLYGHKLPVLSMDISHDS 579

Query: 210 GVFRLCSGSDDSTVRVW 226
            +  + + S D  +++W
Sbjct: 580 KL--IITSSADKNIKIW 594

 Score = 33.1 bits (74), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 62/152 (40%), Gaps = 14/152 (9%)

Query: 89  ESADRTFEMDLLAIIEGHENEV--KGVAWSNDGYYLATCSRDKSVW------IWETDESG 140
           +S  R  + D+  ++  + N V     A ++ G  +     +   W      + +T   G
Sbjct: 3   KSYQRFEQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEEVKCWEIKTGELLKTMRDG 62

Query: 141 EEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVA-VLNGHEGT 199
                I    E   +  ++ +H    +LA    D T++IW   D   + V  V + H   
Sbjct: 63  LPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIW---DMQTQTVLIVFHSHSSA 119

Query: 200 VWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGD 231
           +    FD+T    RL SGS D+T+ +W  + +
Sbjct: 120 ITILRFDQTGT--RLISGSRDATIILWDLVAE 149

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 69/155 (44%), Gaps = 13/155 (8%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           AH  A+ ++ +      L +G  D  + IW         F M +  + + H   V+ V++
Sbjct: 121 AHDSAVTTMEYSHAGDWLISGDSDGIIKIWQPN------FNM-VKVLDQAHMECVRDVSF 173

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
           S       TCS D  + IW      +E     VL  H  DVK   WHP+  L+ S S D+
Sbjct: 174 SGTDSKFVTCSDDNILKIWNFSNGQQE----RVLSGHHWDVKSCDWHPTMGLIVSGSKDN 229

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEG 210
            +++W       +C++ + G + T+  + F  T+G
Sbjct: 230 LIKLWDPRSG--QCISTILGFKHTIIKTKFQPTKG 262

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 83/170 (48%), Gaps = 17/170 (10%)

Query: 58  KKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSN 117
           K  I ++ W P    L   ++    S+W        TF  +  +I++ H++ V  + +S+
Sbjct: 81  KHVIPAIKWTPEGRRLVVATYSGEFSLWNGS-----TFNFE--SIMQAHDSAVTTMEYSH 133

Query: 118 DGYYLATCSRDKSVWIWETDESGEEYECISVL-QEHSQDVKHVIWHPSEALLASSSYDDT 176
            G +L +   D  + IW+ +     +  + VL Q H + V+ V +  +++   + S D+ 
Sbjct: 134 AGDWLISGDSDGIIKIWQPN-----FNMVKVLDQAHMECVRDVSFSGTDSKFVTCSDDNI 188

Query: 177 VRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           ++IW   +   E   VL+GH   V S D+  T G+  + SGS D+ +++W
Sbjct: 189 LKIWNFSNGQQE--RVLSGHHWDVKSCDWHPTMGL--IVSGSKDNLIKLW 234

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 92/233 (39%), Gaps = 33/233 (14%)

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENE-VKGVAWSNDG 119
           ++S  W P   L+ +GS D+ + +W              ++ I G ++  +K       G
Sbjct: 210 VKSCDWHPTMGLIVSGSKDNLIKLWDPRSG-------QCISTILGFKHTIIKTKFQPTKG 262

Query: 120 YYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-SEALLASSSYDDTVR 178
             LA  ++DKS  I++  ++ +E +          D   + WHP +E++     YD +++
Sbjct: 263 NLLAVVAKDKSCKIFDIRQNMKELKSF----RDESDYMSLTWHPINESIFTVGCYDGSLK 318

Query: 179 ---IWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW---KYMGDD 232
              + +D         +   H+  + S  ++    +  L S S D T+R W   + M  +
Sbjct: 319 HFDLLQDTGSSNSFHDIPYAHDKCITSLSYNPVGHI--LASASKDRTIRFWTRSRPMDPN 376

Query: 233 EDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGA---DGVLAVYEEVDGE 282
             D          P  + ++V    +G N  I +V     DG+       DG 
Sbjct: 377 AFDD---------PTYNNKKVNAWYFGINNNINAVRPKTEDGIAPPPANTDGH 420

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 69/155 (44%), Gaps = 16/155 (10%)

Query: 27  LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWA 86
           L +G +D  IK+      +F ++ VLD+ AH + +R V++    S     S D+ + IW 
Sbjct: 138 LISGDSDGIIKIWQ---PNFNMVKVLDQ-AHMECVRDVSFSGTDSKFVTCSDDNILKIWN 193

Query: 87  KEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECI 146
                          ++ GH  +VK   W      + + S+D  + +W+   SG   +CI
Sbjct: 194 FSNGQQE-------RVLSGHHWDVKSCDWHPTMGLIVSGSKDNLIKLWDP-RSG---QCI 242

Query: 147 SVLQEHSQDVKHVIWHPSEA-LLASSSYDDTVRIW 180
           S +      +    + P++  LLA  + D + +I+
Sbjct: 243 STILGFKHTIIKTKFQPTKGNLLAVVAKDKSCKIF 277

 Score = 31.6 bits (70), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 6/60 (10%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           AH K I S+++ P   +LA+ S D T+  W       R+  MD  A  +   N  K  AW
Sbjct: 338 AHDKCITSLSYNPVGHILASASKDRTIRFWT------RSRPMDPNAFDDPTYNNKKVNAW 391

>Scas_674.20
          Length = 297

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 75/163 (46%), Gaps = 11/163 (6%)

Query: 99  LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKH 158
           ++AI   H + +        G  LATCS DK++ I+E +  GE ++ ++ L+ H   V  
Sbjct: 1   MVAIANAHNDLIHDAVLDYYGKRLATCSSDKTIKIFEVE--GETHKEVATLEGHDGPVWR 58

Query: 159 VIW-HPS-EALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCS 216
           V W HP    +LAS SYD  V IWK+ +  W  +A    H  +V S  +   E    L +
Sbjct: 59  VDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIACHAVHSASVNSVQWAPHEYGALLLA 118

Query: 217 GSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWG 259
            S D  V V ++       ++      I+ D H   V + +W 
Sbjct: 119 ASSDGKVSVVEF-------KENGTLTPIIIDAHNIGVNSASWA 154

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 101/246 (41%), Gaps = 34/246 (13%)

Query: 7   IKSLKLYKEKIWSFDFSQG----ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIR 62
           + +L+ +   +W  D++      ILA+ S D K+ +   K ++     +     H  ++ 
Sbjct: 46  VATLEGHDGPVWRVDWAHPKFGTILASCSYDGKVLIW--KEENGRWSQIACHAVHSASVN 103

Query: 63  SVAWRPHT--SLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS---- 116
           SV W PH   +LL A S D  VS+   +E+   T       II+ H   V   +W+    
Sbjct: 104 SVQWAPHEYGALLLAASSDGKVSVVEFKENGTLT-----PIIIDAHNIGVNSASWAPATL 158

Query: 117 ---------NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEAL 167
                     +     T   D  V IW+ +   + Y     LQ HS  V+ V W PS  L
Sbjct: 159 QENKPTKSPEESRRFVTGGADNLVKIWKYNNESQTYLLEDTLQGHSDWVRDVAWSPSVLL 218

Query: 168 ---LASSSYDDTVRIWKDYDDD--WECVAVLNGH-EGTVWSSDFDKTEGVFRLCSGSDDS 221
              +AS S D T  IW   ++D  W+   +        +W + +  +  +  L  G  D+
Sbjct: 219 RSYIASVSQDKTCIIWTQENNDSSWKKTELQKERFPDVLWRASWSLSGNILALSGG--DN 276

Query: 222 TVRVWK 227
            V +WK
Sbjct: 277 KVTLWK 282

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 55/113 (48%), Gaps = 10/113 (8%)

Query: 168 LASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
           LA+ S D T++I++   +  + VA L GH+G VW  D+   +    L S S D  V +WK
Sbjct: 24  LATCSSDKTIKIFEVEGETHKEVATLEGHDGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83

Query: 228 YMGDDEDDQQEWVCEAILPDVHKRQVYNVAWG---FNGLIASVGADGVLAVYE 277
              ++     +  C A    VH   V +V W    +  L+ +  +DG ++V E
Sbjct: 84  ---EENGRWSQIACHA----VHSASVNSVQWAPHEYGALLLAASSDGKVSVVE 129

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 54/119 (45%), Gaps = 9/119 (7%)

Query: 27  LATGSTDRKIKLVSVKYDDFTLIDVLDET--AHKKAIRSVAWRPHT---SLLAAGSFDST 81
             TG  D  +K+   KY++ +   +L++T   H   +R VAW P     S +A+ S D T
Sbjct: 173 FVTGGADNLVKIW--KYNNESQTYLLEDTLQGHSDWVRDVAWSPSVLLRSYIASVSQDKT 230

Query: 82  VSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESG 140
             IW +E +     + +L    E   + +   +WS  G  LA    D  V +W+ +  G
Sbjct: 231 CIIWTQENNDSSWKKTELQK--ERFPDVLWRASWSLSGNILALSGGDNKVTLWKENLEG 287

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 64/131 (48%), Gaps = 19/131 (14%)

Query: 56  AHKKAIRSVAWRPH-TSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
            H+  +  VA+ P   +  A+   D TV IW+  + +   F M          +E +GV 
Sbjct: 20  GHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSP-NFTMT--------AHETRGVN 70

Query: 115 WSN-----DGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLA 169
           + +     D  YL T S D+SV IW+     +   C++ L+ H  +V + I+HPS  ++ 
Sbjct: 71  FVDYYPLQDKPYLITSSDDRSVKIWDY----QTKSCVATLEGHMANVSYAIFHPSLPIII 126

Query: 170 SSSYDDTVRIW 180
           S S D TV+IW
Sbjct: 127 SGSEDGTVKIW 137

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 72/145 (49%), Gaps = 18/145 (12%)

Query: 85  WAKEESADRTFEMDLLAIIEGHENEVKGVAWS-NDGYYLATCSRDKSVWIWETDESGEEY 143
           W K  + ++TFE        GHE+ V  VA++  D    A+   D +V IW     G++ 
Sbjct: 8   WEKNWALEQTFE--------GHEHFVMCVAFNPKDPNTFASACLDHTVKIWSL---GQQS 56

Query: 144 ECISVLQEHSQDVKHVIWHP--SEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVW 201
              ++    ++ V  V ++P   +  L +SS D +V+IW DY     CVA L GH   V 
Sbjct: 57  PNFTMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIW-DYQTK-SCVATLEGHMANVS 114

Query: 202 SSDFDKTEGVFRLCSGSDDSTVRVW 226
            + F  +  +  + SGS+D TV++W
Sbjct: 115 YAIFHPSLPI--IISGSEDGTVKIW 137

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 76/196 (38%), Gaps = 22/196 (11%)

Query: 131 VWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA-LLASSSYDDTVRIWKDYDDDWEC 189
           +W WE + + E+       + H   V  V ++P +    AS+  D TV+IW         
Sbjct: 5   LWNWEKNWALEQ-----TFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNF 59

Query: 190 VAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVH 249
               +   G  +  D+   +    L + SDD +V++W Y        Q   C A L    
Sbjct: 60  TMTAHETRGVNFV-DYYPLQDKPYLITSSDDRSVKIWDY--------QTKSCVATLEGHM 110

Query: 250 KRQVYNVAWGFNGLIASVGADGVLAVYE----EVDGEWKVFAKRALC---HGVYEINVVK 302
               Y +      +I S   DG + ++     +++    +  +R+ C   H   + N V 
Sbjct: 111 ANVSYAIFHPSLPIIISGSEDGTVKIWNANTYKLEKTLNLGLERSWCVAAHPTGKRNYVA 170

Query: 303 WLELNGKTILATGGDD 318
               NG  +L+ G D+
Sbjct: 171 SGFDNGFNVLSMGNDE 186

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 76/158 (48%), Gaps = 20/158 (12%)

Query: 110 VKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLA 169
           ++ V +S DG YLAT + DK + IW+        + +  LQ H QD+  + + P+   L 
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTTK----KILMTLQGHEQDIYSLDYFPAGDKLV 410

Query: 170 SSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYM 229
           S S D TVRIW       +C   L+  +G V +      +G + + +GS D TVRVW   
Sbjct: 411 SGSGDRTVRIWDLR--TGQCSLTLSIEDG-VTTVAVSPGDGKY-IAAGSLDRTVRVW--- 463

Query: 230 GDDEDDQQEWVCEAI-----LPDVHKRQVYNVAWGFNG 262
               D +  ++ E +     L   HK  VY+V +  +G
Sbjct: 464 ----DSETGFLVERLDSENELSTGHKDSVYSVVFTRDG 497

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 105/243 (43%), Gaps = 27/243 (11%)

Query: 1   MASINLIKSLKLYKEKIWSFD-FSQG-ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHK 58
           + +  ++ +L+ +++ I+S D F  G  L +GS DR +++  ++    +L   +++    
Sbjct: 381 LTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIED---- 436

Query: 59  KAIRSVAWRPH-TSLLAAGSFDSTVSIWAKE-----ESADRTFEMDLLAIIEGHENEVKG 112
             + +VA  P     +AAGS D TV +W  E     E  D   E+       GH++ V  
Sbjct: 437 -GVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELS-----TGHKDSVYS 490

Query: 113 VAWSNDGYYLATCSRDKSVWIWET---DESGEEYECISVLQEHSQDVKHVIWHPSEALLA 169
           V ++ DG  + + S D+SV +W+    +       C      H   V  V     +  + 
Sbjct: 491 VVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYIL 550

Query: 170 SSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWS----SDFDKTEGVFRLCSGSDDSTVRV 225
           S S D  V  W     +   + +L GH  +V S    + F     V    +GS D   R+
Sbjct: 551 SGSKDRGVLFWDTASGN--PLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARI 608

Query: 226 WKY 228
           WKY
Sbjct: 609 WKY 611

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 86/180 (47%), Gaps = 28/180 (15%)

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120
           IRSV + P    LA G+ D  + IW      D T +  +L  ++GHE ++  + +   G 
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIW------DLTTK-KILMTLQGHEQDIYSLDYFPAGD 407

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA-LLASSSYDDTVRI 179
            L + S D++V IW+   +G+    +S+       V  V   P +   +A+ S D TVR+
Sbjct: 408 KLVSGSGDRTVRIWDL-RTGQCSLTLSI----EDGVTTVAVSPGDGKYIAAGSLDRTVRV 462

Query: 180 W--------KDYDDDWECVAVLNGHEGTVWSSDFDK-TEGVFRLCSGSDDSTVRVWKYMG 230
           W        +  D + E   +  GH+ +V+S  F +  +GV    SGS D +V++W   G
Sbjct: 463 WDSETGFLVERLDSENE---LSTGHKDSVYSVVFTRDGQGVI---SGSLDRSVKLWDLRG 516

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 100/235 (42%), Gaps = 26/235 (11%)

Query: 2   ASINLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAI 61
           A+I    S  LY   +  F      LATG+ D+ I++    +D  T   ++    H++ I
Sbjct: 343 ATIQPASSSDLYIRSVC-FSPDGKYLATGAEDKLIRI----WDLTTKKILMTLQGHEQDI 397

Query: 62  RSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS-NDGY 120
            S+ + P    L +GS D TV IW       RT +  L   I   E+ V  VA S  DG 
Sbjct: 398 YSLDYFPAGDKLVSGSGDRTVRIWDL-----RTGQCSLTLSI---EDGVTTVAVSPGDGK 449

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQE----HSQDVKHVIWHPSEALLASSSYDDT 176
           Y+A  S D++V +W++ E+G   E +    E    H   V  V++      + S S D +
Sbjct: 450 YIAAGSLDRTVRVWDS-ETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRS 508

Query: 177 VRIW-----KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           V++W             C     GH+  V S     T+    + SGS D  V  W
Sbjct: 509 VKLWDLRGLNGQKSHATCEVTYTGHKDFVLS--VATTQDDEYILSGSKDRGVLFW 561

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 66/164 (40%), Gaps = 35/164 (21%)

Query: 93  RTFEMDLLAIIEGHENEVKGVAWSNDGYYLAT-CSRDKSVWIWET--------------- 136
           R  ++DL   ++ H + V  V +SNDG YLAT C++   V+   T               
Sbjct: 263 RDLDVDLHHSLD-HSSVVCCVRFSNDGEYLATGCNKTTQVYKVSTGELLARLSDDSVAGV 321

Query: 137 --------------DESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKD 182
                         D  GE    I         ++ V + P    LA+ + D  +RIW  
Sbjct: 322 NNEASTGPANNGTADNGGENSATIQPASSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDL 381

Query: 183 YDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
                + +  L GHE  ++S D+       +L SGS D TVR+W
Sbjct: 382 TTK--KILMTLQGHEQDIYSLDYFPAGD--KLVSGSGDRTVRIW 421

>Scas_629.12
          Length = 671

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 73/155 (47%), Gaps = 17/155 (10%)

Query: 72  LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSV 131
           L+A  S DS  S      ++  T   DL          ++ V +S DG +LAT + DK +
Sbjct: 361 LIAKLSDDSVTSPDTSSATSGSTPSTDLY---------IRSVCFSPDGEFLATGAEDKLI 411

Query: 132 WIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVA 191
            IW+     +E + + VL+ H QDV  + + P+   L S S D TVRIW       +C  
Sbjct: 412 RIWDI----QERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLR--TGQCSL 465

Query: 192 VLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            L+   G V +      +G F + +GS D  VRVW
Sbjct: 466 TLSIEYG-VTTVAVSPNDGKF-IAAGSLDRAVRVW 498

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 85/175 (48%), Gaps = 26/175 (14%)

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120
           IRSV + P    LA G+ D  + IW  +       E  ++ +++GHE +V  + +  +G 
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIWDIQ-------ERKIVMVLKGHEQDVYSLDYFPNGE 442

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA-LLASSSYDDTVRI 179
            L + S D++V IW+   +G+    +S+  E+   V  V   P++   +A+ S D  VR+
Sbjct: 443 KLVSGSGDRTVRIWDL-RTGQCSLTLSI--EYG--VTTVAVSPNDGKFIAAGSLDRAVRV 497

Query: 180 W--------KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           W        +  D + E   +  GH  +V+S  F  T     + SGS D TV++W
Sbjct: 498 WDSTTGFLVERLDSENE---LGTGHRDSVYSVVF--TRDGNEVVSGSLDKTVKLW 547

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 64/135 (47%), Gaps = 19/135 (14%)

Query: 106 HENEVKGVAWSNDGYYLAT-CSRDKSVWIWE--------TDESGEEYECISVLQEHSQD- 155
           H + V  V +SNDG +LAT C++   ++           +D+S    +  S     +   
Sbjct: 327 HSSVVCCVKFSNDGQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPST 386

Query: 156 ---VKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSD-FDKTEGV 211
              ++ V + P    LA+ + D  +RIW     + + V VL GHE  V+S D F   E  
Sbjct: 387 DLYIRSVCFSPDGEFLATGAEDKLIRIWD--IQERKIVMVLKGHEQDVYSLDYFPNGE-- 442

Query: 212 FRLCSGSDDSTVRVW 226
            +L SGS D TVR+W
Sbjct: 443 -KLVSGSGDRTVRIW 456

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 99/248 (39%), Gaps = 39/248 (15%)

Query: 6   LIKSLKLYKEKIWSFD-FSQG-ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRS 63
           ++  LK +++ ++S D F  G  L +GS DR +++  ++    +L   ++       + +
Sbjct: 421 IVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIE-----YGVTT 475

Query: 64  VAWRPH-TSLLAAGSFDSTVSIWAKE-----ESADRTFEMDLLAIIEGHENEVKGVAWSN 117
           VA  P+    +AAGS D  V +W        E  D   E+       GH + V  V ++ 
Sbjct: 476 VAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELGT-----GHRDSVYSVVFTR 530

Query: 118 DGYYLATCSRDKSVWIWETDESGEEYE-----------CISVLQEHSQDVKHVIWHPSEA 166
           DG  + + S DK+V +W    SG               C      H   V  V     + 
Sbjct: 531 DGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDK 590

Query: 167 LLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWS------SDFDKTEGVFRLCSGSDD 220
            + S S D  +  W    +    + +L GH  +V S      S       VF   +GS D
Sbjct: 591 YILSGSKDRGILFWD--KESGNPLLMLQGHRNSVISVAVANGSALGPKYNVF--ATGSGD 646

Query: 221 STVRVWKY 228
              R+WKY
Sbjct: 647 CKARIWKY 654

>Scas_702.16
          Length = 816

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 82/206 (39%), Gaps = 33/206 (16%)

Query: 54  ETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWA--------------KEESADRTFEMDL 99
           E +    I +V   P    +A G  D  + IW+               E   D+  +  L
Sbjct: 13  EESRSYEIYTVDVSPDGKRVATGGLDGKIRIWSVDSIKQIVKILSLKDEVPIDKELKKPL 72

Query: 100 LAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDES------------GEEYECIS 147
            A +  H   V  + +S +G YLA+ S D+ + IW  DE              E +    
Sbjct: 73  -ASMSRHTGSVTCLKFSPNGKYLASGSDDRILLIWTLDEERPIQPIFGGESEKERWAVRK 131

Query: 148 VLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDK 207
            L  H  D++ + W P  +LL S   D  V IW      +E +   + H+  V    FD 
Sbjct: 132 RLVAHDNDIQDICWAPDSSLLVSVGLDRAVIIWNGI--TFEKLKRFDVHQSHVKGVIFDP 189

Query: 208 TEGVFRLCSGSDDSTVRVWKY--MGD 231
               F   + SDD T+++++Y  +GD
Sbjct: 190 ANKYF--ATASDDRTMKIFRYHKIGD 213

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 62/147 (42%), Gaps = 22/147 (14%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           AH   I+ + W P +SLL +   D  V IW        TFE   L   + H++ VKGV +
Sbjct: 135 AHDNDIQDICWAPDSSLLVSVGLDRAVIIWN-----GITFEK--LKRFDVHQSHVKGVIF 187

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
                Y AT S D+++ I+   + G+           S  ++HV+  P +    ++ +  
Sbjct: 188 DPANKYFATASDDRTMKIFRYHKIGDA----------SFTIEHVVTEPFKGSPLTTYFRR 237

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWS 202
                  +  D + +A  N   G V S
Sbjct: 238 L-----SWSPDGQHIAAPNATNGPVSS 259

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 56/259 (21%), Positives = 99/259 (38%), Gaps = 35/259 (13%)

Query: 20  FDFSQGILATGSTDRKIKLVSV-KYDD--FTLIDVLDETAHKKAI----RSVAWRPHTSL 72
           FD +    AT S DR +K+    K  D  FT+  V+ E      +    R ++W P    
Sbjct: 187 FDPANKYFATASDDRTMKIFRYHKIGDASFTIEHVVTEPFKGSPLTTYFRRLSWSPDGQH 246

Query: 73  LAA----------------GSFDSTVSIWAKEESADRT-FEMDLLAIIEGH-ENEVKGVA 114
           +AA                G++DS +S+   +   +   F   L  + +G    + K  +
Sbjct: 247 IAAPNATNGPVSSVAIINRGTWDSNISLIGHDAPTEVVRFNPRLFEVNDGMTPAKRKQDS 306

Query: 115 WSNDGY--YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSS 172
             ND     +AT  +DK+V +W T  +   +    +  +   D++   W P   +L  +S
Sbjct: 307 GPNDSMESIIATAGQDKTVVVWSTTRARPIFIAFDIANKSITDMQ---WTPDGTMLFLTS 363

Query: 173 YDDTVRIWKDYDDDWECVAVLNG-----HEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
            D ++ I    D++   +  L       H   V     D  E V +L      + ++  K
Sbjct: 364 LDSSITILVFEDNELGKIIPLEKNIEQLHRYGVDKDSLDFPESVEQLIFEETVNKLKKPK 423

Query: 228 YMGDDEDDQQEWVCEAILP 246
                    QE   +++LP
Sbjct: 424 LSSTSNLQLQEKKPDSLLP 442

>Scas_721.32
          Length = 822

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 97/230 (42%), Gaps = 30/230 (13%)

Query: 40  SVKYDDF--TLIDVLDETAHKK--AIRSVAWRPHTSLLAAGSFDSTVSIWA--------- 86
           S+K D+    L  V   T H     + S+ +   + L+AAG  DS + +W+         
Sbjct: 465 SIKLDNLQAALPSVCMYTFHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQI 524

Query: 87  KEESADRTFEMDL----LAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEE 142
           +E+SAD     D+       + GH   V   ++S D  YL + S DK+V +W TD     
Sbjct: 525 QEKSADSINTGDMNDNTSTTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTD----T 580

Query: 143 YECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWS 202
           Y  +   + H+  V  V + P     A++S+D T R+W    D    + +  GH   V  
Sbjct: 581 YTSLVSYKGHNHPVWDVQFSPLGHYFATASHDQTARLWS--CDHIYPLRIFAGHLSDVDC 638

Query: 203 SDFDKTEGVFRLCSGSDDSTVRVWKYMGDDE-----DDQQEWVCEAILPD 247
             F    G + + +GS D T R+W     D            +C A+ PD
Sbjct: 639 VSF-HPNGCY-VFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPD 686

>KLLA0F06754g complement(650475..651509) similar to sp|P53011
           Saccharomyces cerevisiae YGL100w SEH1 nuclear pore
           protein, start by similarity
          Length = 344

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 51/246 (20%), Positives = 107/246 (43%), Gaps = 23/246 (9%)

Query: 99  LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKH 158
           +   + GH + V  +++   G  +ATCS D+ + +++ D+   E+E     + H   +  
Sbjct: 1   MKPFLTGHSDLVHDISYDFYGRRVATCSSDQHIKVFKLDKETNEWELSESWKAHDSSIVS 60

Query: 159 VIWHPSE--ALLASSSYDDTVRIWKDYDD-------DWECVAVLNGHEGTVWSSDFDKTE 209
           + W   E   ++AS SYD T+++W++  D        W+ +  LN   G ++S  F  + 
Sbjct: 61  LDWAAPEFGRIIASVSYDKTIKLWEEDPDALELSGKRWQKLCTLNDATGPLFSVKFAPSH 120

Query: 210 GVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAIL------PDVHKRQVYNVAW---GF 260
              RL +  +D  +R++  +  +  D + W   + +      P  H +  + ++W    F
Sbjct: 121 LGLRLAALGNDGKLRLYDAL--ESSDLRSWTLTSEITVLNTPPASHLQSDFCLSWCPSRF 178

Query: 261 NGLIASVGADGVLAVYEEVDGEWKVFAKRALCHGVYEINVVKWLELNGK--TILATGGDD 318
           +     + A     +Y+  + + K+     L      I  + W    G+   ++ATG  D
Sbjct: 179 STERLVISAMDQATIYQR-NKQGKLVPAGHLKGHTGLIRSIAWAPSVGRWYQLIATGCKD 237

Query: 319 GIVNFW 324
           G +  +
Sbjct: 238 GKLRIF 243

 Score = 34.7 bits (78), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 60/150 (40%), Gaps = 27/150 (18%)

Query: 56  AHKKAIRSVAWRPHT----SLLAAGSFDSTVSIWAKEESADR-----TFEMDLLAIIEGH 106
            H   IRS+AW P       L+A G  D  + I+   ES +        E D  A IE  
Sbjct: 210 GHTGLIRSIAWAPSVGRWYQLIATGCKDGKLRIFKVTESRNNGTNIINEENDNNANIERD 269

Query: 107 ENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA 166
              +   A   DG                   +    E IS   +H  +V  V W+ +  
Sbjct: 270 GPPIDSSAIDADGSV-----------------ANLHVELISEHSDHQGEVWSVSWNLTGT 312

Query: 167 LLASSSYDDTVRIWK-DYDDDWECVAVLNG 195
           +L+S+  D  +R+WK  Y +++ C++V+  
Sbjct: 313 ILSSTGDDGKIRLWKASYSNEFRCMSVVQA 342

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 97/232 (41%), Gaps = 26/232 (11%)

Query: 19  SFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDET--AHKKAIRSVAWRPHT--SLLA 74
           S+DF    +AT S+D+ IK+   K D  T    L E+  AH  +I S+ W       ++A
Sbjct: 16  SYDFYGRRVATCSSDQHIKVF--KLDKETNEWELSESWKAHDSSIVSLDWAAPEFGRIIA 73

Query: 75  AGSFDSTVSIW-----AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDK 129
           + S+D T+ +W     A E S  R  ++  L    G    VK  A S+ G  LA    D 
Sbjct: 74  SVSYDKTIKLWEEDPDALELSGKRWQKLCTLNDATGPLFSVK-FAPSHLGLRLAALGNDG 132

Query: 130 SVWIWETDESGEEY-----ECISVLQ----EHSQDVKHVIWHPSE---ALLASSSYDDTV 177
            + +++  ES +         I+VL      H Q    + W PS      L  S+ D   
Sbjct: 133 KLRLYDALESSDLRSWTLTSEITVLNTPPASHLQSDFCLSWCPSRFSTERLVISAMDQAT 192

Query: 178 RIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFR--LCSGSDDSTVRVWK 227
              ++          L GH G + S  +  + G +   + +G  D  +R++K
Sbjct: 193 IYQRNKQGKLVPAGHLKGHTGLIRSIAWAPSVGRWYQLIATGCKDGKLRIFK 244

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 57.0 bits (136), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 104/255 (40%), Gaps = 36/255 (14%)

Query: 73  LAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVW 132
            A GS DST+ +W             L   ++GH   V+ +  S    Y+ + S+DK V 
Sbjct: 129 FATGSNDSTIRVWDLATGK-------LKVTLQGHIMTVRDICISARHPYMFSASQDKLVK 181

Query: 133 IWETDESGEEYECISVLQE-HSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVA 191
            W+ + +    +    L   HS D+     HPS  L+ S+  D  VR+W        CV 
Sbjct: 182 CWDLERNTVVRDFHGTLSGVHSVDL-----HPSLDLIVSAGRDSVVRVWDIRSR--SCVL 234

Query: 192 VLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKR 251
            L GH G +        +   ++ S S D+TV++W  +                   HKR
Sbjct: 235 TLAGHRGPINKVRCLPVDP--QIVSCSTDATVKLWDLVAGKPMKTLTH---------HKR 283

Query: 252 QVYNVAWGFNGL-IASVGADGVLAVYEEVDGEWKV-FAKRALCHGVYEINVVKWLELNGK 309
            V ++A+       AS   D + + ++ VDG+    F   AL        +V  L  N  
Sbjct: 284 NVRDLAFNPTEFSFASACTDDIRS-WKLVDGQLLTNFNSEAL-------GIVNTLACNQD 335

Query: 310 TILATGGDDGIVNFW 324
            +L  GGD G ++F+
Sbjct: 336 GVLFAGGDTGELSFF 350

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 169 ASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           A + Y++ V     +   W+   V+NGH G V     D  +  +   +GS+DST+RVW
Sbjct: 85  ALARYEEVVSQKPQWHAPWKLTRVINGHTGWVRCVCVDPVDNAW-FATGSNDSTIRVW 141

>Kwal_27.11585
          Length = 823

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 75/172 (43%), Gaps = 19/172 (11%)

Query: 31  STDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEES 90
            T   + + ++K  D+T        AH+K I +++  P+ S+ A  S+D T  IW  +  
Sbjct: 483 PTSNDVDMHNIKVSDYT------RRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSG 536

Query: 91  ADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQ 150
                  +L   +  H+  +  V +      LATCS DK++ +W    S E    +  L+
Sbjct: 537 -------ELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVW----SLESMSVVKTLE 585

Query: 151 EHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWS 202
            H+  V+   +      + S+  D  +++W       EC+  L+ H   +W+
Sbjct: 586 GHTNAVQRCSFINRNKQIVSTGADGLIKVWD--LSTGECIRTLDAHSNRIWA 635

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 103/240 (42%), Gaps = 36/240 (15%)

Query: 102 IIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDV----- 156
           + EGH + +  +  S +G +LATCS+D +V +W+ +   E+++  +    H+  V     
Sbjct: 395 LYEGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTAVGL 454

Query: 157 KHVIWHPSEALLASSSYDDTVRIWK-----DYDDDWECVAV----LNGHEGTVWSSDFDK 207
            +V+ +     + ++S D T++ W        D D   + V       HE  + +     
Sbjct: 455 PNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISP 514

Query: 208 TEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAW-GFNGLIAS 266
            + VF   + S D T ++W        D  E   E  L + HKR +++V +  ++ L+A+
Sbjct: 515 NDSVF--ATASYDKTCKIWNV------DSGEL--EGTLAN-HKRGLWDVTFCQYDKLLAT 563

Query: 267 VGADGVLAVYEEVDGEWKVFAKRALCHGVYEINVVKWLEL--NGKTILATGGDDGIVNFW 324
              D  + V       W + +   +       N V+        K I++TG  DG++  W
Sbjct: 564 CSGDKTIKV-------WSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGA-DGLIKVW 615

>Kwal_27.10385
          Length = 536

 Score = 57.0 bits (136), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 79/177 (44%), Gaps = 26/177 (14%)

Query: 27  LATGSTDRKIKLVSVKYDD-----FTLIDVLDE-TAHKKAIRSVAWRPHTSLLAAGSFDS 80
           L T   D KI++  + +++        ID L   T H++A+  + +     +LA    D 
Sbjct: 34  LVTAGGDNKIRVWQLNFEEQNENKVDTIDFLSSLTQHEQAVNVIRFNSRNDVLATAGDDG 93

Query: 81  TVSIWAKEESADRTFEMDLLAIIEGHEN----------------EVKGVAWSNDGYYLAT 124
            + +W + +S  + F +D     E  E+                E+  +AWS D  Y+ T
Sbjct: 94  QLLLWKRNDSISKEFGVDEEEFAEFKESWYVWKRLRSSSTAGSSEIYDLAWSPDDNYIVT 153

Query: 125 CSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWK 181
            S D S+ I+E     EE  C++   +H+  V+ V+W P    + S S D +V +++
Sbjct: 154 GSMDNSLRIFEV----EEGTCVANAADHNHYVQGVVWDPQNEFIFSQSADRSVHVYR 206

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 7/85 (8%)

Query: 55  TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
           TA    I  +AW P  + +  GS D+++ I+  EE          +A    H + V+GV 
Sbjct: 133 TAGSSEIYDLAWSPDDNYIVTGSMDNSLRIFEVEEGT-------CVANAADHNHYVQGVV 185

Query: 115 WSNDGYYLATCSRDKSVWIWETDES 139
           W     ++ + S D+SV ++  +++
Sbjct: 186 WDPQNEFIFSQSADRSVHVYRIEKT 210

>Kwal_23.5035
          Length = 744

 Score = 57.0 bits (136), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 70/298 (23%), Positives = 124/298 (41%), Gaps = 55/298 (18%)

Query: 9   SLKLYKEKIWS-FDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWR 67
           +L+ +  KI +   F    + TG+ D+ I++   K + F    +   + H   + ++ + 
Sbjct: 364 TLRGHTMKIVTCLQFEDDYVITGADDKMIRVYDAKTEKF----ITQLSGHDGGVWALKYG 419

Query: 68  PHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVK--GVAWSNDGYYLATC 125
            H  +L +GS D +V +W  +             + +GH + V+   +   N   ++ T 
Sbjct: 420 -HDGILVSGSTDRSVRVWNIKSGK-------CTHVFKGHTSTVRCLDIVEHNGKKFIVTG 471

Query: 126 SRDKSVWIWETDE-SGEEYE---C------------ISVLQEHSQDVKHVIWHPSEALLA 169
           SRD ++ +W+    + E+Y    C            + VL+ H   V+ V  H +  ++ 
Sbjct: 472 SRDHTLHVWKLPNCNAEDYNPEVCEVFNTTDANPYFVGVLRGHMAAVRTVSGHGN--IVV 529

Query: 170 SSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYM 229
           S SYD  + +W       +C+ VL GH   ++S+ +D      R  S   DSTV+VW   
Sbjct: 530 SGSYDFNLMVWDIAQ--MKCLYVLTGHTDRIYSTIYDYQRN--RCISAGMDSTVKVW--- 582

Query: 230 GDDEDDQQEWVCEAILPDVHK----------RQVYNVAWGFNGL----IASVGADGVL 273
            D  D  +   C  I    +            Q +    G  GL    + S GADG+L
Sbjct: 583 -DLADVSKNGPCTTITSSNNPCTKVTGSSITLQGHTALVGLLGLSDKFLVSAGADGIL 639

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 65/155 (41%), Gaps = 7/155 (4%)

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
           Y+ T + DK + ++  D   E++  I+ L  H   V   + +  + +L S S D +VR+W
Sbjct: 382 YVITGADDKMIRVY--DAKTEKF--ITQLSGHDGGV-WALKYGHDGILVSGSTDRSVRVW 436

Query: 181 KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWV 240
                  +C  V  GH  TV   D  +  G   + +GS D T+ VWK    + +D    V
Sbjct: 437 NI--KSGKCTHVFKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVWKLPNCNAEDYNPEV 494

Query: 241 CEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAV 275
           CE             V  G    + +V   G + V
Sbjct: 495 CEVFNTTDANPYFVGVLRGHMAAVRTVSGHGNIVV 529

>Scas_704.40
          Length = 608

 Score = 56.6 bits (135), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 73/155 (47%), Gaps = 20/155 (12%)

Query: 72  LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSV 131
           LL  GS+DSTV+IW             L+  + GH + VK + +  D   L T S DK++
Sbjct: 265 LLFTGSYDSTVAIWD-------LCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTI 315

Query: 132 WIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVA 191
            +W         ECIS  + H+  V  V     + ++ S S D TV+IW  + +   C  
Sbjct: 316 RVWNYKTG----ECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIW--HVESRTCYT 367

Query: 192 VLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            L GH  T W +        F   SGSDD+T+R+W
Sbjct: 368 -LRGH--TEWVNCVKLHPKSFTCFSGSDDTTIRMW 399

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 98/230 (42%), Gaps = 33/230 (14%)

Query: 7   IKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDD-FTLIDVLDETAHKKAIRSVA 65
           I + + + + + S D  + I+ +GS D+ +K+  V+    +TL        H + +  V 
Sbjct: 326 ISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTL------RGHTEWVNCVK 379

Query: 66  WRPHTSLLAAGSFDSTVSIW-AKEESADRTFEMDL--------LAIIEGHENEVKGVAWS 116
             P +    +GS D+T+ +W  +  S  + F   +        L II+     V  ++ S
Sbjct: 380 LHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGS 439

Query: 117 NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDT 176
           N+G      +   +  I     + +E          +Q +   I +P+  L  S S D+T
Sbjct: 440 NEGDDEPASTTTPTAAIAAEAATNDE---------ENQTLDKSIPYPTHLL--SCSLDNT 488

Query: 177 VRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           +++W       +C+    GH   VW    D     FR+ SGS D ++++W
Sbjct: 489 IKLWDV--QTGQCIRTQFGHVEGVWDIAADN----FRIISGSHDGSIKIW 532

 Score = 36.2 bits (82), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 6/62 (9%)

Query: 167 LLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           LL + SYD TV IW    +  + +  L+GH   V +  FD+     +L +GS D T+RVW
Sbjct: 265 LLFTGSYDSTVAIWDLCSN--KLIRRLSGHTDGVKTLYFDEA----KLVTGSLDKTIRVW 318

Query: 227 KY 228
            Y
Sbjct: 319 NY 320

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 82/170 (48%), Gaps = 17/170 (10%)

Query: 58  KKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSN 117
           K  I ++ W P    L   +++   S+W+           +  +I++ H++ V  + +S+
Sbjct: 81  KHVIPALTWTPEGRRLVVATYNGEFSLWSGSS-------FNFESIMQAHDSAVTVMTYSH 133

Query: 118 DGYYLATCSRDKSVWIWETDESGEEYECISVL-QEHSQDVKHVIWHPSEALLASSSYDDT 176
            G ++ + S D  + IW+ +     +  + V+ Q H + V+ + + P++    S S D+ 
Sbjct: 134 TGDWMVSGSADGELKIWQPN-----FNMVKVMDQAHMECVREISFSPTDQKFVSCSDDNV 188

Query: 177 VRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           ++IW   +   E   VL+GH   V S D+    G+  + SGS D+ ++ W
Sbjct: 189 LKIWNFSNGQQE--RVLSGHHWDVKSCDWHPKMGL--IVSGSKDNLIKFW 234

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 73/171 (42%), Gaps = 14/171 (8%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           AH  A+  + +      + +GS D  + IW         F M +  + + H   V+ +++
Sbjct: 121 AHDSAVTVMTYSHTGDWMVSGSADGELKIWQPN------FNM-VKVMDQAHMECVREISF 173

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
           S       +CS D  + IW      +E     VL  H  DVK   WHP   L+ S S D+
Sbjct: 174 SPTDQKFVSCSDDNVLKIWNFSNGQQE----RVLSGHHWDVKSCDWHPKMGLIVSGSKDN 229

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            ++ W        CV+ + G + T+ S+ F   +G   L   S D T +V+
Sbjct: 230 LIKFWDPRSG--SCVSTMLGFKHTIISTKFQPKQGNL-LSVISKDKTCKVY 277

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 68/155 (43%), Gaps = 16/155 (10%)

Query: 27  LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWA 86
           + +GS D ++K+      +F ++ V+D+ AH + +R +++ P      + S D+ + IW 
Sbjct: 138 MVSGSADGELKIWQ---PNFNMVKVMDQ-AHMECVREISFSPTDQKFVSCSDDNVLKIWN 193

Query: 87  KEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECI 146
                          ++ GH  +VK   W      + + S+D  +  W+   SG    C+
Sbjct: 194 FSNGQQE-------RVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKFWDP-RSG---SCV 242

Query: 147 SVLQEHSQDVKHVIWHPSEA-LLASSSYDDTVRIW 180
           S +      +    + P +  LL+  S D T +++
Sbjct: 243 STMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVY 277

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 73/174 (41%), Gaps = 20/174 (11%)

Query: 110 VKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLA 169
           +  + W+ +G  L   + +    +W    SG  +   S++Q H   V  + +  +   + 
Sbjct: 84  IPALTWTPEGRRLVVATYNGEFSLW----SGSSFNFESIMQAHDSAVTVMTYSHTGDWMV 139

Query: 170 SSSYDDTVRIWKDYDDDWECVAVLN-GHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKY 228
           S S D  ++IW+    ++  V V++  H   V    F  T+  F  C  SDD+ +++W +
Sbjct: 140 SGSADGELKIWQ---PNFNMVKVMDQAHMECVREISFSPTDQKFVSC--SDDNVLKIWNF 194

Query: 229 MGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFN-GLIASVGADGVLAVYEEVDG 281
                + QQE V        H   V +  W    GLI S   D ++  ++   G
Sbjct: 195 ----SNGQQERVLSG-----HHWDVKSCDWHPKMGLIVSGSKDNLIKFWDPRSG 239

 Score = 35.8 bits (81), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 34/171 (19%), Positives = 71/171 (41%), Gaps = 18/171 (10%)

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW-SNDG 119
           ++S  W P   L+ +GS D+ +  W     +        ++ + G ++ +    +    G
Sbjct: 210 VKSCDWHPKMGLIVSGSKDNLIKFWDPRSGS-------CVSTMLGFKHTIISTKFQPKQG 262

Query: 120 YYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-SEALLASSSYDDTVR 178
             L+  S+DK+  +++  +  +  E  SV  +   D   + WHP  E +     YD +++
Sbjct: 263 NLLSVISKDKTCKVYDIRQQAK--ELFSVRDD--VDYMTLQWHPIDETVFTVGCYDGSIK 318

Query: 179 ---IWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
              + ++   +     +   HE  V S  +     +  + S S D T+R W
Sbjct: 319 HFDLSQENQPNKPTHNIPYAHEKCVTSLAYSPIGHI--MASASKDRTIRFW 367

 Score = 32.0 bits (71), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 22/37 (59%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESAD 92
           AH+K + S+A+ P   ++A+ S D T+  W +  + D
Sbjct: 338 AHEKCVTSLAYSPIGHIMASASKDRTIRFWTRSRAVD 374

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 105/257 (40%), Gaps = 47/257 (18%)

Query: 1   MASINLIKSLKLYKEKIWSFDFSQG--ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHK 58
           +AS  L+ + + +   IWS D +     L TGS D+     S K+ DF +++ L      
Sbjct: 451 LASSTLLSTTEAHTAAIWSLDLTSNGKRLVTGSADK-----SCKFWDFEVVEQLVPGTKD 505

Query: 59  KAIRSVAWRPHTSLLAAGSFDSTVSIWA-KEESADRTFEMDLL---------------AI 102
           K I      P   L+   + + T  I A K  S DR   + LL                 
Sbjct: 506 KYI------PQLKLVHDTTLELTDDILAVKISSEDRYLAVSLLDNTVKVFFFDSLKFYLS 559

Query: 103 IEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWH 162
           + GH+  V  + +S D   L T S DK++ IW  D      +C   +  H   +  V + 
Sbjct: 560 LYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFG----DCHKSIFAHQDSIMSVRFE 615

Query: 163 PSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWS---SDFDKTEGVFRLCSGSD 219
                  S   D  V+ W    D ++C+  LNGH+  VW    S   +T     + S S 
Sbjct: 616 ADTHNFFSCGKDGAVKRWD--GDKFDCIQKLNGHQSEVWCIAVSPDGRT-----VVSTSH 668

Query: 220 DSTVRVWKYMGDDEDDQ 236
           D ++RVW+    + DDQ
Sbjct: 669 DHSIRVWQ----ETDDQ 681

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 82/211 (38%), Gaps = 22/211 (10%)

Query: 23  SQGILATGSTDR------KIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAG 76
           + G L TG+ +       K   V V  D   +  V    +    + ++ +   T LL  G
Sbjct: 32  TSGKLITGALENIQIWTLKTNEVEVLTDGLPIGAVETNISKPSVVTAMCFHKETELLCVG 91

Query: 77  SFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWET 136
             D  + +W             +L    GH++ V  +   ++G  L + S+D  + IW  
Sbjct: 92  YEDGVIKVWD-------LLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIW-- 142

Query: 137 DESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGH 196
           D  GE    +  L+ H   +  +    +   L S + D  +++W D     +CV     H
Sbjct: 143 DLVGE--VGLMKLRSHKDAITGIWIDHNMDWLISVAKDGLIKVW-DLKAGGQCVETHMAH 199

Query: 197 EGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
            G  WS   D+      + + S DS  ++W+
Sbjct: 200 TGQCWSMAIDEE----VIITTSMDSQAKIWE 226

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 10/79 (12%)

Query: 156 VKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVL---NGHEGTVWSSDFDKTEGVF 212
           V  + +H    LL     D  +++W     D    +VL   NGH+  V     D +EG  
Sbjct: 76  VTAMCFHKETELLCVGYEDGVIKVW-----DLLSKSVLMQFNGHKSGVTVLRLD-SEGT- 128

Query: 213 RLCSGSDDSTVRVWKYMGD 231
           RL SGS DS + +W  +G+
Sbjct: 129 RLVSGSKDSDLIIWDLVGE 147

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 105/253 (41%), Gaps = 32/253 (12%)

Query: 73  LAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVW 132
            A GS D+T+ IW   + A    ++ L+    GH   V+ +A S    Y+ + S DK V 
Sbjct: 138 FATGSNDTTIKIW---DLAAGKLKITLI----GHVMSVRDIAISKRHPYMFSASEDKLVK 190

Query: 133 IWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAV 192
            W+     E    I     H   V  V  HPS  ++A++  D  VR+W D     E + V
Sbjct: 191 CWDL----ERNTAIRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVRLW-DIRSRSE-IMV 244

Query: 193 LNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQ 252
           L GH+  +        +     CSG  D+TVR+W  +      +   V      ++    
Sbjct: 245 LPGHKSPINKVKCLPVDPQIISCSG--DATVRLWDIIA----GKASKVLTHHSRNIRDLT 298

Query: 253 VYNVAWGFNGLIASVGADGVLAVYEEVDGEWKVFAKRALCH-GVYEINVVKWLELNGKTI 311
           ++   + F    ASV  + V +        WK+   + L +       ++  + +N   +
Sbjct: 299 LHPAEFSF----ASVSTNDVRS--------WKLPEGQLLTNFQSQNTGILNTVSINHDNV 346

Query: 312 LATGGDDGIVNFW 324
           L  GGDDG + F+
Sbjct: 347 LLAGGDDGTLCFY 359

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 59/131 (45%), Gaps = 12/131 (9%)

Query: 51  VLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEV 110
           + D   H   + +V   P   ++A    D+ V +W     ++       + ++ GH++ +
Sbjct: 200 IRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVRLWDIRSRSE-------IMVLPGHKSPI 252

Query: 111 KGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLAS 170
             V        + +CS D +V +W+        +   VL  HS++++ +  HP+E   AS
Sbjct: 253 NKVKCLPVDPQIISCSGDATVRLWDIIAG----KASKVLTHHSRNIRDLTLHPAEFSFAS 308

Query: 171 SSYDDTVRIWK 181
            S +D VR WK
Sbjct: 309 VSTND-VRSWK 318

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 154 QDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFR 213
           Q V+ V   P + +     Y+ T      +   W+   V+NGH G V     D  +  + 
Sbjct: 79  QLVRRVFQQPHQQISLMERYEKTRSYKPQWHAPWKLSKVINGHTGWVRCVCVDPVDNEW- 137

Query: 214 LCSGSDDSTVRVW 226
             +GS+D+T+++W
Sbjct: 138 FATGSNDTTIKIW 150

>Scas_592.4*
          Length = 318

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 100/231 (43%), Gaps = 37/231 (16%)

Query: 69  HTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRD 128
             +LL +GS D T+  W K    D+ F + + +  +GH + V+    + DG Y  + S D
Sbjct: 29  QPNLLLSGSRDKTLISW-KLTGDDQKFGVPVRSF-KGHSHIVQDCTLTQDGAYALSASWD 86

Query: 129 KSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWE 188
           K++ +W+   +GE Y+       H  DV  V      +++ S S D T+++W       +
Sbjct: 87  KTLRLWDV-ATGETYQ---RFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKG---Q 139

Query: 189 CVAVLNGHE---GTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAIL 245
           C+A L GH      V  +  D+ +    + S  +D  V+ W                   
Sbjct: 140 CLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAW------------------- 180

Query: 246 PDVHKRQVYNVAWGFNGLIASVGA--DGVLAVYEEVDGE---WKVFAKRAL 291
            ++++ Q+     G NG + +V A  DG L      DGE   W +  K+A+
Sbjct: 181 -NLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAM 230

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 56/131 (42%), Gaps = 17/131 (12%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA- 114
            HK  + SVA     S++ +GS D T+ +W        T +   LA + GH + V  V  
Sbjct: 105 GHKSDVMSVAIDRKASMIISGSRDKTIKVW--------TIKGQCLATLLGHNDWVSQVRI 156

Query: 115 ----WSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLAS 170
                ++D   + +   DK V  W  ++   E + +     H+ +V  V   P   L+AS
Sbjct: 157 APTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVG----HNGNVNAVTASPDGTLIAS 212

Query: 171 SSYDDTVRIWK 181
           +  D  + +W 
Sbjct: 213 AGKDGEIMLWN 223

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 50/231 (21%), Positives = 87/231 (37%), Gaps = 49/231 (21%)

Query: 19  SFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRP------HTSL 72
           + D    ++ +GS D+ IK+ ++K      +       H   +  V   P        ++
Sbjct: 114 AIDRKASMIISGSRDKTIKVWTIKGQCLATL-----LGHNDWVSQVRIAPTDQNDDAVTV 168

Query: 73  LAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVW 132
           ++AG+ D  V  W   +     F+++  A   GH   V  V  S DG  +A+  +D  + 
Sbjct: 169 ISAGN-DKMVKAWNLNQ-----FQIE--ADFVGHNGNVNAVTASPDGTLIASAGKDGEIM 220

Query: 133 IWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSS--------------YDDTVR 178
           +W   E    Y           +V  + + P+   LA+++               DD   
Sbjct: 221 LWNLAEKKAMYTL-----SAQDEVFSLAFSPNRYWLAAATASGIKIFCLDPQSLIDDLRP 275

Query: 179 IWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYM 229
            +  Y+   E  AV        WS+D         L +G  DS +RVW+ M
Sbjct: 276 EFAGYNKSAEPHAV-----SLAWSADGQT------LFAGYTDSVIRVWQVM 315

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 61/117 (52%), Gaps = 8/117 (6%)

Query: 110 VKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLA 169
           ++ V +S DG +LAT + D+ + IW+     E  + + +LQ H QD+  + + PS   L 
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDI----ENRKIVMILQGHEQDIYSLDYFPSGDKLV 501

Query: 170 SSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           S S D TVRIW       +C   L+  +G V +      +G + + +GS D  VRVW
Sbjct: 502 SGSGDRTVRIWDLR--TGQCSLTLSIEDG-VTTVAVSPGDGKY-IAAGSLDRAVRVW 554

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 80/175 (45%), Gaps = 26/175 (14%)

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120
           IRSV + P    LA G+ D  + IW  E          ++ I++GHE ++  + +   G 
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRK-------IVMILQGHEQDIYSLDYFPSGD 498

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA-LLASSSYDDTVRI 179
            L + S D++V IW+   +G+    +S+       V  V   P +   +A+ S D  VR+
Sbjct: 499 KLVSGSGDRTVRIWDL-RTGQCSLTLSI----EDGVTTVAVSPGDGKYIAAGSLDRAVRV 553

Query: 180 W--------KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           W        +  D + E      GH+ +V+S  F  T     + SGS D +V++W
Sbjct: 554 WDSETGFLVERLDSENESGT---GHKDSVYSVVF--TRDGQSVVSGSLDRSVKLW 603

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 102/245 (41%), Gaps = 36/245 (14%)

Query: 6   LIKSLKLYKEKIWSFDF--SQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRS 63
           ++  L+ +++ I+S D+  S   L +GS DR +++  ++    +L   +++      + +
Sbjct: 477 IVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIED-----GVTT 531

Query: 64  VAWRP-HTSLLAAGSFDSTVSIWAKE-----ESADRTFEMDLLAIIEGHENEVKGVAWSN 117
           VA  P     +AAGS D  V +W  E     E  D   E        GH++ V  V ++ 
Sbjct: 532 VAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGT-----GHKDSVYSVVFTR 586

Query: 118 DGYYLATCSRDKSVWIWETDESGEEYE--------CISVLQEHSQDVKHVIWHPSEALLA 169
           DG  + + S D+SV +W    +  + +        C      H   V  V    ++  + 
Sbjct: 587 DGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYIL 646

Query: 170 SSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWS------SDFDKTEGVFRLCSGSDDSTV 223
           S S D  V  W     +   + +L GH  +V S      S       VF   +GS D   
Sbjct: 647 SGSKDRGVLFWDKKSGN--PLLMLQGHRNSVISVAVANGSPLGPEYNVF--ATGSGDCKA 702

Query: 224 RVWKY 228
           R+WKY
Sbjct: 703 RIWKY 707

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 92/216 (42%), Gaps = 30/216 (13%)

Query: 26  ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIW 85
            LATG+ DR I++  ++     +I       H++ I S+ + P    L +GS D TV IW
Sbjct: 457 FLATGAEDRLIRIWDIENRKIVMI----LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIW 512

Query: 86  AKEESADRTFEMDLLAIIEGHENEVKGVAWS-NDGYYLATCSRDKSVWIWETDESGEEYE 144
                  RT +  L   I   E+ V  VA S  DG Y+A  S D++V +W++ E+G   E
Sbjct: 513 DL-----RTGQCSLTLSI---EDGVTTVAVSPGDGKYIAAGSLDRAVRVWDS-ETGFLVE 563

Query: 145 CISVLQE----HSQDVKHVIWHPSEALLASSSYDDTVRIWK----------DYDDDWECV 190
            +    E    H   V  V++      + S S D +V++W              +   C 
Sbjct: 564 RLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCE 623

Query: 191 AVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
               GH+  V S     T+    + SGS D  V  W
Sbjct: 624 VTYIGHKDFVLS--VATTQNDEYILSGSKDRGVLFW 657

>Scas_721.115*
          Length = 318

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 99/227 (43%), Gaps = 29/227 (12%)

Query: 69  HTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRD 128
             +LL +GS D T+  W K    D+ F + + +  +GH + V+    + DG Y  + S D
Sbjct: 29  QPNLLLSGSRDKTLISW-KLTGDDQKFGVPVRSF-KGHSHIVQDCTLTQDGAYALSASWD 86

Query: 129 KSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWE 188
           K++ +W+   +GE Y+       H  DV  V      +++ S S D T+++W       +
Sbjct: 87  KTLRLWDV-ATGETYQ---RFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKG---Q 139

Query: 189 CVAVLNGHE---GTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAIL 245
           C+A L GH      V  +  D+ +    + S  +D  V+ W           ++  EA  
Sbjct: 140 CLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNL--------NQFQIEADF 191

Query: 246 PDVHKRQVYNVAWGFNG-LIASVGADGVLAVYEEVDGEWKVFAKRAL 291
              H   V  V    +G LIAS G DG + +       W +  K+A+
Sbjct: 192 VG-HNGNVNTVTASPDGTLIASAGKDGEIML-------WNLAEKKAM 230

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 56/131 (42%), Gaps = 17/131 (12%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA- 114
            HK  + SVA     S++ +GS D T+ +W        T +   LA + GH + V  V  
Sbjct: 105 GHKSDVMSVAIDRKASMIISGSRDKTIKVW--------TIKGQCLATLLGHNDWVSQVRI 156

Query: 115 ----WSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLAS 170
                ++D   + +   DK V  W  ++   E + +     H+ +V  V   P   L+AS
Sbjct: 157 APTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVG----HNGNVNTVTASPDGTLIAS 212

Query: 171 SSYDDTVRIWK 181
           +  D  + +W 
Sbjct: 213 AGKDGEIMLWN 223

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 50/231 (21%), Positives = 87/231 (37%), Gaps = 49/231 (21%)

Query: 19  SFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRP------HTSL 72
           + D    ++ +GS D+ IK+ ++K      +       H   +  V   P        ++
Sbjct: 114 AIDRKASMIISGSRDKTIKVWTIKGQCLATL-----LGHNDWVSQVRIAPTDQNDDSVTV 168

Query: 73  LAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVW 132
           ++AG+ D  V  W   +     F+++  A   GH   V  V  S DG  +A+  +D  + 
Sbjct: 169 ISAGN-DKMVKAWNLNQ-----FQIE--ADFVGHNGNVNTVTASPDGTLIASAGKDGEIM 220

Query: 133 IWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSS--------------YDDTVR 178
           +W   E    Y           +V  + + P+   LA+++               DD   
Sbjct: 221 LWNLAEKKAMYTL-----SAQDEVFALAFSPNRYWLAAATASGIKIFCLDPQSLVDDLRP 275

Query: 179 IWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYM 229
            +  Y+   E  AV        WS+D         L +G  DS +RVW+ M
Sbjct: 276 EFAGYNKSAEPHAV-----SLAWSADGQT------LFAGYTDSVIRVWQVM 315

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 94/213 (44%), Gaps = 38/213 (17%)

Query: 17  IWSFDFS-QGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSL--L 73
           +W+  ++  GIL +GSTDR +++ ++     T +       H   +R +    H  +  +
Sbjct: 412 VWALKYAGNGILVSGSTDRSVRIWNIHLGKCTHV----FKGHTSTVRCLDIVEHEGVKYI 467

Query: 74  AAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWI 133
             GS D+T+ IW   + +D   +       EG  N      +SN+G              
Sbjct: 468 VTGSRDNTLHIWKLPQMSDSNID-------EGMPN-----VYSNNGPLF----------- 504

Query: 134 WETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVL 193
           + + E    +  + VL+ H   V+ V  H    ++ S SYD+ + +W       +C+ +L
Sbjct: 505 FHSPEENPYF--VGVLRGHIASVRTVSGH--GRIVISGSYDNNLIVWDII--QMKCLYIL 558

Query: 194 NGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            GH   ++S+ +D      R  S S DST+++W
Sbjct: 559 MGHTDRIYSTIYDYKRN--RCISASMDSTIKIW 589

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 38/74 (51%), Gaps = 4/74 (5%)

Query: 165 EALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVR 224
             +L S S D +VRIW  +    +C  V  GH  TV   D  + EGV  + +GS D+T+ 
Sbjct: 420 NGILVSGSTDRSVRIWNIHL--GKCTHVFKGHTSTVRCLDIVEHEGVKYIVTGSRDNTLH 477

Query: 225 VWKY--MGDDEDDQ 236
           +WK   M D   D+
Sbjct: 478 IWKLPQMSDSNIDE 491

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/145 (21%), Positives = 60/145 (41%), Gaps = 27/145 (18%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
            H  ++R+V+   H  ++ +GS+D+ + +W          +M  L I+ GH + +    +
Sbjct: 520 GHIASVRTVSG--HGRIVISGSYDNNLIVW-------DIIQMKCLYILMGHTDRIYSTIY 570

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISV----------------LQEHSQDVKHV 159
                   + S D ++ IW+        EC++V                LQ H+  V   
Sbjct: 571 DYKRNRCISASMDSTIKIWDLQNIWNNGECVNVTNATVPCTKITGPMMTLQGHTALVG-- 628

Query: 160 IWHPSEALLASSSYDDTVRIWKDYD 184
           +   S+  L S++ D ++R W   D
Sbjct: 629 LLKLSDKFLVSAAADGSLRGWDSSD 653

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 108/252 (42%), Gaps = 34/252 (13%)

Query: 75  AGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIW 134
            GS D+T+ +W       +T        + GH   V+ VA S+   YL + S DK+V  W
Sbjct: 157 TGSNDTTMKVWDLATGKLKT-------TLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCW 209

Query: 135 ETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLN 194
           +     E+ + I     H   V+ V  HP+  L+A++  D  +++W D       + ++ 
Sbjct: 210 DL----EKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLW-DMRTRIPVITLV- 263

Query: 195 GHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVY 254
           GH+G +  +    T    ++ S S D+TVR+W  +              +L   HKR V 
Sbjct: 264 GHKGPI--NQVQCTPVDPQVVSSSTDATVRLWDVVAGK--------TMKVLTH-HKRSVR 312

Query: 255 NVAWGFNGL-IASVGADGVLAVYEEVDGEWKVFAKRALCHGVYE-INVVKWLELNGKTIL 312
             A       +AS   D + +        W +     L +   E   ++  L +N   +L
Sbjct: 313 ATALHPKEFSVASACTDDIRS--------WGLAEGSLLTNFESEKTGIINTLSINQDDVL 364

Query: 313 ATGGDDGIVNFW 324
             GGD+G+++F+
Sbjct: 365 FAGGDNGVLSFY 376

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 89/216 (41%), Gaps = 40/216 (18%)

Query: 26  ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIW 85
           ++AT   D  IKL    +D  T I V+    HK  I  V   P    + + S D+TV +W
Sbjct: 238 LIATAGRDSVIKL----WDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLW 293

Query: 86  AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLAT-CSRDKSVWIWE-----TDES 139
             +  A +T     + ++  H+  V+  A     + +A+ C+ D   W        T+  
Sbjct: 294 --DVVAGKT-----MKVLTHHKRSVRATALHPKEFSVASACTDDIRSWGLAEGSLLTNFE 346

Query: 140 GEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDD--------DWECVA 191
            E+   I+ L  +  DV          L A    D+ V  + DY            E V 
Sbjct: 347 SEKTGIINTLSINQDDV----------LFAGG--DNGVLSFYDYKSGHKYQSLATREMVG 394

Query: 192 VLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
            L G E +V  S FDKT    RL +G  D ++++WK
Sbjct: 395 SLEG-ERSVLCSTFDKTG--LRLITGEADKSIKIWK 427

>Kwal_23.5769
          Length = 627

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 71/155 (45%), Gaps = 20/155 (12%)

Query: 72  LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSV 131
           LL  GS+DSTV+IW             L+  + GH + VK + +  DG  L T S D+ +
Sbjct: 329 LLFTGSYDSTVAIWDLATGK-------LVRRLTGHRDGVKAIYF--DGQKLITGSLDRMI 379

Query: 132 WIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVA 191
            +W          C++    HS  V  V  +  + ++ S S D TV++W  + +   C  
Sbjct: 380 RVWNYVTGA----CVAAYPGHSDSVLSVDSY--KKIIVSGSADKTVKVW--HVESRTCY- 430

Query: 192 VLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            L GH  T W          F   SGSDD+T+R+W
Sbjct: 431 TLRGH--TEWVGTVKLHPKSFTCFSGSDDTTIRMW 463

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 101/265 (38%), Gaps = 63/265 (23%)

Query: 1   MASINLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKA 60
           +A+  L++ L  +++ + +  F    L TGS DR I++    ++  T   V     H  +
Sbjct: 344 LATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRV----WNYVTGACVAAYPGHSDS 399

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120
           + SV    +  ++ +GS D TV +W  E     T        + GH   V  V      +
Sbjct: 400 VLSVD--SYKKIIVSGSADKTVKVWHVESRTCYT--------LRGHTEWVGTVKLHPKSF 449

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIW------------------- 161
              + S D ++ +W+   +     C+ V + H   V+ V+                    
Sbjct: 450 TCFSGSDDTTIRMWDIRSN----TCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPR 505

Query: 162 --------------------HPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVW 201
                                P  + L S S D+T+++W+      +CV    GH   +W
Sbjct: 506 NEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTG--KCVRTHFGHVEGIW 563

Query: 202 SSDFDKTEGVFRLCSGSDDSTVRVW 226
               D     FR+ SG+ D TV+VW
Sbjct: 564 DIAADN----FRIVSGAHDKTVKVW 584

 Score = 33.5 bits (75), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 167 LLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           LL + SYD TV IW       + V  L GH   V +  FD      +L +GS D  +RVW
Sbjct: 329 LLFTGSYDSTVAIWDLATG--KLVRRLTGHRDGVKAIYFDGQ----KLITGSLDRMIRVW 382

Query: 227 KYM 229
            Y+
Sbjct: 383 NYV 385

>KLLA0C16643g complement(1457590..1458498) highly similar to
           sp|Q04491 Saccharomyces cerevisiae YLR208w SEC13 protein
           transport protein, start by similarity
          Length = 302

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 54/109 (49%), Gaps = 4/109 (3%)

Query: 119 GYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIW-HPS-EALLASSSYDDT 176
           G  LATCS D +V I+E +  GE ++ +  LQ H   V  V W HP    +LAS SYD  
Sbjct: 21  GKRLATCSSDHTVKIFEVE--GETHKLVDTLQGHEGPVWQVDWAHPKFGVILASCSYDGK 78

Query: 177 VRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRV 225
           V IWK+ +  W  +A    H  +V S  +   E    L + S D  V V
Sbjct: 79  VLIWKEVNGRWSQIAAHEVHSASVNSIQWAPHEYGPLLLAASSDGKVSV 127

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 103/250 (41%), Gaps = 35/250 (14%)

Query: 6   LIKSLKLYKEKIWSFDFSQG----ILATGSTDRKI---KLVSVKYDDFTLIDVLDETAHK 58
           L+ +L+ ++  +W  D++      ILA+ S D K+   K V+ ++      +V     H 
Sbjct: 45  LVDTLQGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWKEVNGRWSQIAAHEV-----HS 99

Query: 59  KAIRSVAWRPHT--SLLAAGSFDSTVSIWA-KEESADRTFEMDLLAI-----------IE 104
            ++ S+ W PH    LL A S D  VS+   KE        +D  +I           ++
Sbjct: 100 ASVNSIQWAPHEYGPLLLAASSDGKVSVVEFKENGTTSPIIIDAHSIGANTACWAPATLQ 159

Query: 105 GHENE-VKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP 163
              N+   G A         T   D  V IW+ +     Y     L+ HS  V+ V W P
Sbjct: 160 QQSNQGTSGSASPQQVRRFVTGGADNLVKIWKYNSDAATYLLEHTLEGHSDWVRDVAWSP 219

Query: 164 ---SEALLASSSYDDTVRIWKD--YDDDWECVAVL-NGHEGTVWSSDFDKTEGVFRLCSG 217
              S + LAS S D T  IW     +D W+   +  +     +W + +  +  +  L  G
Sbjct: 220 TVLSRSYLASVSQDRTCIIWTQDSKEDTWKKTLLKEDKFPDVLWRASWSLSGNILALSCG 279

Query: 218 SDDSTVRVWK 227
             D+TV +WK
Sbjct: 280 --DNTVTLWK 287

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 81/186 (43%), Gaps = 28/186 (15%)

Query: 26  ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHT--------------- 70
           +L   S+D K+ +V  K +  T   ++D  AH     +  W P T               
Sbjct: 115 LLLAASSDGKVSVVEFKENGTTSPIIID--AHSIGANTACWAPATLQQQSNQGTSGSASP 172

Query: 71  ---SLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSN---DGYYLAT 124
                   G  D+ V IW K  S   T+ ++    +EGH + V+ VAWS       YLA+
Sbjct: 173 QQVRRFVTGGADNLVKIW-KYNSDAATYLLE--HTLEGHSDWVRDVAWSPTVLSRSYLAS 229

Query: 125 CSRDKSVWIWETDESGEEYECISVLQEHSQDVK-HVIWHPSEALLASSSYDDTVRIWK-D 182
            S+D++  IW  D   + ++   + ++   DV     W  S  +LA S  D+TV +WK +
Sbjct: 230 VSQDRTCIIWTQDSKEDTWKKTLLKEDKFPDVLWRASWSLSGNILALSCGDNTVTLWKEN 289

Query: 183 YDDDWE 188
            +  WE
Sbjct: 290 LEGKWE 295

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 117/293 (39%), Gaps = 42/293 (14%)

Query: 20  FDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAW-RPHTS-LLAAGS 77
            D+    LAT S+D  +K+  V+ +   L+D L    H+  +  V W  P    +LA+ S
Sbjct: 17  LDYYGKRLATCSSDHTVKIFEVEGETHKLVDTLQ--GHEGPVWQVDWAHPKFGVILASCS 74

Query: 78  FDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSND--GYYLATCSRDKSVWIWE 135
           +D  V IW KE +         +A  E H   V  + W+    G  L   S D  V + E
Sbjct: 75  YDGKVLIW-KEVNG----RWSQIAAHEVHSASVNSIQWAPHEYGPLLLAASSDGKVSVVE 129

Query: 136 TDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSS------------------YDDTV 177
             E+G     I  +  HS       W P+     S+                    D+ V
Sbjct: 130 FKENGTTSPII--IDAHSIGANTACWAPATLQQQSNQGTSGSASPQQVRRFVTGGADNLV 187

Query: 178 RIWKDYDDDWECVAVLNGHEG-TVWSSDFDKTEGVFR---LCSGSDDSTVRVWKYMGDDE 233
           +IWK Y+ D     + +  EG + W  D   +  V     L S S D T  +W     ++
Sbjct: 188 KIWK-YNSDAATYLLEHTLEGHSDWVRDVAWSPTVLSRSYLASVSQDRTCIIWTQDSKED 246

Query: 234 DDQQEWVCEAILPDVHKRQVYNVAWGFNG--LIASVGADGVLAVYEEVDGEWK 284
             ++  + E   PDV    ++  +W  +G  L  S G + V    E ++G+W+
Sbjct: 247 TWKKTLLKEDKFPDV----LWRASWSLSGNILALSCGDNTVTLWKENLEGKWE 295

 Score = 35.4 bits (80), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 52/118 (44%), Gaps = 22/118 (18%)

Query: 213 RLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDV---HKRQVYNVAWG---FNGLIAS 266
           RL + S D TV++++  G+             L D    H+  V+ V W    F  ++AS
Sbjct: 23  RLATCSSDHTVKIFEVEGETHK----------LVDTLQGHEGPVWQVDWAHPKFGVILAS 72

Query: 267 VGADGVLAVYEEVDGEWKVFAKRALCHGVY--EINVVKWLELNGKTILATGGDDGIVN 322
              DG + +++EV+G W   A     H V+   +N ++W       +L     DG V+
Sbjct: 73  CSYDGKVLIWKEVNGRWSQIA----AHEVHSASVNSIQWAPHEYGPLLLAASSDGKVS 126

>Kwal_56.24163
          Length = 729

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 63/124 (50%), Gaps = 21/124 (16%)

Query: 64  VAWRPH-TSLLAAGSFDSTVSIWA-KEESADRTFEMDLLAIIEGHENEVKGVAWSN---- 117
           VA+ P   S  A+   D TV IW+  + +A+ T +           +E +GV + +    
Sbjct: 3   VAFNPKDPSTFASACLDHTVKIWSLGQPTANFTLQA----------HETRGVNYVDYYPL 52

Query: 118 -DGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDT 176
            D  YL T S D++V IW+     +   C++ L+ H  +V + ++HPS  ++ S S D T
Sbjct: 53  QDKPYLITSSDDRTVKIWDY----QTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGT 108

Query: 177 VRIW 180
           +++W
Sbjct: 109 LKVW 112

 Score = 31.6 bits (70), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 68/169 (40%), Gaps = 19/169 (11%)

Query: 159 VIWHPSE-ALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGT-VWSSDFDKTEGVFRLCS 216
           V ++P + +  AS+  D TV+IW            L  HE   V   D+   +    L +
Sbjct: 3   VAFNPKDPSTFASACLDHTVKIWSL--GQPTANFTLQAHETRGVNYVDYYPLQDKPYLIT 60

Query: 217 GSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVY 276
            SDD TV++W Y        Q   C A L        Y V      +I S   DG L V+
Sbjct: 61  SSDDRTVKIWDY--------QTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVW 112

Query: 277 E----EVDGEWKVFAKRALC---HGVYEINVVKWLELNGKTILATGGDD 318
                +++    +  +R+ C   H   + N +     NG T+L+ G D+
Sbjct: 113 NSNTYKLEKTLNLGLERSWCIATHPTGKRNYIASGFDNGFTVLSLGNDE 161

>Kwal_14.1611
          Length = 334

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 104/247 (42%), Gaps = 25/247 (10%)

Query: 99  LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKH 158
           +   I GHE+ V  +++   G ++ATCS D+ + ++       E++     + H   V  
Sbjct: 1   MKPFITGHEDLVHDISYDFYGRHVATCSSDQHIKVFRLVRETNEWQLSDSWKAHDSSVVG 60

Query: 159 VIWHPSE--ALLASSSYDDTVRIWKDYDDDWEC-------VAVLNGHEGTVWSSDFDKTE 209
           + W   E   ++AS SYD  V +W++  D  EC       +  LN   G ++S  F    
Sbjct: 61  LDWASPEYGRIIASVSYDKQVNLWEEEPDAAECSGRRWTKLCTLNDATGPLFSVKFAPGH 120

Query: 210 GVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEA---ILPDV---HKRQVYNVAWGFNGL 263
              +L +  +D  +R+++ M  +  D + W   +   +LP     H +  + + W  +  
Sbjct: 121 LGLKLGAIGNDGILRIYEAM--EPSDLRSWTLTSEVKVLPSPPASHLQSDFCLTWCPSRF 178

Query: 264 ----IASVGADGVLAVYEEVDGEWKVFAKRALCHGVYEINVVKWLELNGK--TILATGGD 317
               +     D  L   ++  G+  V AK     G+  I  V W    G+   ++AT   
Sbjct: 179 SPEKLIVCALDQALIYQKDKAGKLYVAAKLEGHAGL--IRSVSWAPSVGRWYQLIATACK 236

Query: 318 DGIVNFW 324
           DG V  +
Sbjct: 237 DGKVRIF 243

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 122/309 (39%), Gaps = 58/309 (18%)

Query: 19  SFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDE-------TAHKKAIRSVAW--RPH 69
           S+DF    +AT S+D+ IK+       F L+   +E        AH  ++  + W    +
Sbjct: 16  SYDFYGRHVATCSSDQHIKV-------FRLVRETNEWQLSDSWKAHDSSVVGLDWASPEY 68

Query: 70  TSLLAAGSFDSTVSIW-----AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLAT 124
             ++A+ S+D  V++W     A E S  R  ++  L    G    VK  A  + G  L  
Sbjct: 69  GRIIASVSYDKQVNLWEEEPDAAECSGRRWTKLCTLNDATGPLFSVK-FAPGHLGLKLGA 127

Query: 125 CSRDKSVWIWETDE---------SGEEYECISVLQEHSQDVKHVIWHPSE---ALLASSS 172
              D  + I+E  E         + E     S    H Q    + W PS      L   +
Sbjct: 128 IGNDGILRIYEAMEPSDLRSWTLTSEVKVLPSPPASHLQSDFCLTWCPSRFSPEKLIVCA 187

Query: 173 YDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFR--LCSGSDDSTVRVWKYMG 230
            D  +   KD        A L GH G + S  +  + G +   + +   D  VR++K M 
Sbjct: 188 LDQALIYQKDKAGKLYVAAKLEGHAGLIRSVSWAPSVGRWYQLIATACKDGKVRIFKLME 247

Query: 231 DDEDDQQEWVCEAI----------LP-----------DVHKRQVYNVAWGFNG-LIASVG 268
             +DDQ     + +          +P           D H+ +V++V+W   G +++S G
Sbjct: 248 TAQDDQDAMSVDQVEEESENGSESIPSSLKVELVSESDDHRGEVWSVSWNLTGTILSSAG 307

Query: 269 ADGVLAVYE 277
            DG + +++
Sbjct: 308 DDGKVRLWK 316

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 62/137 (45%), Gaps = 31/137 (22%)

Query: 92  DRTFEMDLLAIIEGHENEVKGVAWSND----GYYLATCSRDKSVWIWETDESGEE----- 142
           D+  ++ + A +EGH   ++ V+W+         +AT  +D  V I++  E+ ++     
Sbjct: 197 DKAGKLYVAAKLEGHAGLIRSVSWAPSVGRWYQLIATACKDGKVRIFKLMETAQDDQDAM 256

Query: 143 ---------------------YECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWK 181
                                 E +S   +H  +V  V W+ +  +L+S+  D  VR+WK
Sbjct: 257 SVDQVEEESENGSESIPSSLKVELVSESDDHRGEVWSVSWNLTGTILSSAGDDGKVRLWK 316

Query: 182 -DYDDDWECVAVLNGHE 197
             Y  +++C++V++  +
Sbjct: 317 ASYSSEFKCMSVISAQQ 333

 Score = 35.8 bits (81), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 52/126 (41%), Gaps = 28/126 (22%)

Query: 56  AHKKAIRSVAWRPHT----SLLAAGSFDSTVSIWAKEESAD------------------- 92
            H   IRSV+W P       L+A    D  V I+   E+A                    
Sbjct: 210 GHAGLIRSVSWAPSVGRWYQLIATACKDGKVRIFKLMETAQDDQDAMSVDQVEEESENGS 269

Query: 93  ----RTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISV 148
                + +++L++  + H  EV  V+W+  G  L++   D  V +W+   S  E++C+SV
Sbjct: 270 ESIPSSLKVELVSESDDHRGEVWSVSWNLTGTILSSAGDDGKVRLWKASYSS-EFKCMSV 328

Query: 149 LQEHSQ 154
           +    +
Sbjct: 329 ISAQQK 334

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 97/225 (43%), Gaps = 36/225 (16%)

Query: 20  FDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFD 79
             F    + TG+ D+KI +   + D F    +L+   H+  + ++ +     +L +GS D
Sbjct: 266 LQFENNYIITGADDKKINVYDAENDLF----LLELNGHEGGVWALKFV-DGKILVSGSTD 320

Query: 80  STVSIWAKEESADRTFEMDLLAIIEGHENEVKG--VAWSNDGYYLATCSRDKSVWIW--- 134
            +V IW  E             + +GH + V+   V    D  Y+ T SRD ++ +W   
Sbjct: 321 RSVRIWNIETGK-------CTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVWKLP 373

Query: 135 ---ETDESGEE---YEC-------ISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWK 181
              E D+  +E   Y         + VL+ H   V+ V  H    ++ S SYD  + +W 
Sbjct: 374 PMKELDKGSQEPIFYRTPEENPYFVGVLRGHMSSVRTVSGH--GRIVISGSYDHNLMVWD 431

Query: 182 DYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
                 + + +L GH   V+S+ +D      R  S S D+TV +W
Sbjct: 432 II--SMKLLYILTGHTDRVYSTIYDYKRN--RCISASMDTTVMIW 472

 Score = 35.4 bits (80), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 2/70 (2%)

Query: 167 LLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           +L S S D +VRIW    +  +C  V  GH  TV   +  +      + +GS D+T+ VW
Sbjct: 313 ILVSGSTDRSVRIWNI--ETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVW 370

Query: 227 KYMGDDEDDQ 236
           K     E D+
Sbjct: 371 KLPPMKELDK 380

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 37/83 (44%), Gaps = 9/83 (10%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
            H  ++R+V+   H  ++ +GS+D  + +W           M LL I+ GH + V    +
Sbjct: 403 GHMSSVRTVSG--HGRIVISGSYDHNLMVWD-------IISMKLLYILTGHTDRVYSTIY 453

Query: 116 SNDGYYLATCSRDKSVWIWETDE 138
                   + S D +V IW+ + 
Sbjct: 454 DYKRNRCISASMDTTVMIWDLEN 476

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 73/155 (47%), Gaps = 20/155 (12%)

Query: 72  LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSV 131
           LL  GS+DST+ IW         F   L+  + GH + VK + +  D   L T S DK++
Sbjct: 314 LLFTGSYDSTIGIWD-------LFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTI 364

Query: 132 WIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVA 191
            +W         ECIS  + HS  V  V  +  + ++ S S D TV++W  + +   C  
Sbjct: 365 RVWNYITG----ECISTYRGHSDSVLSVDSY--QKVIVSGSADKTVKVW--HVESRTCYT 416

Query: 192 VLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            L GH  T W +        F   S SDD+T+R+W
Sbjct: 417 -LRGH--TEWVNCVKLHPKSFSCFSCSDDTTIRMW 448

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 95/231 (41%), Gaps = 39/231 (16%)

Query: 7   IKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDD-FTLIDVLDETAHKKAIRSVA 65
           I + + + + + S D  Q ++ +GS D+ +K+  V+    +TL        H + +  V 
Sbjct: 375 ISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTL------RGHTEWVNCVK 428

Query: 66  WRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGV---------AWS 116
             P +    + S D+T+ +W    ++        L +  GH  +V+ +           +
Sbjct: 429 LHPKSFSCFSCSDDTTIRMWDIRTNS-------CLKVFRGHVGQVQKIIPLTIKDVENLA 481

Query: 117 NDGYYLATCSRDKSVWIWETDES-GEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
            D     +  +D        DES     E  +VL E+       I +P+  L  S   D+
Sbjct: 482 TDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDEN-------IPYPTHLL--SCGLDN 532

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           T+++W       +C+    GH   VW    D     FR+ SGS D +++VW
Sbjct: 533 TIKLWDV--KTGKCIRTQFGHVEGVWDIAADN----FRIISGSHDGSIKVW 577

 Score = 35.4 bits (80), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 6/63 (9%)

Query: 167 LLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           LL + SYD T+ IW  +    + +  L+GH   V +  FD      +L +GS D T+RVW
Sbjct: 314 LLFTGSYDSTIGIWDLFTG--KLIRRLSGHSDGVKTLYFDDR----KLITGSLDKTIRVW 367

Query: 227 KYM 229
            Y+
Sbjct: 368 NYI 370

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 92/216 (42%), Gaps = 24/216 (11%)

Query: 16  KIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAA 75
           K W F      L  G+ ++ + ++ + +D  T +++ D+      I  V   P    LA 
Sbjct: 498 KFWDFKVENS-LVPGTKNKFLPVLKLHHD--TTLELTDD------ILCVRVSPDDRYLAI 548

Query: 76  GSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWE 135
              D+TV ++  +        M     + GH+  V  +  S D   + T S DK++ IW 
Sbjct: 549 SLLDNTVKVFFLDS-------MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWG 601

Query: 136 TDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNG 195
            D      +C   L  H   + +V + P      S S D  V+ W    + +EC+  L  
Sbjct: 602 LDFG----DCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWD--GEKFECIQKLYA 655

Query: 196 HEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGD 231
           H+  VW+     T+G F + S S D ++R+W+   D
Sbjct: 656 HQSEVWALAV-ATDGGF-VVSSSHDHSIRIWEETED 689

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 66/167 (39%), Gaps = 20/167 (11%)

Query: 70  TSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDK 129
           T LLA G  D  + +W             +L    GH+  +  + +   G  L + S+D 
Sbjct: 91  TDLLAVGYADGVIKVW-------DLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDS 143

Query: 130 SVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWEC 189
           ++ +W  D  GE    +  L+ H   +    W   E  L S+S D  +++W       +C
Sbjct: 144 NIIVW--DLVGE--VGLYKLRSHKDSITG-FWCQGEDWLISTSKDGMIKLWD--LKTHQC 196

Query: 190 VAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQ 236
           +     H G  W            L +   DS V++WK   D E+D+
Sbjct: 197 IETHIAHTGECWGLAVKDD----LLITTGTDSQVKIWKL--DIENDK 237

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 54/127 (42%), Gaps = 12/127 (9%)

Query: 103 IEGHENEVKGVAWSNDGYYLATCSRDK-SVWIWETDESGEEYECISVLQEHSQDVKHVIW 161
           ++G   +V+ +  S+D   LAT S     +W  +T +    +EC   L           +
Sbjct: 387 LQGQRTDVRSIDISDDNKLLATASNGSLKIWNIKTHKCIRTFECGYALT--------CKF 438

Query: 162 HPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDS 221
            P   L+   + +  ++++ D         + + H+  +WS D   T    RL +GS D 
Sbjct: 439 LPGGLLVILGTRNGELQLF-DLASSSLLDTIEDAHDAAIWSLDL--TSDGKRLVTGSADK 495

Query: 222 TVRVWKY 228
           TV+ W +
Sbjct: 496 TVKFWDF 502

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 76/164 (46%), Gaps = 23/164 (14%)

Query: 26  ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIW 85
           +LA G  D  IK+    +D  +   +L+   HK AI  + +    + L +GS DS + +W
Sbjct: 93  LLAVGYADGVIKV----WDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVW 148

Query: 86  AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYEC 145
                 D   E+ L   +  H++ + G  W     +L + S+D  + +W+     + ++C
Sbjct: 149 ------DLVGEVGLYK-LRSHKDSITGF-WCQGEDWLISTSKDGMIKLWDL----KTHQC 196

Query: 146 ISVLQEHSQDVKHVIWHPS--EALLASSSYDDTVRIWK-DYDDD 186
           I     H+ +     W  +  + LL ++  D  V+IWK D ++D
Sbjct: 197 IETHIAHTGEC----WGLAVKDDLLITTGTDSQVKIWKLDIEND 236

 Score = 33.9 bits (76), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 33/73 (45%), Gaps = 10/73 (13%)

Query: 162 HPSEALLASSSYDDTVRIWKDYDDDWECVAVL---NGHEGTVWSSDFDKTEGVFRLCSGS 218
           H    LLA    D  +++W     D     VL   NGH+  +    FD T    RL SGS
Sbjct: 88  HKDTDLLAVGYADGVIKVW-----DLMSKTVLLNFNGHKAAITLLQFDGTGT--RLISGS 140

Query: 219 DDSTVRVWKYMGD 231
            DS + VW  +G+
Sbjct: 141 KDSNIIVWDLVGE 153

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 69/155 (44%), Gaps = 20/155 (12%)

Query: 72  LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSV 131
           LL  GS+DSTV+IW             L+  + GH + VK + +  D   L T S DK++
Sbjct: 271 LLLTGSYDSTVAIWDLATG-------KLIRRLSGHTDGVKALRF--DDQKLITGSLDKTI 321

Query: 132 WIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVA 191
            +W          C+S  + H   V  V       L+ S S D TV++W  + +   C  
Sbjct: 322 RVWNYVTGA----CVSTYRGHQDSVLSV--DSFRKLIVSGSADKTVKVW--HVESRTCY- 372

Query: 192 VLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            L GH G  W +        F   SGSDD T+R+W
Sbjct: 373 TLRGHTG--WVNCVKLHPKSFTCFSGSDDMTIRMW 405

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 98/264 (37%), Gaps = 63/264 (23%)

Query: 1   MASINLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKA 60
           +A+  LI+ L  + + + +  F    L TGS D+ I++    ++  T   V     H+ +
Sbjct: 286 LATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRV----WNYVTGACVSTYRGHQDS 341

Query: 61  IRSV-AWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDG 119
           + SV ++R    L+ +GS D TV +W  E     T        + GH   V  V      
Sbjct: 342 VLSVDSFR---KLIVSGSADKTVKVWHVESRTCYT--------LRGHTGWVNCVKLHPKS 390

Query: 120 YYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWH----------------- 162
           +   + S D ++ +W+   +     C+ V   H   V+ VI                   
Sbjct: 391 FTCFSGSDDMTIRMWDIRTN----TCVRVFHGHVGQVQKVIPLTLGSDLIEDPKDAVVPP 446

Query: 163 --------------------PSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWS 202
                               P    L S S D+T+++W        C+    GH   VW 
Sbjct: 447 DATAPAHDPSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTG--ACIRTQFGHVEGVWD 504

Query: 203 SDFDKTEGVFRLCSGSDDSTVRVW 226
              D     FR+ SGS D + +VW
Sbjct: 505 IAADN----FRIVSGSHDRSCKVW 524

 Score = 36.2 bits (82), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 6/66 (9%)

Query: 164 SEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTV 223
           +  LL + SYD TV IW       + +  L+GH   V +  FD      +L +GS D T+
Sbjct: 268 TNKLLLTGSYDSTVAIWDLATG--KLIRRLSGHTDGVKALRFDDQ----KLITGSLDKTI 321

Query: 224 RVWKYM 229
           RVW Y+
Sbjct: 322 RVWNYV 327

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 73/171 (42%), Gaps = 14/171 (8%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           AH  A+  + +      L +G  D T+ IW         F M +  +   H   ++ +++
Sbjct: 119 AHDSAVTVMQYSHAGDWLISGDADGTIKIWQPN------FNM-VKVLDRAHTECMRDISF 171

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
           S       TCS D  + IW      +E     VL  H  DVK   WHP   L+ S S D+
Sbjct: 172 SYSDQKFVTCSDDNVLKIWNFSNGQQE----RVLSGHHWDVKSCDWHPKMGLIVSGSKDN 227

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            +++W         V+ + G + TV  + F  T+G   L   S D +++++
Sbjct: 228 LIKLWDPRTG--RNVSTILGLKHTVIKTKFQPTQGNL-LAVVSKDKSIKIY 275

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 83/170 (48%), Gaps = 17/170 (10%)

Query: 58  KKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSN 117
           K  I ++ W P    L   ++    S+W     +   FE    +I++ H++ V  + +S+
Sbjct: 79  KHVIPAITWTPEGRRLVVATYSGEFSLW---NGSSFNFE----SIMQAHDSAVTVMQYSH 131

Query: 118 DGYYLATCSRDKSVWIWETDESGEEYECISVL-QEHSQDVKHVIWHPSEALLASSSYDDT 176
            G +L +   D ++ IW+ +     +  + VL + H++ ++ + +  S+    + S D+ 
Sbjct: 132 AGDWLISGDADGTIKIWQPN-----FNMVKVLDRAHTECMRDISFSYSDQKFVTCSDDNV 186

Query: 177 VRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           ++IW   +   E   VL+GH   V S D+    G+  + SGS D+ +++W
Sbjct: 187 LKIWNFSNGQQE--RVLSGHHWDVKSCDWHPKMGL--IVSGSKDNLIKLW 232

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 71/171 (41%), Gaps = 17/171 (9%)

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120
           ++S  W P   L+ +GS D+ + +W      D     ++  I+      +K       G 
Sbjct: 208 VKSCDWHPKMGLIVSGSKDNLIKLW------DPRTGRNVSTILGLKHTVIKTKFQPTQGN 261

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-SEALLASSSYDDTVRI 179
            LA  S+DKS+ I++  +   E + I        D   + WHP +E + +   Y+  ++ 
Sbjct: 262 LLAVVSKDKSIKIYDMRQHMRELQTI----RDDMDYMSLSWHPINETIFSVGCYNGAIKH 317

Query: 180 WKDYDDDWE----CVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           +    D+      C  +   HE +V S  +     +  L S + D T+R W
Sbjct: 318 FDLLHDNSNSTPACHTIPYAHEKSVTSLAYSPVGHI--LASAAKDRTIRFW 366

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 77/177 (43%), Gaps = 24/177 (13%)

Query: 110 VKGVAWSNDGYYL--ATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEAL 167
           +  + W+ +G  L  AT S + S+W      +G  +   S++Q H   V  + +  +   
Sbjct: 82  IPAITWTPEGRRLVVATYSGEFSLW------NGSSFNFESIMQAHDSAVTVMQYSHAGDW 135

Query: 168 LASSSYDDTVRIWKDYDDDWECVAVLN-GHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           L S   D T++IW+    ++  V VL+  H   +    F  ++  F  C  SDD+ +++W
Sbjct: 136 LISGDADGTIKIWQ---PNFNMVKVLDRAHTECMRDISFSYSDQKFVTC--SDDNVLKIW 190

Query: 227 KYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFN-GLIASVGADGVLAVYEEVDGE 282
            +     + QQE V        H   V +  W    GLI S   D ++ +++   G 
Sbjct: 191 NF----SNGQQERVLSG-----HHWDVKSCDWHPKMGLIVSGSKDNLIKLWDPRTGR 238

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 23/37 (62%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESAD 92
           AH+K++ S+A+ P   +LA+ + D T+  WA+    D
Sbjct: 337 AHEKSVTSLAYSPVGHILASAAKDRTIRFWARSRPVD 373

>Kwal_56.24526
          Length = 1210

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 86/200 (43%), Gaps = 43/200 (21%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H+  +R + + P   L  +   D T+ +W+ +           L  + GH + V+ V + 
Sbjct: 52  HEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLDTK-------KCLFTLNGHLDYVRTVFFH 104

Query: 117 NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDT 176
            +  ++ + S D+++ IW      E    I+ L  H+  V    +HP+E L+ S+S D+T
Sbjct: 105 RELPWIISASDDQTIRIWNWQNRKE----IACLTGHNHFVMCADFHPTEDLVVSASLDET 160

Query: 177 VRIWK--------------DYDDDW------------ECVA--VLNGH-EGTVWSSDFDK 207
           VR+W                 +D              +CV   +L GH  G  W+S F  
Sbjct: 161 VRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHSRGVNWAS-FHP 219

Query: 208 TEGVFRLCSGSDDSTVRVWK 227
           T  +  + SG DD  V++W+
Sbjct: 220 TLPL--IVSGGDDRQVKLWR 237

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 65/140 (46%), Gaps = 14/140 (10%)

Query: 97  MDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVL---QEHS 153
           M +L   E      KG+A+     ++       S+ +W+       Y   ++L   ++H 
Sbjct: 1   MKMLTKFESKSTRAKGLAFHPSRPWVLVALFSSSIQLWD-------YRMGTLLHKFEDHE 53

Query: 154 QDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFR 213
             V+ + +HP++ L  S+  D T+++W    D  +C+  LNGH   V +  F +   +  
Sbjct: 54  GPVRGIDFHPTQPLFVSAGDDYTIKVWS--LDTKKCLFTLNGHLDYVRTVFFHRE--LPW 109

Query: 214 LCSGSDDSTVRVWKYMGDDE 233
           + S SDD T+R+W +    E
Sbjct: 110 IISASDDQTIRIWNWQNRKE 129

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 63/149 (42%), Gaps = 25/149 (16%)

Query: 55  TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIW-----AKEESADRTFEM-DLLA------- 101
           T H   +    + P   L+ + S D TV +W      K  SA  T+ + D +A       
Sbjct: 134 TGHNHFVMCADFHPTEDLVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLD 193

Query: 102 ----------IIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQE 151
                     I+EGH   V   ++      + +   D+ V +W    S + +E +   + 
Sbjct: 194 GGFGDCVVKFILEGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMS-STKAWE-VDTCRG 251

Query: 152 HSQDVKHVIWHPSEALLASSSYDDTVRIW 180
           H+ +V  VI+HP + L+ S   D TVR+W
Sbjct: 252 HTNNVDSVIFHPHQNLIISVGEDKTVRVW 280

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 69/158 (43%), Gaps = 19/158 (12%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H + +   ++ P   L+ +G  D  V +W    S+ + +E+D      GH N V  V + 
Sbjct: 208 HSRGVNWASFHPTLPLIVSGGDDRQVKLW--RMSSTKAWEVD---TCRGHTNNVDSVIFH 262

Query: 117 NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDT 176
                + +   DK+V +W+ D+       +   +  +     V  HP+  L   +++D  
Sbjct: 263 PHQNLIISVGEDKTVRVWDLDKRTP----VKQFKRENDRFWLVRAHPNINLFG-AAHDSG 317

Query: 177 VRIWKDYDDDWECVAVLNGH-------EGTVWSSDFDK 207
           + ++K  D +  C +V+N +       E  V S D++K
Sbjct: 318 IMVFK-LDRERPC-SVINQNQLIFVNKEKQVQSFDYNK 353

>Kwal_26.7570
          Length = 218

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 63/135 (46%), Gaps = 6/135 (4%)

Query: 99  LLAIIEGHENEVKGVAWSN-DGYYLATCSRDKSVWIWETDESGEEYEC-ISVLQEHSQDV 156
           L   +EGH   V  +A S      L + SRDKS+  W+     ++Y   +   + HS  V
Sbjct: 9   LRGTLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIV 68

Query: 157 KHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCS 216
           +     P      S+S+D TVR+W+      +C+    GH+  V S   D+     ++ S
Sbjct: 69  QDCTVTPDGEYALSASWDKTVRLWELATG--KCIQRFVGHKSDVLSVTIDRRAS--QIVS 124

Query: 217 GSDDSTVRVWKYMGD 231
            S D TV+VW  +G+
Sbjct: 125 ASRDKTVKVWNTLGE 139

 Score = 49.7 bits (117), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 65/143 (45%), Gaps = 10/143 (6%)

Query: 56  AHKKAIRSVAWRP-HTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
            H   + S+A  P   +LL +GS D ++  W K    D+ + + + +   GH + V+   
Sbjct: 15  GHNGWVTSLATSPAQPNLLLSGSRDKSLITW-KLTGDDQQYGVPVRSF-RGHSHIVQDCT 72

Query: 115 WSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYD 174
            + DG Y  + S DK+V +WE        +CI     H  DV  V      + + S+S D
Sbjct: 73  VTPDGEYALSASWDKTVRLWELATG----KCIQRFVGHKSDVLSVTIDRRASQIVSASRD 128

Query: 175 DTVRIWKDYDDDWECVAVLNGHE 197
            TV++W       EC+  L GH 
Sbjct: 129 KTVKVWNTLG---ECMVTLLGHN 148

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 64/155 (41%), Gaps = 18/155 (11%)

Query: 26  ILATGSTDRKIKLVSVKYDDFTL-IDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSI 84
           +L +GS D+ +    +  DD    + V     H   ++     P      + S+D TV +
Sbjct: 32  LLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKTVRL 91

Query: 85  WAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYE 144
           W  E +  +  +        GH+++V  V        + + SRDK+V +W T       E
Sbjct: 92  W--ELATGKCIQR-----FVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNT-----LGE 139

Query: 145 CISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRI 179
           C+  L  H+  V  V   P+E     S  D+TV +
Sbjct: 140 CMVTLLGHNDWVSQVRVAPNE-----SPEDETVTV 169

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 74/165 (44%), Gaps = 20/165 (12%)

Query: 64  VAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLA 123
           + + P T+LLAAG  D  + IW             +L    GH++ +  +A+   G  L 
Sbjct: 85  LKYHPETNLLAAGYADGVIKIW-------DLISKTVLISFNGHKSAITVLAFDTTGTRLI 137

Query: 124 TCSRDKSVWIWE-TDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKD 182
           + S+D  + +W+   ESG     +  L+ H +D    +W   E  L S+S D  V+IW D
Sbjct: 138 SASKDSDIIVWDLVGESG-----LYKLRSH-KDAITGLWCEDENWLISTSKDGLVKIW-D 190

Query: 183 YDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
                +CV     H G  WS      E +   CS   DS V++WK
Sbjct: 191 LKSQ-QCVETHLAHTGECWS--LGIIEDMAVTCSA--DSQVKLWK 230

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 85/229 (37%), Gaps = 59/229 (25%)

Query: 54  ETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEES-------ADRTFEM--------- 97
           E AH  AI S+        L  GS D TV  W  E S       +++T  M         
Sbjct: 466 EGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTL 525

Query: 98  ----DLLAII-------------------------------EGHENEVKGVAWSNDGYYL 122
               D+L+++                                GH+  V  +  S D   +
Sbjct: 526 ELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLI 585

Query: 123 ATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKD 182
            TCS DK++ IW  D      +C   L  H   + +V + P      S S D TV+ W  
Sbjct: 586 VTCSADKNIKIWGLDFG----DCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWD- 640

Query: 183 YDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGD 231
               +EC+  L  H+  VWS      +G F + +G D S +RVW+   D
Sbjct: 641 -GQKFECIQKLAAHQSEVWSISVS-NDGTFVISTGHDHS-IRVWEETED 686

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/223 (21%), Positives = 97/223 (43%), Gaps = 26/223 (11%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
            HK  + S+     + L+   S D  + IW  +         D    +  H++ +  V +
Sbjct: 568 GHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFG-------DCHKSLFAHQDSIMNVKF 620

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
             + Y   +CS+D +V  W+    G+++ECI  L  H  +V  +        + S+ +D 
Sbjct: 621 LPESYNFFSCSKDATVKYWD----GQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDH 676

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDD 235
           ++R+W++ +D       L           ++ T  +  L  G+ D  + V K  GD+E+ 
Sbjct: 677 SIRVWEETEDQ----VFLEEEREKEMDEQYEDTL-LTSLEGGAGDEMLSVKK--GDNEES 729

Query: 236 QQEWVCEAILPDVHKRQVYNVAWGFNGLIA-SVGADGVLAVYE 277
           ++       +  VHK+ V ++  G   + A  +G + ++A+ E
Sbjct: 730 EE-------VEGVHKQTVESLKAGERLMEALEIGVNDIIAMEE 765

 Score = 32.0 bits (71), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 69/159 (43%), Gaps = 22/159 (13%)

Query: 25  GILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSI 84
            +LA G  D  IK+    +D  +   ++    HK AI  +A+    + L + S DS + +
Sbjct: 92  NLLAAGYADGVIKI----WDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIV 147

Query: 85  WAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYE 144
           W      D   E  L   +  H++ + G+ W  D  +L + S+D  V IW+     +  +
Sbjct: 148 W------DLVGESGLYK-LRSHKDAITGL-WCEDENWLISTSKDGLVKIWDL----KSQQ 195

Query: 145 CISVLQEHSQDVKHVIWHPS--EALLASSSYDDTVRIWK 181
           C+     H+ +     W     E +  + S D  V++WK
Sbjct: 196 CVETHLAHTGEC----WSLGIIEDMAVTCSADSQVKLWK 230

>Scas_707.22
          Length = 730

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 94/204 (46%), Gaps = 24/204 (11%)

Query: 6   LIKSLKLYKEKIWSFDF-SQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSV 64
            +K L  ++  +W+  + + GI+ +GSTDR +++  +K    T +     T+  + +  V
Sbjct: 388 FLKELSGHEGGVWALKYDADGIIVSGSTDRSVRIWDIKRGCCTHV-FKGHTSTVRCLEIV 446

Query: 65  AWRPHTSLLAAGSFDSTVSIWA--KEESADRTFEMD---------LLAIIEGHENEVKGV 113
            ++ +   +  GS D+T+ +W   KEE  D    M           + ++ GH   V+ +
Sbjct: 447 TYK-NMKYIVTGSRDNTLHVWKLIKEEKFDGELPMVYNTPEENPYFVGVLRGHMASVRTI 505

Query: 114 AWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSY 173
             S  G  + + S D ++ +W+      + +C+ VL  H+  +   I+        S+S 
Sbjct: 506 --SGHGNIVISGSYDNNLMVWDI----AQMKCLYVLIGHTDRIYSTIYDHKRQRCISASM 559

Query: 174 DDTVRIWKDYDDDW---ECVAVLN 194
           D T+++W D D+ W    C  + N
Sbjct: 560 DSTIKVW-DLDNIWNNGNCTIITN 582

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 100/227 (44%), Gaps = 36/227 (15%)

Query: 17  IWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAG 76
           +    F    + TG+ DR++++   +   F    + + + H+  + ++ +     ++ +G
Sbjct: 359 VTCLQFEDDYVITGADDRQLRIYDARSKKF----LKELSGHEGGVWALKYDAD-GIIVSG 413

Query: 77  SFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKG---VAWSNDGYYLATCSRDKSVWI 133
           S D +V IW  +             + +GH + V+    V + N   Y+ T SRD ++ +
Sbjct: 414 STDRSVRIWDIKRGC-------CTHVFKGHTSTVRCLEIVTYKN-MKYIVTGSRDNTLHV 465

Query: 134 WET--------------DESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRI 179
           W+               +   E    + VL+ H   V+ +  H +  ++ S SYD+ + +
Sbjct: 466 WKLIKEEKFDGELPMVYNTPEENPYFVGVLRGHMASVRTISGHGN--IVISGSYDNNLMV 523

Query: 180 WKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           W       +C+ VL GH   ++S+ +D      R  S S DST++VW
Sbjct: 524 WDIAQ--MKCLYVLIGHTDRIYSTIYDHKRQ--RCISASMDSTIKVW 566

 Score = 35.4 bits (80), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 164 SEALLASSSYDDTVRIWKDYDDDWE---CVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDD 220
           ++ ++ S S D +VRIW     D +   C  V  GH  TV   +    + +  + +GS D
Sbjct: 406 ADGIIVSGSTDRSVRIW-----DIKRGCCTHVFKGHTSTVRCLEIVTYKNMKYIVTGSRD 460

Query: 221 STVRVWKYMGDDEDD 235
           +T+ VWK + +++ D
Sbjct: 461 NTLHVWKLIKEEKFD 475

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 61/117 (52%), Gaps = 8/117 (6%)

Query: 110 VKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLA 169
           ++ V +S DG +LAT + DK + IW+      + + + VL+ H QD+  + +  S   L 
Sbjct: 376 IRSVCFSPDGKFLATGAEDKLIRIWDI----AQRKIVMVLRGHEQDIYSLDYFQSGNKLV 431

Query: 170 SSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           S S D T+RIW  +    +C   L+  +G V +       G + + +GS D TVRVW
Sbjct: 432 SGSGDRTIRIWDLH--TGQCSLTLSIEDG-VTTVAVSPGNGNY-VAAGSLDRTVRVW 484

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 66/132 (50%), Gaps = 17/132 (12%)

Query: 106 HENEVKGVAWSNDGYYLAT-CSRDKSVWIWETDESGEEYECISVLQEHSQD--------- 155
           H++ V  V +SN+G YLAT C  +K+  I+E        E +   +  ++D         
Sbjct: 317 HDSVVCCVKFSNNGEYLATGC--NKTTKIFEVATGNLVTELVDDTKTGTEDANSASSADL 374

Query: 156 -VKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRL 214
            ++ V + P    LA+ + D  +RIW       + V VL GHE  ++S D+ ++    +L
Sbjct: 375 YIRSVCFSPDGKFLATGAEDKLIRIWDIA--QRKIVMVLRGHEQDIYSLDYFQSGN--KL 430

Query: 215 CSGSDDSTVRVW 226
            SGS D T+R+W
Sbjct: 431 VSGSGDRTIRIW 442

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 80/175 (45%), Gaps = 26/175 (14%)

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120
           IRSV + P    LA G+ D  + IW   + A R   M    ++ GHE ++  + +   G 
Sbjct: 376 IRSVCFSPDGKFLATGAEDKLIRIW---DIAQRKIVM----VLRGHEQDIYSLDYFQSGN 428

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA-LLASSSYDDTVRI 179
            L + S D+++ IW+   +G+    +S+       V  V   P     +A+ S D TVR+
Sbjct: 429 KLVSGSGDRTIRIWDL-HTGQCSLTLSI----EDGVTTVAVSPGNGNYVAAGSLDRTVRV 483

Query: 180 W--------KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           W        +  D + E      GH+ +V+S  F  T     + SGS D +V++W
Sbjct: 484 WDSNSGFLVERLDSEGETGV---GHKDSVYSVVF--TRDGKNIVSGSLDRSVKLW 533

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 90/217 (41%), Gaps = 31/217 (14%)

Query: 26  ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIW 85
            LATG+ D+ I++  +      ++       H++ I S+ +    + L +GS D T+ IW
Sbjct: 387 FLATGAEDKLIRIWDIAQRKIVMV----LRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIW 442

Query: 86  AKEESADRTFEMDLLAIIEGHENEVKGVAWS-NDGYYLATCSRDKSVWIWETDESGEEYE 144
                   T +  L   I   E+ V  VA S  +G Y+A  S D++V +W+++ SG   E
Sbjct: 443 DL-----HTGQCSLTLSI---EDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSN-SGFLVE 493

Query: 145 CISVLQE----HSQDVKHVIWHPSEALLASSSYDDTVRIW-----------KDYDDDWEC 189
            +    E    H   V  V++      + S S D +V++W                +  C
Sbjct: 494 RLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNC 553

Query: 190 VAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
                GH+  V S     TE    + SGS D  V  W
Sbjct: 554 EMTYIGHKDFVLS--VTTTENDQYILSGSKDRGVIFW 588

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 76/178 (42%), Gaps = 35/178 (19%)

Query: 27  LATGSTDRKIKLVSVKYDDFT--LIDVLDE-----TAHKKAIRSVAWRPHTSLLAAGSFD 79
           +A GS DR +++    +D  +  L++ LD        HK ++ SV +      + +GS D
Sbjct: 472 VAAGSLDRTVRV----WDSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLD 527

Query: 80  STVSIW----------AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDK 129
            +V +W          + +   +   EM  +    GH++ V  V  + +  Y+ + S+D+
Sbjct: 528 RSVKLWNLRNINGASTSPQPKTEGNCEMTYI----GHKDFVLSVTTTENDQYILSGSKDR 583

Query: 130 SVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEAL------LASSSYDDTVRIWK 181
            V  W+   SG     + +LQ H   V  V     + L       A+ S D   +IWK
Sbjct: 584 GVIFWD-KVSGVP---LLMLQGHRNSVISVAVANGKPLGANYNVFATGSGDCKAKIWK 637

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/226 (21%), Positives = 90/226 (39%), Gaps = 18/226 (7%)

Query: 5   NLIKSLKLYKEKIWSFDFSQGI--LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIR 62
           N + S + ++  + S  F Q    + T S D  IK+  V+        +     H   + 
Sbjct: 66  NPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPS-----IPRNYKHNAPVN 120

Query: 63  SVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYL 122
            V   P+   L +   D  + IW   E+           +    +  ++ ++ ++DG  L
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGEN------QCTHQLTPEDDTSLQSLSMASDGSML 174

Query: 123 ATCSRDKSVWIWETDES--GEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
           A  +   + ++WE          + ++  + HS  +  ++       LA+ S D T R+W
Sbjct: 175 AAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVW 234

Query: 181 KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
              DDD++    L+GH+  VW   F        L + S D  VR+W
Sbjct: 235 S-IDDDFKLETTLDGHQRWVWDCAFSADSAY--LVTASSDHYVRLW 277

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 5/88 (5%)

Query: 93  RTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEH 152
           RT   + +A  EGH   V  V++  D  ++ T S D ++ +W+          I    +H
Sbjct: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPS-----IPRNYKH 115

Query: 153 SQDVKHVIWHPSEALLASSSYDDTVRIW 180
           +  V  V+ HP++  L S   D  +RIW
Sbjct: 116 NAPVNEVVIHPNQGELISCDRDGNIRIW 143

 Score = 32.3 bits (72), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 6/80 (7%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           AH   I  +        LA  S D T  +W    S D  F+++    ++GH+  V   A+
Sbjct: 205 AHSTYITRILLSSDVKHLATCSADHTARVW----SIDDDFKLE--TTLDGHQRWVWDCAF 258

Query: 116 SNDGYYLATCSRDKSVWIWE 135
           S D  YL T S D  V +W+
Sbjct: 259 SADSAYLVTASSDHYVRLWD 278

 Score = 28.9 bits (63), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 38/83 (45%), Gaps = 5/83 (6%)

Query: 145 CISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSD 204
           C   +Q     V  +     + LLA++ + + VR++     +   VA   GH G V S  
Sbjct: 24  CSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTTNPNPVASFEGHRGNVTSVS 82

Query: 205 FDKTEGVFR-LCSGSDDSTVRVW 226
           F +     R + + S+D T++VW
Sbjct: 83  FQQDN---RWMVTSSEDGTIKVW 102

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 101/265 (38%), Gaps = 64/265 (24%)

Query: 14  KEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLL 73
           K K  +F  +  +LA G T  + +L  +   DFTLI  L  +  +  + +V+       L
Sbjct: 262 KVKCVTFHPATRLLAVGFTSGEFRLYDLP--DFTLIQQL--SMGQNPVNTVSVNQTGEWL 317

Query: 74  AAGSF---DSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKS 130
           A GS       V  W  E    +          +GH +    +A+S DG  + T S D  
Sbjct: 318 AFGSSKLGQLLVYEWQSESYILKQ---------QGHFDSTNSLAYSPDGSRVVTASEDGK 368

Query: 131 VWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW-----KDYDD 185
           + +W+         C++  +EH+  V  V +     ++ SSS D TVR W     +++  
Sbjct: 369 IKVWDITSGF----CLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRT 424

Query: 186 -------DWECVAV------------------------------LNGHEGTVWSSDFDKT 208
                   + C+AV                              L+GHEG V    F + 
Sbjct: 425 FTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQE 484

Query: 209 EGVFRLCSGSDDSTVRVWKYMGDDE 233
             V  L S S D T+R+W   G  +
Sbjct: 485 NSV--LASASWDKTIRIWSIFGRSQ 507

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 79/189 (41%), Gaps = 16/189 (8%)

Query: 5   NLIKSLKLYKEKIWSFDF--SQGILATGSTDRKIKLVSVKYD------DFTLIDVLDETA 56
           N +    L   K ++F++   + I A     +   L+S+  D      +F   +VL    
Sbjct: 35  NRVSVFDLINNKSFTFEYEHRKNIAAIDLNKQGTLLISIDEDGRAILVNFKARNVLHHFN 94

Query: 57  HKKAIRSVAWRPHTSL--LAAGSFDSTVSIWAKEE-SADRTFEMDLLAIIE-GHENEVKG 112
            K+   +V + P   L  LA+G F   + IW   + + DR F   +   +  GH  ++  
Sbjct: 95  FKEKCSAVKFSPDGRLFALASGRF---LQIWKTPDVNKDRQFAPFVRHRVHAGHFQDITS 151

Query: 113 VAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSS 172
           + WS D  ++ T S+D S  IW  D S E+    +    H   V    +   +  + + S
Sbjct: 152 LTWSQDSRFILTTSKDLSAKIWSVD-SEEKNLAATTFNGHRDYVMGAFFSHDQEKIYTVS 210

Query: 173 YDDTVRIWK 181
            D  V +W+
Sbjct: 211 KDGAVFVWE 219

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 53/118 (44%), Gaps = 12/118 (10%)

Query: 64  VAWRPHTSLLAAGSFDS-TVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYL 122
           +A  P   ++ AGS D+  + +W+ +          LL  + GHE  V  +++S +   L
Sbjct: 436 LAVDPSGEVVCAGSLDNFDIHVWSVQTG-------QLLDALSGHEGPVSCLSFSQENSVL 488

Query: 123 ATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
           A+ S DK++ IW      ++ E I V      DV  +   P    +A S+    + I+
Sbjct: 489 ASASWDKTIRIWSIFGRSQQVEPIEVY----SDVLALSMRPDGKEVAVSTLKGQISIF 542

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 97/228 (42%), Gaps = 36/228 (15%)

Query: 17  IWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAG 76
           +  F F    + TG+ D++I +     + F     L+   H+  + ++ +     +L +G
Sbjct: 370 VTCFQFEGNYIITGADDKRINVYDADREQFK----LELVGHEGGVWALKY-AGDEILVSG 424

Query: 77  SFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDG--YYLATCSRDKSVWIW 134
           S D TV IW  +             +  GH + V+ +     G   Y+ T SRD ++ +W
Sbjct: 425 STDRTVRIWNVKAGK-------CTHVFRGHTSTVRCLDVVEHGGIKYVVTGSRDNTLHVW 477

Query: 135 E-TDESGEEYEC---------------ISVLQEHSQDVKHVIWHPSEALLASSSYDDTVR 178
           +  D +  +Y                 + VL+ H   V+ V  H +  ++ S SYD  + 
Sbjct: 478 KLPDPNSPDYNPNAMRQFNSIEDNPFFVGVLRGHMASVRTVSGHGN--IVVSGSYDHNLM 535

Query: 179 IWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           +W       + + VL GH   ++S+ +D      R  S S D+TV+VW
Sbjct: 536 VWDIA--KMKLLYVLTGHTDRIYSTLYDHKRK--RCISASMDTTVKVW 579

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 64/136 (47%), Gaps = 14/136 (10%)

Query: 103 IEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIW- 161
           ++GH  +V    +  +G Y+ T + DK + +++ D   E+++   V  E        +W 
Sbjct: 362 LDGHRTKVV-TCFQFEGNYIITGADDKRINVYDADR--EQFKLELVGHEGG------VWA 412

Query: 162 --HPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSD 219
             +  + +L S S D TVRIW       +C  V  GH  TV   D  +  G+  + +GS 
Sbjct: 413 LKYAGDEILVSGSTDRTVRIWNV--KAGKCTHVFRGHTSTVRCLDVVEHGGIKYVVTGSR 470

Query: 220 DSTVRVWKYMGDDEDD 235
           D+T+ VWK    +  D
Sbjct: 471 DNTLHVWKLPDPNSPD 486

 Score = 32.3 bits (72), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 17/80 (21%), Positives = 39/80 (48%), Gaps = 9/80 (11%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
            H  ++R+V+   H +++ +GS+D  + +W          +M LL ++ GH + +    +
Sbjct: 510 GHMASVRTVSG--HGNIVVSGSYDHNLMVWD-------IAKMKLLYVLTGHTDRIYSTLY 560

Query: 116 SNDGYYLATCSRDKSVWIWE 135
            +      + S D +V +W+
Sbjct: 561 DHKRKRCISASMDTTVKVWD 580

>Scas_720.83d
          Length = 915

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 100/262 (38%), Gaps = 64/262 (24%)

Query: 14  KEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLL 73
           K K  +F     +L  G T+ + +L  + +  FTL+  L  +  +  I +VA       L
Sbjct: 260 KVKCVTFHAPSNMLVVGFTNGEFRLYELPH--FTLLQQL--SMGQNPINTVAVNSSGEWL 315

Query: 74  AAGSF---DSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKS 130
           A GS       V  W  E    +          +GH +    + +S DG  + T + D  
Sbjct: 316 AFGSSKLGQLLVYEWQSESYILKQ---------QGHFDATNSLTYSPDGSRVVTAAEDGK 366

Query: 131 VWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW-----KDYDD 185
           + +W+   SG    C++  QEH+  V  V +     +L SSS D TVR W     +++  
Sbjct: 367 IKVWDV-VSGF---CLATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRT 422

Query: 186 -------DWECVAV------------------------------LNGHEGTVWSSDFDKT 208
                   + C+AV                              L+GHEG V    F + 
Sbjct: 423 FTAAERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQE 482

Query: 209 EGVFRLCSGSDDSTVRVWKYMG 230
             V  L S S D TVRVW   G
Sbjct: 483 NSV--LASASWDKTVRVWSIFG 502

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 48/109 (44%), Gaps = 12/109 (11%)

Query: 41  VKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDS-TVSIWAKEESADRTFEMDL 99
           ++Y +F         A +     +A  P   ++ AGS D+  + +W+ +          L
Sbjct: 415 IRYRNFRTF----TAAERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTG-------QL 463

Query: 100 LAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISV 148
           L  + GHE  V  +A+S +   LA+ S DK+V +W      ++ E   V
Sbjct: 464 LDTLSGHEGPVSCLAFSQENSVLASASWDKTVRVWSIFGRSQQVEPFDV 512

 Score = 33.1 bits (74), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 76/190 (40%), Gaps = 18/190 (9%)

Query: 5   NLIKSLKLYKEKIWSFDF--SQGILATGSTDRKIKLVSVKYD------DFTLIDVLDETA 56
           N +    L   K ++F++   + I       +   L+SV  D      +F    VL    
Sbjct: 35  NRVSVFDLINNKSFTFEYEHRKNIATIDLNKQGTLLISVDEDGRAILTNFKAKTVLHHFN 94

Query: 57  HKKAIRSVAWRPHTSL--LAAGSFDSTVSIWAKEESA-DRTFEMDL-LAIIEGHENEVKG 112
            K+    V + P   L  LA G F   + IW   ++  DR F   +   +  GH  ++  
Sbjct: 95  FKEKCYQVKFSPDGKLFALATGRF---LQIWKTPDATEDRQFAPFVRYRVHAGHFQDILS 151

Query: 113 VAWSNDGYYLATCSRDKSVWIWETDESGEEYECISV-LQEHSQDVKHVIWHPSEALLASS 171
           + WS D  ++ + S+D +  IW  D   EE +  S+    H   V    +   +  + + 
Sbjct: 152 LTWSLDSRFIISTSKDLTARIWSID--SEEKDLASMTFAGHRDYVMGAFFSADQEKIYTV 209

Query: 172 SYDDTVRIWK 181
           S D  + +W+
Sbjct: 210 SKDGALFVWE 219

>KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomyces
           cerevisiae YPL183c, start by similarity
          Length = 990

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/261 (22%), Positives = 109/261 (41%), Gaps = 23/261 (8%)

Query: 63  SVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYL 122
           S+    H  L+ AG+  + + +W  +           +  + GHE  +  V  SN+G  L
Sbjct: 144 SIKVLRHKVLVNAGTIMNGIIVWELDSKKK-------IHTLRGHEGSIFYVTTSNNGKLL 196

Query: 123 ATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKD 182
           A+CS D+S+ IW+   SG   + +S    H+  + ++ +   +  L S S D T R+W  
Sbjct: 197 ASCSDDRSIIIWDM-VSG---KLLSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWNY 252

Query: 183 YDDDWECVAVLNGH-EGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVC 241
            +D+     +   H    VW  D ++T  +    SG +D  ++V + +  +     E   
Sbjct: 253 KNDELTIKDIFESHLTKNVWGVDVEETNLI--AISGGNDGRLKVTELVPHNRSCNIELSL 310

Query: 242 EAILPD----VHKRQ--VYNVAWGFNGLIASVGADGVLAVYEEVDGEWKV--FAKRALCH 293
           E+I       +HK    V    W   GL+       +L   + ++ EWK   +  R    
Sbjct: 311 ESISEQCDGFIHKANEIVKGFHWFDFGLVLITSEGNILEYLQNIE-EWKFLDYDDRFFSF 369

Query: 294 GVYEINVVKWLELNGKTILAT 314
            + + N      +N K +L +
Sbjct: 370 SITQGNENTIFFMNNKCLLTS 390

>Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement
          Length = 1140

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 76/182 (41%), Gaps = 12/182 (6%)

Query: 64  VAWRPHTSLL--AAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW-SNDGY 120
           V W PH +       + +    +W    ++    E     I+ GH   +  + +  +   
Sbjct: 73  VQWSPHPAKPYWVVSTSNQKAMVWNLSRNSTNAIEH----ILHGHFRAITDINFHPHHPE 128

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
            LATCS D  V  W+       Y   S  +  +  VK   W+   + + +SS+ D V IW
Sbjct: 129 ILATCSVDTYVLAWDMRSPQRPYYSTSEWRAGASQVK---WNFRNSNIMASSHSDHVCIW 185

Query: 181 KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWV 240
            D       +  L GHEG+V + DF+K +    + S S+D TV+ W Y   D   +   V
Sbjct: 186 -DLRKGCTPLYTLQGHEGSVNNIDFNKAKET-EIMSSSNDGTVKFWDYSVSDTKPRHTIV 243

Query: 241 CE 242
            +
Sbjct: 244 TD 245

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 89/200 (44%), Gaps = 43/200 (21%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H+  +R+V + P   +  +   D+++ +W+ E +         L  + GH + V+ V + 
Sbjct: 52  HEGPVRAVDFHPTQPIFVSAGDDASIKVWSLETNR-------CLYTLTGHLDYVRTVFFH 104

Query: 117 NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDT 176
           ++  ++ + S D++V IW      E    ++ L  H+  V    +H +E L+ S+S D+T
Sbjct: 105 SELPWVISASDDQTVRIWNWQNRKE----LACLTGHNHFVMCAQFHQTEDLVVSASLDET 160

Query: 177 VRIW--------------KDYDD--------------DWECVAVLNGH-EGTVWSSDFDK 207
           VR+W                Y+D              D +   +L GH  G  W+S F  
Sbjct: 161 VRVWDISGLRKKHSAPGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTRGVNWAS-FHP 219

Query: 208 TEGVFRLCSGSDDSTVRVWK 227
           T  +  + +G DD  V++W+
Sbjct: 220 TLPL--IVTGGDDRQVKLWR 237

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 59/265 (22%), Positives = 102/265 (38%), Gaps = 66/265 (24%)

Query: 97  MDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQE---HS 153
           M LL   E      KG+A+     +        ++ +W+       Y   ++L     H 
Sbjct: 1   MKLLTKFESKSTRAKGIAFHPSRPWALVALFSSTIQLWD-------YRMGTLLHRFEGHE 53

Query: 154 QDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFR 213
             V+ V +HP++ +  S+  D ++++W    +   C+  L GH         D    VF 
Sbjct: 54  GPVRAVDFHPTQPIFVSAGDDASIKVWSLETN--RCLYTLTGH--------LDYVRTVFF 103

Query: 214 ------LCSGSDDSTVRVWKYMGDDEDDQQEWVCEA------ILPDVHKRQVYNVA---- 257
                 + S SDD TVR+W +      +++E  C        +    H+ +   V+    
Sbjct: 104 HSELPWVISASDDQTVRIWNWQ-----NRKELACLTGHNHFVMCAQFHQTEDLVVSASLD 158

Query: 258 -----WGFNGLIASVGADGVLAVYEEVDGEWKVFAKRALCHGVYEINVVKWLELNGKT-- 310
                W  +GL     A GV + YE+      + +++ L  G +    VK++ L G T  
Sbjct: 159 ETVRVWDISGLRKKHSAPGVTS-YED-----SLASQQNLLDGAFGDCKVKFI-LEGHTRG 211

Query: 311 -----------ILATGGDDGIVNFW 324
                      ++ TGGDD  V  W
Sbjct: 212 VNWASFHPTLPLIVTGGDDRQVKLW 236

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 63/152 (41%), Gaps = 31/152 (20%)

Query: 55  TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIW------AKEESADRTFEMDLLA------- 101
           T H   +    +     L+ + S D TV +W       K  +   T   D LA       
Sbjct: 134 TGHNHFVMCAQFHQTEDLVVSASLDETVRVWDISGLRKKHSAPGVTSYEDSLASQQNLLD 193

Query: 102 ----------IIEGHENEVKGVAWSNDGYYLA---TCSRDKSVWIWETDESGEEYECISV 148
                     I+EGH    +GV W++    L    T   D+ V +W    S + +E +  
Sbjct: 194 GAFGDCKVKFILEGH---TRGVNWASFHPTLPLIVTGGDDRQVKLWRMS-SNKAWE-VDT 248

Query: 149 LQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
            + H+ +V  V++HP + L+ S + D T+RIW
Sbjct: 249 CRGHTNNVDCVVFHPDQNLILSVAEDKTLRIW 280

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 94/236 (39%), Gaps = 45/236 (19%)

Query: 20  FDFSQGILATGSTDRKIKLVSVKYDD--FTLIDVLDETAHKKAIRSVAWRPHTSLLAAGS 77
           F  +Q I  +   D  IK+ S++ +   +TL      T H   +R+V +      + + S
Sbjct: 61  FHPTQPIFVSAGDDASIKVWSLETNRCLYTL------TGHLDYVRTVFFHSELPWVISAS 114

Query: 78  FDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETD 137
            D TV IW  +   +       LA + GH + V    +      + + S D++V +W+  
Sbjct: 115 DDQTVRIWNWQNRKE-------LACLTGHNHFVMCAQFHQTEDLVVSASLDETVRVWDIS 167

Query: 138 ESGEEYECISV--------------------------LQEHSQDVKHVIWHPSEALLASS 171
              +++    V                          L+ H++ V    +HP+  L+ + 
Sbjct: 168 GLRKKHSAPGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTRGVNWASFHPTLPLIVTG 227

Query: 172 SYDDTVRIWK-DYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
             D  V++W+   +  WE V    GH   V    F   + +  + S ++D T+R+W
Sbjct: 228 GDDRQVKLWRMSSNKAWE-VDTCRGHTNNVDCVVFHPDQNL--ILSVAEDKTLRIW 280

 Score = 36.6 bits (83), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 5/82 (6%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H + +   ++ P   L+  G  D  V +W    S+++ +E+D      GH N V  V + 
Sbjct: 208 HTRGVNWASFHPTLPLIVTGGDDRQVKLW--RMSSNKAWEVD---TCRGHTNNVDCVVFH 262

Query: 117 NDGYYLATCSRDKSVWIWETDE 138
            D   + + + DK++ IW+ D+
Sbjct: 263 PDQNLILSVAEDKTLRIWDLDK 284

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 93/220 (42%), Gaps = 29/220 (13%)

Query: 69  HTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRD 128
             +LL +GS D T+  W   E+ ++ F + + +  +GH + V+ V  S DG Y  + S D
Sbjct: 30  QPNLLVSGSRDKTLISWRLTEN-EQQFGVPVRSY-KGHSHIVQDVVVSADGNYAVSASWD 87

Query: 129 KSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWE 188
           K++ +W       E   +     H+ DV  V    + + + S+S D T+R+W    D   
Sbjct: 88  KTLRLWNLATGNSEARFVG----HTGDVLSVAIDANSSKIISASRDKTIRVWNTVGD--- 140

Query: 189 CVAVLNGHEGTVWSS----------DFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQE 238
           C  VL GH  T W +          D +  +G     S   D  VR W    D    + +
Sbjct: 141 CAYVLLGH--TDWVTKVRVAPKNLEDGEVDDGRITFVSAGMDKIVRSWSLNEDSYRIEAD 198

Query: 239 WVCEAILPDVHKRQVYNVAWGFNG-LIASVGADGVLAVYE 277
           ++        H   +  V    +G L AS G DG + V+ 
Sbjct: 199 FIG-------HNNYINVVQPSPDGSLAASAGKDGQIYVWN 231

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 68/272 (25%), Positives = 107/272 (39%), Gaps = 35/272 (12%)

Query: 56  AHKKAIRSVAWRP-HTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
            H   +R+VA  P      A GS D+T+ IW             L   + GH   VK + 
Sbjct: 127 GHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGK-------LKLTLSGHIMTVKDIC 179

Query: 115 WSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYD 174
            S    Y+ + S DK V  W+     E+   I     H   V  V  HP+  L+A++  D
Sbjct: 180 ISKRHPYMFSASEDKLVKCWDL----EKNRVIRDYHGHLSGVHTVDIHPTLNLIATAGRD 235

Query: 175 DTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDED 234
             VR+W D       V  + GH+  +        +     CS   D+TVR+W        
Sbjct: 236 SVVRLW-DIRTKLP-VMTMAGHKSPINRVKCLPVDPQVVSCSA--DATVRLW-------- 283

Query: 235 DQQEWVCEAILPDVHKRQVYNVAWGFNGL-IASVGADGVLAVYEEVDGEWKVFAKRALCH 293
           D        +L   HKR V ++        I+S   D + +        WK+   + L +
Sbjct: 284 DITAGKTLKVLTH-HKRSVRDIGIHPGEFSISSACTDDIRS--------WKLPEGQLLTN 334

Query: 294 GVYE-INVVKWLELNGKTILATGGDDGIVNFW 324
              E   ++  L +N   +L  G D+G+++F+
Sbjct: 335 FQSEKTGIINTLSINQDDVLFAGSDNGVLSFY 366

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 90/217 (41%), Gaps = 40/217 (18%)

Query: 25  GILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSI 84
            ++AT   D  ++L    +D  T + V+    HK  I  V   P    + + S D+TV +
Sbjct: 227 NLIATAGRDSVVRL----WDIRTKLPVMTMAGHKSPINRVKCLPVDPQVVSCSADATVRL 282

Query: 85  WAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLAT-CSRDKSVWIWE-----TDE 138
           W  + +A +T     L ++  H+  V+ +      + +++ C+ D   W        T+ 
Sbjct: 283 W--DITAGKT-----LKVLTHHKRSVRDIGIHPGEFSISSACTDDIRSWKLPEGQLLTNF 335

Query: 139 SGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYD--------DDWECV 190
             E+   I+ L  +  DV          L A S  D+ V  + DY         D  E  
Sbjct: 336 QSEKTGIINTLSINQDDV----------LFAGS--DNGVLSFYDYKTGHKYQQLDTTEIP 383

Query: 191 AVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
             L    G + +S FD+T    RL +G  D ++++WK
Sbjct: 384 GSLESERG-ILTSTFDQTG--LRLITGESDKSIKIWK 417

 Score = 32.3 bits (72), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 36/79 (45%), Gaps = 10/79 (12%)

Query: 148 VLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDK 207
           V      DV H I H  E +++             +   W+ + V+NGH G V +   D 
Sbjct: 89  VFNSSEDDVFHSIMHRHEQMISQKP---------KWHAPWKLMRVINGHNGWVRTVAVDP 139

Query: 208 TEGVFRLCSGSDDSTVRVW 226
            +  +   +GS+D+T+++W
Sbjct: 140 IDNEW-FATGSNDTTIKIW 157

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 67/156 (42%), Gaps = 14/156 (8%)

Query: 51  VLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEV 110
           +L +  H   + S+++    SL++    D+   IW      +       +  ++GH   +
Sbjct: 298 ILIQEGHSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKN-------IMSLQGHSKPI 350

Query: 111 KGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSE-ALLA 169
             V WS +GY LA+ S D ++ +W+  + G     +  +  H+  V  V ++      L 
Sbjct: 351 YSVDWSQNGYQLASGSGDGTIKVWDIRKKGN----VETILAHNSIVSQVKFNKQNGGYLV 406

Query: 170 SSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDF 205
           SS YD  V I+   D +W     L GH   V S D 
Sbjct: 407 SSGYDKKVNIFN--DGNWIKERSLEGHLDKVMSIDI 440

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 123/286 (43%), Gaps = 37/286 (12%)

Query: 42  KYDDFTL--IDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDL 99
           K   F+L  + V+DE    K I  +   P   L+A GS+   +S+   + S  + +    
Sbjct: 165 KLKQFSLKGMQVIDE----KPISEINTSPGGDLMACGSWSGNLSLV--DNSLSKIYCNRS 218

Query: 100 LAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHV 159
           L+       ++ G+ WS D   +  C+ D  + I++   SG+E   + +L ++      V
Sbjct: 219 LS-----GTKISGLDWSVDSKNIFVCTHDGRIVIYD---SGDE-TTVKILYKNDARFAQV 269

Query: 160 IWHPSEALLASSSYDDTVRIWKDYDDDWEC-VAVLNGHEGTVWSSDFDKTEGVFRLCSGS 218
             HP  + + S+S+D T   W   D   +  + +  GH   V+S  F   +G     +G 
Sbjct: 270 RCHPCNSFIGSTSFDKT---WILIDTVKQAPILIQEGHSAEVFSLSF-HNDGSLVSTAGL 325

Query: 219 DDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGL-IASVGADGVLAVYE 277
            D+   +W    D    +     +      H + +Y+V W  NG  +AS   DG + V+ 
Sbjct: 326 -DAIALIW----DIRSGKNIMSLQG-----HSKPIYSVDWSQNGYQLASGSGDGTIKVW- 374

Query: 278 EVDGEWKVFAKRALCHGVYEINVVKWLELNGKTILATGGDDGIVNF 323
             D   K   +  L H    ++ VK+ + NG  ++++G D  +  F
Sbjct: 375 --DIRKKGNVETILAHNSI-VSQVKFNKQNGGYLVSSGYDKKVNIF 417

>AER280C [2782] [Homologous to ScYML102W (CAC2) - SH]
           (1148956..1150488) [1533 bp, 510 aa]
          Length = 510

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 85/206 (41%), Gaps = 37/206 (17%)

Query: 9   SLKLY---KEKIWSFDFSQGI--------LATGSTDRKIKLVSVKYDD-----FTLIDVL 52
           SL++Y    + I+S  F   +        L T   D K ++  + +D         ID L
Sbjct: 5   SLQIYWHESQPIYSISFQPSLPGSSGAPRLVTAGGDNKARVWQLNFDSERPGKVDSIDFL 64

Query: 53  DE-TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMD------------- 98
              T H++A+    + P   +LA    D  + +W K ++  + F +D             
Sbjct: 65  SSLTQHEQAVNVARFNPSGDVLATAGDDGLLLLWKKNDTIVKEFGIDDDEFADFKESWCV 124

Query: 99  ---LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQD 155
              L  +     +E+  +AWS    Y+ T   D  V I++  E      C++ + EH+  
Sbjct: 125 VEKLRTVSTIGTSEIYDLAWSPCAKYIVTGCMDNGVRIFDIAEK----TCVAHVVEHNHY 180

Query: 156 VKHVIWHPSEALLASSSYDDTVRIWK 181
           V+ V+W P    + S S D +V I+K
Sbjct: 181 VQGVVWDPQNEYIISQSADRSVHIYK 206

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 50/97 (51%), Gaps = 9/97 (9%)

Query: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120
           I  +AW P    +  G  D+ V I+   + A++T     +A +  H + V+GV W     
Sbjct: 139 IYDLAWSPCAKYIVTGCMDNGVRIF---DIAEKT----CVAHVVEHNHYVQGVVWDPQNE 191

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVK 157
           Y+ + S D+SV I++ + S E +  I+ L+ H + +K
Sbjct: 192 YIISQSADRSVHIYKIETSTEGH--ITGLKLHHKIMK 226

 Score = 28.9 bits (63), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 39/90 (43%), Gaps = 4/90 (4%)

Query: 201 WSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGF 260
           +      + G  RL +   D+  RVW+   D E   +    + +       Q  NVA  F
Sbjct: 21  FQPSLPGSSGAPRLVTAGGDNKARVWQLNFDSERPGKVDSIDFLSSLTQHEQAVNVAR-F 79

Query: 261 NG---LIASVGADGVLAVYEEVDGEWKVFA 287
           N    ++A+ G DG+L ++++ D   K F 
Sbjct: 80  NPSGDVLATAGDDGLLLLWKKNDTIVKEFG 109

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 76/187 (40%), Gaps = 29/187 (15%)

Query: 55  TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
           T+H +    + W P    +A  S D +V I              LL    GH   V  + 
Sbjct: 52  TSHARPFSELCWSPDGQCIATASDDFSVEIIH--------LSYGLLHTFIGHTAPVISLT 103

Query: 115 WSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHV-IWHPSEALLASSSY 173
           ++  G  L T S D+S+ IW+T  +G   + IS    HS+ V  V +     ++L+S SY
Sbjct: 104 FNRKGNLLFTSSMDESIKIWDT-LNGSLMKTISA---HSEAVVSVDVPMNDSSILSSGSY 159

Query: 174 DDTVRIWK----------DYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTV 223
           D  +RI+            YD DW+         G V  S    +E    L   S D  V
Sbjct: 160 DGLIRIFDAETGHCLKTLTYDKDWK------RENGVVPISQVKFSENARYLLVKSLDGVV 213

Query: 224 RVWKYMG 230
           ++W  +G
Sbjct: 214 KIWDCIG 220

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 54/126 (42%), Gaps = 8/126 (6%)

Query: 101 AIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVI 160
            ++  H      + WS DG  +AT S D SV I         Y  +     H+  V  + 
Sbjct: 49  TLVTSHARPFSELCWSPDGQCIATASDDFSVEIIHL-----SYGLLHTFIGHTAPVISLT 103

Query: 161 WHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDD 220
           ++    LL +SS D++++IW   +     +  ++ H   V S D    +    L SGS D
Sbjct: 104 FNRKGNLLFTSSMDESIKIWDTLNGSL--MKTISAHSEAVVSVDVPMNDSSI-LSSGSYD 160

Query: 221 STVRVW 226
             +R++
Sbjct: 161 GLIRIF 166

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 64/146 (43%), Gaps = 23/146 (15%)

Query: 54  ETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGV 113
           ET H + I  + W P ++ +A+GS D TV I           E   L  + GH   V  V
Sbjct: 51  ETTHTEPINDICWSPDSACVASGSEDFTVEI--------THLEYGRLHKLRGHSAPVLSV 102

Query: 114 AWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA-LLASSS 172
            ++  G  L T S D+S+  W+   SG     +  +  HS  V  +     +A +L+S S
Sbjct: 103 VFNCKGNLLCTASVDESIKQWDV-LSGTL---LKTMSAHSDPVVSIDTPDCDATILSSGS 158

Query: 173 YDDTVRIWK----------DYDDDWE 188
           YD  +RI+            YD DW+
Sbjct: 159 YDGLIRIFDTESGHCLKTLTYDKDWQ 184

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 10/114 (8%)

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
           S DG Y+A   R  ++ ++   + G    C      H++ +  + W P  A +AS S D 
Sbjct: 23  SPDGRYVAVADR-TAICVYSVGDGG----CARYETTHTEPINDICWSPDSACVASGSEDF 77

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYM 229
           TV I      ++  +  L GH   V S  F+    +  LC+ S D +++ W  +
Sbjct: 78  TVEITH---LEYGRLHKLRGHSAPVLSVVFNCKGNL--LCTASVDESIKQWDVL 126

>Kwal_27.12239
          Length = 316

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 75/187 (40%), Gaps = 29/187 (15%)

Query: 54  ETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGV 113
            T H + +  + W P +  +A  S D T+ I               L  + GH   V  V
Sbjct: 54  STLHSRPLSDLCWSPDSQCIATASDDFTIII--------THIVFGELHRLVGHTAPVTSV 105

Query: 114 AWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-SEALLASSS 172
            ++  G  L +CS D+S+ IW+   SG     +  L  HS+ V  +   P   ++L+S S
Sbjct: 106 KYTMKGNLLCSCSMDESIKIWDI-LSG---TLLRTLSAHSEPVVSIDLPPFDPSILSSGS 161

Query: 173 YDDTVRIWK----------DYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDST 222
           YD  +RI+            YD DW+         G V  S    +     L   S D  
Sbjct: 162 YDGLIRIFDTATGHCLKTLTYDKDWQ------SENGVVPISQVKFSRNGKYLLVKSLDGI 215

Query: 223 VRVWKYM 229
           +++W ++
Sbjct: 216 LKIWDFV 222

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 62/262 (23%), Positives = 106/262 (40%), Gaps = 58/262 (22%)

Query: 14  KEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLL 73
           K K  +F     +L  G ++ + ++  +   DFT I  L  +  + A+ +VA       L
Sbjct: 273 KVKCAAFHADSNMLIVGFSNGEFRMYELP--DFTFIQQL--SMGQNAVNTVAVNRSGEWL 328

Query: 74  AAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWI 133
           A GS  ST+      E    ++ +      +GH + +  +A+S DG  + T + D  + I
Sbjct: 329 AFGS--STLGQLLVYEWQSESYILKQ----QGHFDALNALAYSPDGARIVTAAEDGKIKI 382

Query: 134 WETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW-----KDYDD--- 185
           W+   SG    C++  +EH+  V  V +  +  ++ SSS D TV+ W     +++     
Sbjct: 383 WDI-VSGF---CLATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTA 438

Query: 186 ----DWECVA------------------------------VLNGHEGTVWSSDFDKTEGV 211
                + C+A                               L+GHEG V    F +   +
Sbjct: 439 TERIQFSCLAADPTGEVVCAGSLDNYDIQVWSVQTGQLLDTLSGHEGPVSCLSFSRENSI 498

Query: 212 FRLCSGSDDSTVRVWKYMGDDE 233
             L S S D T+RVW   G  +
Sbjct: 499 --LASASWDKTIRVWSIFGRSQ 518

 Score = 35.4 bits (80), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 53/118 (44%), Gaps = 12/118 (10%)

Query: 64  VAWRPHTSLLAAGSFDST-VSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYL 122
           +A  P   ++ AGS D+  + +W+ +          LL  + GHE  V  +++S +   L
Sbjct: 447 LAADPTGEVVCAGSLDNYDIQVWSVQTG-------QLLDTLSGHEGPVSCLSFSRENSIL 499

Query: 123 ATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
           A+ S DK++ +W      ++ E I    E   DV  +   P    +A S+ +  +  +
Sbjct: 500 ASASWDKTIRVWSIFGRSQQVEPI----EAYSDVLDISMRPDGKQVAVSTLNGQLSFF 553

 Score = 29.3 bits (64), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 6/81 (7%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAI-IEGHENEVKGVA 114
            H   I S+ W   +  + + + D T  I++         E DL ++   GH + V G  
Sbjct: 160 GHFADITSLTWSRDSRFIISTAKDMTARIYSVNAE-----EKDLASMTFAGHRDYVMGAF 214

Query: 115 WSNDGYYLATCSRDKSVWIWE 135
           +S D   + T S+D +++ WE
Sbjct: 215 FSADQEKIYTVSKDGALFQWE 235

>Scas_465.4
          Length = 1002

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 70/309 (22%), Positives = 124/309 (40%), Gaps = 48/309 (15%)

Query: 43  YDDFTLIDVLDETAHKKAI---RSVAWR-------PHTSLLAAGSFDSTVSIWAKEESAD 92
           Y+   + D+  E   +K +   RS+ +        P    ++AG+    V IW      D
Sbjct: 112 YNKVFVCDLTGEILSRKTLQGERSILYSGSIKEFSPEKVYISAGTVMGGVLIW------D 165

Query: 93  RTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEH 152
              E  L  ++ GHE  +     S++G Y+ +CS D+S+ +W   ++GEE   +     H
Sbjct: 166 LFLETKLYNLV-GHEGSIFYATISDNGRYITSCSDDRSIKLWNL-QTGEE---LCTGWGH 220

Query: 153 SQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHE-------GTVWSSDF 205
           +  + ++ +  ++  L S S D+T R+W    D+      L   +         VW  D 
Sbjct: 221 TARIWNLKFFNNDTQLISVSEDNTCRVWDILQDEGNGNTSLTLSQIYEVHLIKNVWGVDI 280

Query: 206 DKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYN-----VAWGF 260
            + + V    +  +D  +++ K       + QE      L D+    V       +  GF
Sbjct: 281 QEKDMV--AVTSGNDGRLKLTKIQDTKTMNAQE--VSFSLEDISTHSVIKFSKGEIIKGF 336

Query: 261 N----GLIASVGADGVLAVYEEVDGEWKV------FAKRALCHGVYEINVVKWLELNGKT 310
                GLIA + + G +  Y E D  WK+          ++ HG+ E N+V +       
Sbjct: 337 QKFEFGLIA-ITSLGKIIQYFECDNLWKLLLVSENLVSYSVTHGIMEHNIVTFSNNKSDA 395

Query: 311 ILATGGDDG 319
           +L     DG
Sbjct: 396 LLLKLSQDG 404

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 74/174 (42%), Gaps = 11/174 (6%)

Query: 53  DETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKG 112
           D   H++ I  V + P    + + S D T  +W      D +   +LL + EGH+  V  
Sbjct: 260 DLVGHERRISDVKYHPSGKFIGSASHDMTWRLW------DASTHQELL-LQEGHDKGVFS 312

Query: 113 VAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSS 172
           +++  DG  + +   D    +W+   SG +   +  L  HS+ +  V W P+   +A+  
Sbjct: 313 LSFQCDGSLVCSGGMDSLSMLWDI-RSGSK---VMTLAGHSKPIYTVAWSPNGYQVATGG 368

Query: 173 YDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            D  + +W     D   +  +  H   V    F K +G  +L S   D+ + V+
Sbjct: 369 GDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVY 422

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 56/267 (20%), Positives = 98/267 (36%), Gaps = 67/267 (25%)

Query: 59  KAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSND 118
           K I +V+      ++A GS+   + +   +     T ++D       H  ++  + W  D
Sbjct: 176 KPISAVSLSTDDMVVATGSWAGDLQVLNSQTLQPLTQKLD------SHVGKIGAIDWHPD 229

Query: 119 -GYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTV 177
               + +C+ D  +  ++          +  L  H + +  V +HPS   + S+S+D T 
Sbjct: 230 SNNQMISCAEDGLIKNFQYSNEEGGLRLLGDLVGHERRISDVKYHPSGKFIGSASHDMTW 289

Query: 178 RIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQ 237
           R+W D     E + +  GH+  V+S  F + +G   +CSG  DS   +W           
Sbjct: 290 RLW-DASTHQELL-LQEGHDKGVFSLSF-QCDGSL-VCSGGMDSLSMLWDIRSG------ 339

Query: 238 EWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEWKVFAKRALCHGVYE 297
               + +    H + +Y VAW  NG                                 Y+
Sbjct: 340 ---SKVMTLAGHSKPIYTVAWSPNG---------------------------------YQ 363

Query: 298 INVVKWLELNGKTILATGGDDGIVNFW 324
           +              ATGG DGI+N W
Sbjct: 364 V--------------ATGGGDGIINVW 376

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 33/158 (20%), Positives = 62/158 (39%), Gaps = 49/158 (31%)

Query: 19  SFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSF 78
           SF     ++ +G  D     +S+ +D  +   V+    H K I +VAW P+   +A G  
Sbjct: 314 SFQCDGSLVCSGGMDS----LSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGG 369

Query: 79  DSTVSIW-------------------------AKEE-----------------SADRTFE 96
           D  +++W                         +KE+                 S+D   +
Sbjct: 370 DGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVYSSDTWLK 429

Query: 97  MDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIW 134
           M  LA   GH +++  +  SN+ ++L +   D+S+ +W
Sbjct: 430 MGSLA---GHTDKIISLDISNNSHFLVSGGWDRSIKLW 464

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 77/185 (41%), Gaps = 29/185 (15%)

Query: 55  TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
           T HK+ I  + W P +  +A+GS D TV I        R         + GH   V  + 
Sbjct: 66  TTHKECINCLCWSPDSKCIASGSEDFTVEITHIIYGRIRR--------LMGHTAPVISIC 117

Query: 115 WSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHV-IWHPSEALLASSSY 173
           ++N G  L + S D+S+  W    SG   + +S    HS  V  + I     ++L+S SY
Sbjct: 118 YNNKGNILCSSSMDESIKEWHV-LSGTALKTMSA---HSDAVVSIDIPKFDSSILSSGSY 173

Query: 174 DDTVRIWK----------DYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTV 223
           D  +RI+            YD DW         +G V  S    +     L   S D+ V
Sbjct: 174 DGLIRIFDTESGHCLKTLTYDKDWI------AEDGVVPISTVKFSRNGKFLLVKSLDNVV 227

Query: 224 RVWKY 228
           ++W+Y
Sbjct: 228 KLWEY 232

>Scas_721.7
          Length = 325

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 78/191 (40%), Gaps = 32/191 (16%)

Query: 49  IDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHEN 108
           I  +  T+H   I  VAW P    LA+ S D T+ I               L  + GH  
Sbjct: 48  IHSIIPTSHVAPISEVAWSPDNQCLASASDDFTIEITHLTHGC--------LHRLMGHTA 99

Query: 109 EVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSE--A 166
            V  + +++ G  L T S D+S+ IW+T         +  +  HS+ V  +   P    +
Sbjct: 100 PVISLTYNDSGNLLFTSSMDESIKIWDTFHGA----ILKTISAHSESVVSLSICPDRDSS 155

Query: 167 LLASSSYDDTVRIWK----------DYDDDWECVAVLNGHEGTVWSSDFD-KTEGVFRLC 215
           +LAS S+D  +R++            YD DW+        +G V  S       G F L 
Sbjct: 156 VLASGSFDGLIRLFDTRTGHCLKTLTYDKDWK------SDDGVVPISQVRFSPNGKFLLV 209

Query: 216 SGSDDSTVRVW 226
           S S D  V++W
Sbjct: 210 S-SFDGIVKIW 219

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 85/196 (43%), Gaps = 26/196 (13%)

Query: 7   IKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAW 66
           I+  K + + + S  F+  +L TGS D  + +   K  +  LI  L  T H   ++ + +
Sbjct: 305 IQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGN--LIRRL--TGHTDGVKGIYF 360

Query: 67  RPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY--YLAT 124
                + A  S D T+ +W     +        ++   GH++ V  V    D Y   + +
Sbjct: 361 DDQKMITA--SLDKTIRVWNYITGS-------CISTYRGHQDSVLSV----DSYKKIIVS 407

Query: 125 CSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYD 184
            S DK+V +W      E   C + L+ H++ V  V  HP      SSS D T+R+W    
Sbjct: 408 ASADKTVKVWHV----ESRTCYT-LRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRT 462

Query: 185 DDWECVAVLNGHEGTV 200
           +   C+ V  GH G V
Sbjct: 463 N--SCIKVFRGHVGQV 476

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/260 (21%), Positives = 97/260 (37%), Gaps = 62/260 (23%)

Query: 5   NLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSV 64
           NLI+ L  + + +    F    + T S D+ I++    ++  T   +     H+ ++ SV
Sbjct: 343 NLIRRLTGHTDGVKGIYFDDQKMITASLDKTIRV----WNYITGSCISTYRGHQDSVLSV 398

Query: 65  AWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLAT 124
               +  ++ + S D TV +W  E     T        + GH   V  V      +   +
Sbjct: 399 D--SYKKIIVSASADKTVKVWHVESRTCYT--------LRGHTEWVNCVKLHPKSFTCYS 448

Query: 125 CSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWH-----------------PSEAL 167
            S DK++ +W+   +     CI V + H   V+ VI                   P+  L
Sbjct: 449 SSDDKTLRMWDIRTNS----CIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPEL 504

Query: 168 ---------------------LASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFD 206
                                L S S D+T+++W+       C+    GH   VW    D
Sbjct: 505 EEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEV--SSGRCIRTQFGHVEGVWDIAAD 562

Query: 207 KTEGVFRLCSGSDDSTVRVW 226
                FR+ SGS D +++VW
Sbjct: 563 N----FRIVSGSHDKSIKVW 578

 Score = 32.7 bits (73), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 6/66 (9%)

Query: 164 SEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTV 223
           +  LL + SYD TV IW     +   +  L GH   V    FD      ++ + S D T+
Sbjct: 321 NHRLLFTGSYDSTVAIWDTKSGNL--IRRLTGHTDGVKGIYFDDQ----KMITASLDKTI 374

Query: 224 RVWKYM 229
           RVW Y+
Sbjct: 375 RVWNYI 380

>Kwal_56.23685
          Length = 1102

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 75/177 (42%), Gaps = 12/177 (6%)

Query: 64  VAWRPHTSLLA--AGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW-SNDGY 120
           V W PH S  +    + +    +W    ++    E     ++ GH   +  + +      
Sbjct: 73  VQWSPHPSKPSWVISTSNQKALLWNLSRNSSDAIEH----VLHGHSRAITDINFHPTHPE 128

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
            LATCS D  V  W+       Y   SV    +  VK   W+   + + +S++ + V IW
Sbjct: 129 ILATCSIDAYVHAWDMRSPRRAYYSASVWSAGASQVK---WNYKNSNVMASAHSNDVYIW 185

Query: 181 KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQ 237
            D       + VL GH  +V S DF K +    + S S+D TV+ W Y   D++ Q+
Sbjct: 186 -DLRKGCTPLHVLQGHVNSVNSIDFSKFDET-EIMSSSNDGTVKFWDYSLSDKEPQR 240

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 86/180 (47%), Gaps = 28/180 (15%)

Query: 56  AHKKAIRSVAWRPHTS-LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
            HK    S+ + P T  LL +G  D+ + +W      D   E +LL   EGH   +K + 
Sbjct: 133 GHKNGTTSLRFIPKTGHLLLSGGNDNIIKLW------DFYHERELLRTYEGHSMTIKDLN 186

Query: 115 WSNDGYYLATCSRDKSVWIWETDES--------GEEYECISVLQEHSQDVKHVIWHPSEA 166
           ++++G+  A+ S DK V IW T++              CI+    H +D   ++   S +
Sbjct: 187 FTDNGHSFASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITF---HPKDKNQLVVGLSNS 243

Query: 167 LLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            +    YD  +R+ +++ +    V   + H+G++ +  +   +G  +L S S+D TVR+W
Sbjct: 244 EI--RHYD--LRLSENHGE----VQKYDHHQGSILALKY-FPDGK-KLISSSEDKTVRIW 293

>Scas_720.45
          Length = 755

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 58/120 (48%), Gaps = 13/120 (10%)

Query: 64  VAWRPH-TSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSN--DGY 120
           VA+ P   +  A+G  D TV +W+  + A   F ++      G E  V  V +    D  
Sbjct: 3   VAFNPKDPNTFASGCLDRTVKVWSLGQ-ATPNFTLN-----SGQEKGVNYVDYYPLPDKP 56

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
           YL T S D +  +W+     +   C++ L+ H  +V   ++HP+  ++ S S D T++IW
Sbjct: 57  YLITSSDDLTCKVWDY----QTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIW 112

 Score = 29.3 bits (64), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 64/167 (38%), Gaps = 17/167 (10%)

Query: 159 VIWHPSEA-LLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSG 217
           V ++P +    AS   D TV++W           + +G E  V   D+        L + 
Sbjct: 3   VAFNPKDPNTFASGCLDRTVKVWS-LGQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITS 61

Query: 218 SDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYE 277
           SDD T +VW Y        Q   C A L        + V      +I S   DG L ++ 
Sbjct: 62  SDDLTCKVWDY--------QTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIWN 113

Query: 278 ----EVDGEWKVFAKRALC---HGVYEINVVKWLELNGKTILATGGD 317
               +V+    +  +R+ C   H   + N +     NG T+L+ G D
Sbjct: 114 SATYKVEKTLSLGLERSWCIATHPTGKKNYIASGFDNGFTVLSLGND 160

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/228 (21%), Positives = 92/228 (40%), Gaps = 22/228 (9%)

Query: 5   NLIKSLKLYKEKIWSFDFSQGI--LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIR 62
           N + S + +K  + S  F Q    + + S D  IK+  V+        V     H   + 
Sbjct: 66  NPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPS-----VQRNYKHNAPVN 120

Query: 63  SVAWRPHTSLLAAGSFDSTVSIW--AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120
            VA  P+   L +   D  + IW   + +  ++    D           ++ ++ ++DG 
Sbjct: 121 EVAIHPNQGELISCDQDGNIRIWDLGENQCTNQLTPED--------NTPLQSLSVASDGS 172

Query: 121 YLATCSRDKSVWIWETDES--GEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVR 178
            L   +   + ++W+          E ++  + H++ +  V+       LA+ S D T R
Sbjct: 173 MLVAGNNKGNCYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTAR 232

Query: 179 IWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           +W + +D++E    L+GH+  VW   F        L +   D  VR+W
Sbjct: 233 VW-NIEDNFELETTLDGHQRWVWDCAFSADSAY--LVTACSDHYVRLW 277

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 61/135 (45%), Gaps = 8/135 (5%)

Query: 93  RTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEH 152
           R+   + ++  EGH+  V  +A+  +  ++ + S D ++ +W+      +        +H
Sbjct: 61  RSNNPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRN-----YKH 115

Query: 153 SQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVF 212
           +  V  V  HP++  L S   D  +RIW D  ++ +C   L   + T   S    ++G  
Sbjct: 116 NAPVNEVAIHPNQGELISCDQDGNIRIW-DLGEN-QCTNQLTPEDNTPLQSLSVASDGSM 173

Query: 213 RLCSGSDDSTVRVWK 227
            L +G++     VWK
Sbjct: 174 -LVAGNNKGNCYVWK 187

 Score = 35.4 bits (80), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 42/96 (43%), Gaps = 6/96 (6%)

Query: 44  DDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAII 103
           D  TL  V    +H K I  V        LA  S D T  +W  E++    FE++    +
Sbjct: 193 DASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDN----FELE--TTL 246

Query: 104 EGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDES 139
           +GH+  V   A+S D  YL T   D  V +W+   S
Sbjct: 247 DGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTS 282

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 65/167 (38%), Gaps = 18/167 (10%)

Query: 72  LLAAGSFDSTVSIW-AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKS 130
           +LA+  +D T+  W A      RT        I+  +++V  +  ++D  YLA       
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRT--------IQHADSQVNRLEITSDKKYLAAAGH--- 52

Query: 131 VWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECV 190
           + +   D        +S  + H  +V  + +      + SSS D T+++W   D     V
Sbjct: 53  LHVRLYDIRSNNPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVW---DVRSPSV 109

Query: 191 AVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQ 237
                H   V        +G   L S   D  +R+W  +G+++   Q
Sbjct: 110 QRNYKHNAPVNEVAIHPNQG--ELISCDQDGNIRIWD-LGENQCTNQ 153

>Kwal_56.23920
          Length = 937

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 93/241 (38%), Gaps = 64/241 (26%)

Query: 47  TLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIW---AKEESA------------ 91
           TL++ + E AH  AI S+        L  GS D TV  W    ++E              
Sbjct: 457 TLLNTI-EGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLK 515

Query: 92  ---DRTFEM--DLLAI-------------------------------IEGHENEVKGVAW 115
              D T E+  D+LA+                               + GH+  V  +  
Sbjct: 516 MFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDI 575

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
           S D   L T S DK++ IW  D      +C   L  H+  +  V++ P      S S D 
Sbjct: 576 SFDSKLLITSSADKNIKIWGLDFG----DCHRSLFAHNDSIMKVVFVPESHNFFSCSKDA 631

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDD 235
            V+ W    D +EC+  L  H+  VW+     ++G F + S S D ++RVW     + DD
Sbjct: 632 LVKYWD--GDKFECIQKLAAHQKEVWTLAIS-SDGRF-VVSASHDQSIRVW----SETDD 683

Query: 236 Q 236
           Q
Sbjct: 684 Q 684

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 58/139 (41%), Gaps = 14/139 (10%)

Query: 64  VAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLA 123
           + + P T LLA G  D  + IW             +L    GH++ +  + +   G  L 
Sbjct: 81  LQYHPETRLLAVGYNDGAIKIWD-------LLSKSVLISFNGHKSAITILTFDQTGTRLI 133

Query: 124 TCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDY 183
           + SRD  + +W  D  GE    +  L+ H   +   +W   E  L S+S D  +++W D 
Sbjct: 134 SGSRDSDIIVW--DLVGE--VGLYKLRSHKDSITG-LWCEGEEWLISTSKDGLIKVW-DL 187

Query: 184 DDDWECVAVLNGHEGTVWS 202
               +CV     H G  WS
Sbjct: 188 KVQ-QCVETHVAHVGECWS 205

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 77/185 (41%), Gaps = 27/185 (14%)

Query: 61  IRSVAWRPHTSL---LAAGSFDSTV---SIWAKEESADRTFEMDLLAI-IEGHENEVKGV 113
           +RSV W   T+    L   + ++TV   SI  ++          L +I I GH ++V+ +
Sbjct: 332 VRSVCWATTTTSKLDLVVTTANNTVDYYSIKYQKREPTMPSPPKLHSIDIRGHRSDVRAI 391

Query: 114 AWSNDGYYLATCSRDK-SVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSS 172
             S D   LAT S     +W  +T+     +EC   L           + P  AL+   +
Sbjct: 392 DISGDNKLLATASNGTLKIWNIKTNSCIRTFECGYALA--------CKFLPGGALVVLGT 443

Query: 173 YDDTVRIWKDYDDDWECVAVLN----GHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKY 228
               + ++     D     +LN     H G +WS D   T+G  RL +GS D TV  W +
Sbjct: 444 KTGDLHLY-----DLASSTLLNTIEGAHSGAIWSLDM-TTDGK-RLVTGSADKTVCFWDF 496

Query: 229 MGDDE 233
             + E
Sbjct: 497 QVEQE 501

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 10/80 (12%)

Query: 155 DVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVL---NGHEGTVWSSDFDKTEGV 211
           +  ++ +HP   LLA    D  ++IW     D    +VL   NGH+  +    FD+T   
Sbjct: 77  ETSYLQYHPETRLLAVGYNDGAIKIW-----DLLSKSVLISFNGHKSAITILTFDQTGT- 130

Query: 212 FRLCSGSDDSTVRVWKYMGD 231
            RL SGS DS + VW  +G+
Sbjct: 131 -RLISGSRDSDIIVWDLVGE 149

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 70/155 (45%), Gaps = 18/155 (11%)

Query: 26  ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIW 85
           +LA G  D  IK+    +D  +   ++    HK AI  + +    + L +GS DS + +W
Sbjct: 89  LLAVGYNDGAIKI----WDLLSKSVLISFNGHKSAITILTFDQTGTRLISGSRDSDIIVW 144

Query: 86  AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYEC 145
                 D   E+ L   +  H++ + G+ W     +L + S+D  + +W+     +  +C
Sbjct: 145 ------DLVGEVGLYK-LRSHKDSITGL-WCEGEEWLISTSKDGLIKVWDL----KVQQC 192

Query: 146 ISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
           +     H  +   +  H  E L+ ++  D+ +++W
Sbjct: 193 VETHVAHVGECWSMGVH--EDLVITAGADNQIKLW 225

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 96/228 (42%), Gaps = 30/228 (13%)

Query: 69  HTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRD 128
             +LL + S D T+  W K    D+ F + + +  +GH + V+    + DG Y  + S D
Sbjct: 29  QPNLLLSASRDKTLISW-KLTGDDQKFGVPVRSF-KGHSHIVQDCTLTADGAYALSASWD 86

Query: 129 KSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWE 188
           K++ +W+   +GE Y+       H  DV  V      +++ S S D T+++W       +
Sbjct: 87  KTLRLWDV-ATGETYQR---FVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKG---Q 139

Query: 189 CVAVLNGHEGTVWSSDFDKTEGV----FRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAI 244
           C+A L GH   V        E        + S  +D  V+ W           ++  EA 
Sbjct: 140 CLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNL--------NQFQIEAD 191

Query: 245 LPDVHKRQVYNVAWGFNG-LIASVGADGVLAVYEEVDGEWKVFAKRAL 291
               H   +  +    +G LIAS G DG + +       W + AK+A+
Sbjct: 192 FIG-HNSNINTLTASPDGTLIASAGKDGEIML-------WNLAAKKAM 231

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 54/131 (41%), Gaps = 18/131 (13%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGV--- 113
           HK  + SV      S++ +GS D T+ +W        T +   LA + GH + V  V   
Sbjct: 106 HKSDVMSVDIDKKASMIISGSRDKTIKVW--------TIKGQCLATLLGHNDWVSQVRVV 157

Query: 114 ---AWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLAS 170
                 +D   + +   DK V  W  ++   E + I     H+ ++  +   P   L+AS
Sbjct: 158 PNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIG----HNSNINTLTASPDGTLIAS 213

Query: 171 SSYDDTVRIWK 181
           +  D  + +W 
Sbjct: 214 AGKDGEIMLWN 224

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 81/193 (41%), Gaps = 28/193 (14%)

Query: 13  YKEKIWSFDFSQGILATGSTDRKIKLVSVKY-DDFTLIDVLD------ETAHKKAIRSVA 65
           ++  I + + S GI  +       K ++V     + L +V D       T+H +++  + 
Sbjct: 4   FQTSIPTSEKSVGICTSAKVSPDGKFIAVSQGTSYLLYNVSDGLSAFIPTSHVESMSDIC 63

Query: 66  WRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATC 125
           W P +  +A  S D T+ I               L  + GH   V  + +++ G  L + 
Sbjct: 64  WSPDSQCIATASDDFTIEI--------NHITYGRLHRLVGHTAPVLSLVYTSKGNLLCSA 115

Query: 126 SRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWK---- 181
           S D+S+ IW+   +G   + IS   E    +   +  PS  +L+S SYD  +RI+     
Sbjct: 116 SMDESIKIWDV-LTGTLLKTISAHSEPVVSIDMPVCDPS--ILSSGSYDGLIRIFDTTTG 172

Query: 182 ------DYDDDWE 188
                  YD DW+
Sbjct: 173 HCLKTLTYDKDWK 185

>Scas_605.18
          Length = 424

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 104/232 (44%), Gaps = 31/232 (13%)

Query: 103 IEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWH 162
           ++GH N++    WS D   + + S+D  + IW+T  SG +   I +    SQ V      
Sbjct: 87  LKGHNNKISDFRWSRDSKSILSASQDGFMLIWDT-ASGLKRNAIPL---DSQWVLSCALS 142

Query: 163 PSEALLASSSYDDTV---RIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSD 219
           PS  L AS+  ++     R+ K+       V++  GH  T + SD +  +    + + S 
Sbjct: 143 PSGNLAASAGLNNNCTIYRVSKENRVQQNVVSIFKGH--TCYISDIEFLDNS-HIITSSG 199

Query: 220 DSTVRVW-----KYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLA 274
           D T  +W     K + +  D   + +  A+ P            G N + AS G+DG   
Sbjct: 200 DMTCALWDIPKAKRVREYADHLGDVLALALPPPSADENT-----GAN-IFASCGSDGYTY 253

Query: 275 VYEEVDGE--WKVFAKRALCHGVYEINVVKWLELNGKTILATGGDDGIVNFW 324
           +++        K FA         ++N +++ + +G +I+ TGGDDG++N +
Sbjct: 254 IWDTRTSAAVQKFFASDT------DVNAIQFFK-DGNSIV-TGGDDGVINMF 297

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 4/66 (6%)

Query: 115 WSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYD 174
           +SN G  +  C  D    IW+  ++    E +  L+ HS  V  V   P    + + S+D
Sbjct: 358 FSNSGRLMFACYTDLGCIIWDVLKA----EIVGKLEGHSNRVSSVRTSPDGLGVCTGSWD 413

Query: 175 DTVRIW 180
            T+RIW
Sbjct: 414 STMRIW 419

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 23/43 (53%)

Query: 95  FEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETD 137
            + +++  +EGH N V  V  S DG  + T S D ++ IW  +
Sbjct: 380 LKAEIVGKLEGHSNRVSSVRTSPDGLGVCTGSWDSTMRIWSPN 422

>YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein
           essential for replication of M double-stranded RNA
           (dsRNA) virus, member of the WD (WD-40) repeat family
           [1407 bp, 468 aa]
          Length = 468

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 68/265 (25%), Positives = 104/265 (39%), Gaps = 55/265 (20%)

Query: 87  KEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECI 146
           KE  A +T     +   + H   +K +A S    YL + S D+ + I++  +  E    +
Sbjct: 86  KENDAAKTPHFMPIFHFQAHSLSIKCLAVSRR--YLVSGSNDEHIRIYDLQKRKE----L 139

Query: 147 SVLQEHSQDVKHVIW-HPSEAL--------------LASSSYDDTVRIWKDYDDDWECVA 191
             L  H   +  + + HP+ +               L S+S D  + +W+    DWE V 
Sbjct: 140 GTLLSHQGSITALQFSHPASSSEDAAVSKGSKNSKWLLSASEDHKIMVWRV--KDWETVG 197

Query: 192 VLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKR 251
            L GH   V   D   T  +    S SDD ++R+W  M             A+L    K 
Sbjct: 198 TLKGHTARVNDVDIHPTNRI--AISVSDDHSIRLWNLM--------TLRNAAVL----KL 243

Query: 252 QVYN-----VAW-GFNGLIASVGADGVLAVYEEVDGEWK-----VFAKRALCHGVYEINV 300
           + YN     V W G  G   +VG    + +YE   G  K     VF ++ L H    I  
Sbjct: 244 RKYNTNGTCVRWLGAKGDYFAVGLRDRVLIYE--TGSAKVFKEIVFQRKTLMHIETHI-- 299

Query: 301 VKWLELNGKTILATGGDDGIVNFWS 325
              L  + K  L+ G  DG V+F+ 
Sbjct: 300 ---LPFDNKEYLSVGISDGNVHFYP 321

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 61/135 (45%), Gaps = 6/135 (4%)

Query: 99  LLAIIEGHENEVKGVAWS-NDGYYLATCSRDKSVWIWETDESGEEYEC-ISVLQEHSQDV 156
           L   +EGH   V  +A S      L + SRDK++  W+     +++   +   + HS  V
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIV 68

Query: 157 KHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCS 216
           +      + A   S S+D T+R+W       E      GH+G V S   DK   +  + S
Sbjct: 69  QDCTLTENGAYALSGSWDKTLRLWDVATG--ETFQTFVGHKGDVMSVAIDKKASM--IIS 124

Query: 217 GSDDSTVRVWKYMGD 231
           GS D +++VW   GD
Sbjct: 125 GSRDKSIKVWSIKGD 139

 Score = 32.0 bits (71), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 19/101 (18%)

Query: 75  AGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIW 134
           +GS+D T+ +W  + +   TF+        GH+ +V  VA       + + SRDKS+ +W
Sbjct: 82  SGSWDKTLRLW--DVATGETFQ-----TFVGHKGDVMSVAIDKKASMIISGSRDKSIKVW 134

Query: 135 ETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
                  + +C++ L  H+  V       S+  +A+SS DD
Sbjct: 135 SI-----KGDCLATLIGHNDWV-------SQVRIANSSDDD 163

>Scas_695.15
          Length = 327

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 5/88 (5%)

Query: 93  RTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEH 152
           RT   + +A  EGH+  V  V++  D  ++ T S D ++ +W+          +    +H
Sbjct: 81  RTTNPNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDV-----RSPSVPRNYKH 135

Query: 153 SQDVKHVIWHPSEALLASSSYDDTVRIW 180
           +  V  V+ HP++  L S   D T++IW
Sbjct: 136 NAPVNEVVIHPNQGELISCDRDGTIKIW 163

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 72/158 (45%), Gaps = 3/158 (1%)

Query: 23  SQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTV 82
           +QG L +   D  IK+  +  +  T   + D+     +++S++     S+L A +     
Sbjct: 147 NQGELISCDRDGTIKIWDLGENQCTHQLIPDDD--NTSLQSLSVASDGSMLVAANNKGDC 204

Query: 83  SIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEE 142
            +W      D +  +  +     H++ +  V  S+D  ++ATCS D++  IW   E+ ++
Sbjct: 205 YVWEMPNHTDAS-NLKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGETEDD 263

Query: 143 YECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
           +   + L  H + V    +    A L ++S D  VR+W
Sbjct: 264 FNLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 301

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 39/81 (48%), Gaps = 3/81 (3%)

Query: 55  TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
           +AHK  I  V        +A  S D T  IW+  E+ D   + +L   ++GH+  V   A
Sbjct: 225 SAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGETED---DFNLETTLDGHQRWVWDCA 281

Query: 115 WSNDGYYLATCSRDKSVWIWE 135
           +S D  YL T S D  V +W+
Sbjct: 282 FSADSAYLVTASSDHYVRLWD 302

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/244 (18%), Positives = 89/244 (36%), Gaps = 51/244 (20%)

Query: 31  STDRKIKLVSVKYDDFTLIDVLDETA--------HKKAIRSVAWRPHTSLLAAGSFDSTV 82
           + D+K+ L +  Y +  L D+             HK  + SV+++     +   S D T+
Sbjct: 61  TNDKKL-LAAAGYQNVRLYDIRTTNPNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTI 119

Query: 83  SIW-AKEESADRTFEMDLL---AIIEGHENE----------------------------- 109
            +W  +  S  R ++ +      +I  ++ E                             
Sbjct: 120 KVWDVRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGTIKIWDLGENQCTHQLIPDDD 179

Query: 110 ---VKGVAWSNDGYYLATCSRDKSVWIWETDES--GEEYECISVLQEHSQDVKHVIWHPS 164
              ++ ++ ++DG  L   +     ++WE          + I+    H   +  V+    
Sbjct: 180 NTSLQSLSVASDGSMLVAANNKGDCYVWEMPNHTDASNLKPINKFSAHKDYITRVVLSSD 239

Query: 165 EALLASSSYDDTVRIWK--DYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDST 222
              +A+ S D T +IW   + +DD+     L+GH+  VW   F        L + S D  
Sbjct: 240 VKHMATCSADRTAKIWSVGETEDDFNLETTLDGHQRWVWDCAFSADSAY--LVTASSDHY 297

Query: 223 VRVW 226
           VR+W
Sbjct: 298 VRLW 301

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 3/82 (3%)

Query: 145 CISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSD 204
           C   +Q     V  +     + LLA++ Y + VR++     +   VA   GH+G V S  
Sbjct: 44  CSRTIQHSDSQVNRLEITNDKKLLAAAGYQN-VRLYDIRTTNPNAVATFEGHKGNVTSVS 102

Query: 205 FDKTEGVFRLCSGSDDSTVRVW 226
           F +      + + S+D T++VW
Sbjct: 103 FQQDNKW--MVTSSEDGTIKVW 122

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 99/238 (41%), Gaps = 45/238 (18%)

Query: 51  VLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEV 110
           V  + + ++ I SV+W P   L+  G+    + +W K+          L  I++ H + +
Sbjct: 202 VYPKRSEEEPIISVSWSPDGELVLTGTTSGELRLWNKQGK--------LKNILDSHRSPI 253

Query: 111 KGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECIS-----VLQEHSQDV--------K 157
             + W+ D  +L T      V +W T  +G + +  S     +  E S  +        K
Sbjct: 254 VAMKWNQDCTHLLTTDVSNVVILWST-LTGTQLQHFSFKEGDIENEDSLGIDLEWVETDK 312

Query: 158 HVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSG 217
            VI  P  +LL  +  ++            + +  L GH  T+ + +F+K+     L S 
Sbjct: 313 FVIPGPGGSLLVYTIGNN------------KPLGRLLGHTSTITTLEFNKSNK--SLLSA 358

Query: 218 SDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAV 275
           SDD+T++VW+  G +     ++         H + + +  W  + LI S   DG + V
Sbjct: 359 SDDNTIKVWR--GGNSSAANDFTD-------HTKTISSAHWINDDLIISTAYDGTVKV 407

>Kwal_26.8776
          Length = 433

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 58/281 (20%), Positives = 112/281 (39%), Gaps = 68/281 (24%)

Query: 1   MASINLIKSLKLYKEKIWSFDFSQ--GILATGSTDRKIKLVSVKYDDFTLIDVLDETAHK 58
           MAS  L  +L  +   + S   SQ   ++ + S D+ +K   ++ +      + D   H 
Sbjct: 151 MASGKLKLTLTGHVMTVRSVAVSQRHPLMFSASEDKMVKCWDLERN----AAIRDYHGHF 206

Query: 59  KAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSND 118
             + +V   P   L+A+   D+ V +W      D    + ++ +  GH++ +  V     
Sbjct: 207 SGVNTVDVHPTLDLIASAGRDAVVRLW------DIRTRLPVMTL-AGHKSPINQVKCFPV 259

Query: 119 GYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVR 178
              + +CS D +V +W+        +   +L  HS+ V+ +  HP+E+ +A++S  D VR
Sbjct: 260 DPQIMSCSSDATVRLWDIRAG----KATKILTHHSKSVRAIAAHPAESSVATASTSD-VR 314

Query: 179 IWKDYDDDW------ECVAVLN--------------------------GH---------- 196
            W+  D         E + ++N                          GH          
Sbjct: 315 SWRHSDGQLLTNYHSEGIGIINSLSVNADGVLFGGGDDGNLSFFDYKSGHKYQELPTTKI 374

Query: 197 ------EGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGD 231
                 E  + S+ FD+T    RL +G  D ++++WK + +
Sbjct: 375 PGSLDSERGILSASFDQTG--LRLITGESDKSIKMWKQIPE 413

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 173 YDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           +   + +  ++   W+ + V+NGH G V     D  +  +   +GS+D+T++VW
Sbjct: 97  HKQQLELQPEWHAPWKLMRVINGHNGWVRCVCPDPVDNAW-FATGSNDTTIKVW 149

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 95/224 (42%), Gaps = 24/224 (10%)

Query: 51  VLDETAHKKAIRSVAWRPHTS-LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENE 109
           + +   H +   ++ + P T  L+ +G  D T+ IW      D   + + L   +GH   
Sbjct: 155 IRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIW------DFYHDYECLRDFQGHNKP 208

Query: 110 VKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLA 169
           +K + ++ D     + S D+SV IW+T E+G+    +  L     DV+    +P E ++ 
Sbjct: 209 IKALRFTEDCQSFLSSSFDRSVKIWDT-ETGKVKTRLH-LNSTPADVESRPTNPHEFIVG 266

Query: 170 SSS-----YDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVR 224
            S+     YDD V       ++   V   + H  ++ +  +      F   S S+D TVR
Sbjct: 267 LSNSKILHYDDRV------SENQGLVQTYDHHLSSILALKYFPDGSKF--ISSSEDKTVR 318

Query: 225 VWKYMGDDEDDQQEWVCEAILP--DVHKRQVYNVAWGFNGLIAS 266
           +W+   +    Q     +  +P  +VH  Q Y  A   +  I S
Sbjct: 319 IWENQINVPIKQISDTAQHSMPFLNVHPSQNYFCAQSMDNRIYS 362

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 69/190 (36%), Gaps = 44/190 (23%)

Query: 26  ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIW 85
           ++ +G  D  IK+    +D   L D      H K I+++ +        + SFD +V IW
Sbjct: 177 LILSGGNDHTIKIWDFYHDYECLRDF---QGHNKPIKALRFTEDCQSFLSSSFDRSVKIW 233

Query: 86  AKEESA-------------------------------------DRTFE-MDLLAIIEGHE 107
             E                                        DR  E   L+   + H 
Sbjct: 234 DTETGKVKTRLHLNSTPADVESRPTNPHEFIVGLSNSKILHYDDRVSENQGLVQTYDHHL 293

Query: 108 NEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEAL 167
           + +  + +  DG    + S DK+V IWE ++     + IS   +HS    +V  HPS+  
Sbjct: 294 SSILALKYFPDGSKFISSSEDKTVRIWE-NQINVPIKQISDTAQHSMPFLNV--HPSQNY 350

Query: 168 LASSSYDDTV 177
             + S D+ +
Sbjct: 351 FCAQSMDNRI 360

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 103/259 (39%), Gaps = 58/259 (22%)

Query: 14  KEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLL 73
           K K  +F  +  IL  G ++ + +L  +   +F +I  L  +  + A+ +VA       L
Sbjct: 258 KVKCSAFHAASNILTVGFSNGEFRLYELP--EFIMIQQL--SMGQNAVNTVAINSSGEWL 313

Query: 74  AAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWI 133
           A GS      I  + +S     +       +GH + + G+ +S DG  + T S +  + I
Sbjct: 314 AFGSSKLGQLIVYEWQSESYILKQ------QGHFDTLNGLCYSPDGSKIVTASHEGKIKI 367

Query: 134 WETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW-----KDY----- 183
           W+   SG    C++   EH+  V  V +     +L S+S D TV+ W     +++     
Sbjct: 368 WDV-ASGF---CLATFDEHAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRTFTA 423

Query: 184 ----------------------DDDW----------ECVAVLNGHEGTVWSSDFDKTEGV 211
                                 +D +          + V  L+GHEG +    F    GV
Sbjct: 424 TERIQFNSLAVDPSGEVVCAGSEDSFDIFVWSVQTGQLVDTLSGHEGPISCLSFSNENGV 483

Query: 212 FRLCSGSDDSTVRVWKYMG 230
             L S S D T+RVW   G
Sbjct: 484 --LASASWDKTIRVWSLFG 500

 Score = 37.0 bits (84), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 52/113 (46%), Gaps = 12/113 (10%)

Query: 61  IRSVAWRPHTSLLAAGSFDS-TVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDG 119
             S+A  P   ++ AGS DS  + +W+ +          L+  + GHE  +  +++SN+ 
Sbjct: 429 FNSLAVDPSGEVVCAGSEDSFDIFVWSVQTG-------QLVDTLSGHEGPISCLSFSNEN 481

Query: 120 YYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSS 172
             LA+ S DK++ +W      ++ E   V      DV  +   P    +A+S+
Sbjct: 482 GVLASASWDKTIRVWSLFGRSQQVEPFEVF----SDVLSISMKPDGQQIAAST 530

 Score = 35.8 bits (81), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 45  DFTLIDVLDETAHKKAIRSVAWRPHTSL--LAAGSFDSTVSIWAKEESA-DRTFEMDL-L 100
           +F   +VL     K+ +  + + P   L  LA G F   + IW   E+  DR F   +  
Sbjct: 83  NFKTRNVLHHFNFKEKVYDLKFSPDGKLFALACGRF---LQIWRTPETTEDRQFAPFVRY 139

Query: 101 AIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETD 137
            I  GH +++  + WS D  ++ + S+D +  IW  +
Sbjct: 140 RIHAGHFSDITSLTWSKDSRFIISTSKDLTARIWSVN 176

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 83/194 (42%), Gaps = 22/194 (11%)

Query: 7   IKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAW 66
           I+  K + + + +  F+  +L TGS D  + +    +D FT   +   T H   ++++ +
Sbjct: 327 IQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAI----WDLFTGKLIRRLTGHSDGVKTLYF 382

Query: 67  RPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCS 126
                 L  GS D T+ +W            + ++   GH + V  V   +    + + S
Sbjct: 383 DDQK--LITGSLDKTIRVW-------NYITGECISTYRGHTDSVMSV--DSHKKIIVSGS 431

Query: 127 RDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDD 186
            DK+V +W      E   C + L+ H++ V  V  HP      S S D T+R+W    + 
Sbjct: 432 ADKTVKVWHV----ESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTN- 485

Query: 187 WECVAVLNGHEGTV 200
             C+ V  GH G V
Sbjct: 486 -TCLRVFRGHVGQV 498

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/266 (21%), Positives = 97/266 (36%), Gaps = 69/266 (25%)

Query: 6   LIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVA 65
           LI+ L  + + + +  F    L TGS D+ I++    ++  T   +     H  ++ SV 
Sbjct: 366 LIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRV----WNYITGECISTYRGHTDSVMSVD 421

Query: 66  WRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATC 125
              H  ++ +GS D TV +W  E     T        ++GH   V  V      +   +C
Sbjct: 422 --SHKKIIVSGSADKTVKVWHVESRTCYT--------LKGHTEWVNCVKLHPKSFSCYSC 471

Query: 126 SRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIW------------------------ 161
           S D ++ +W+   +     C+ V + H   V+ VI                         
Sbjct: 472 SDDTTIRMWDIRTN----TCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIAS 527

Query: 162 ---------------------HPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTV 200
                                 P    L S + D+T+++W+       C+    GH   V
Sbjct: 528 NGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRS--GRCIRTQFGHVEGV 585

Query: 201 WSSDFDKTEGVFRLCSGSDDSTVRVW 226
           W    D     FR+ SGS D ++++W
Sbjct: 586 WDIAADN----FRIISGSHDGSIKIW 607

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 57/128 (44%), Gaps = 13/128 (10%)

Query: 100 LAIIEGHENEVKGVAWSNDGYYLA-TCSRDKSVWIWETDESGEEYECISVLQEHSQDVKH 158
           L  I+  +  + GV      Y L  T S D +V IW+        + I  L  HS  VK 
Sbjct: 324 LCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTG----KLIRRLTGHSDGVKT 379

Query: 159 VIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGS 218
           + +   +  L + S D T+R+W       EC++   GH  +V S D  K   V    SGS
Sbjct: 380 LYF--DDQKLITGSLDKTIRVWNYIT--GECISTYRGHTDSVMSVDSHKKIIV----SGS 431

Query: 219 DDSTVRVW 226
            D TV+VW
Sbjct: 432 ADKTVKVW 439

 Score = 35.8 bits (81), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 167 LLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           LL + SYD TV IW  +    + +  L GH   V +  FD      +L +GS D T+RVW
Sbjct: 346 LLFTGSYDTTVAIWDLFT--GKLIRRLTGHSDGVKTLYFDDQ----KLITGSLDKTIRVW 399

Query: 227 KYM 229
            Y+
Sbjct: 400 NYI 402

>Kwal_14.1710
          Length = 574

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 101/239 (42%), Gaps = 30/239 (12%)

Query: 16  KIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAA 75
           +I S  + + ++ATGS   +I +  V+  +  ++   +E  HK  +  +A+RP    LA+
Sbjct: 323 RIGSQSWLETLIATGSKSGEIHINDVRIKNH-IVSTWEE--HKGEVCGIAYRPDGLQLAS 379

Query: 76  GSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSND-GYYLATC--SRDKSVW 132
           GS D+TV+IW    S  +        I   H   VK +AWS D    LAT     DK + 
Sbjct: 380 GSNDNTVAIWDTRTSLPQ-------HIKRQHTAAVKALAWSPDISNLLATGGGQTDKHIH 432

Query: 133 IWETDESGEEYECISVLQEHSQDVKHVIWHPS--------EALLASSSYDDTVRIWKDYD 184
            W T  +G     I+        V  + W  S        E +      ++ V I+ +YD
Sbjct: 433 FWNT-TTGARTGSINT----GSQVSSLHWGQSYNSNAIQREIVATGGIPENAVSIY-NYD 486

Query: 185 DDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEA 243
             ++   +++ HE  + SS       V     G  D  ++ +K   +    + + VC+ 
Sbjct: 487 TKFKVAEIVHAHEARICSSQLSPDGTVLATVGG--DENLKFYKVF-EPRRKRPQGVCDG 542

>Kwal_23.6240
          Length = 913

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 65/169 (38%), Gaps = 48/169 (28%)

Query: 104 EGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP 163
           +GH +    V +S DG  + T S D  + IW+   SG    C+   QEH+  V  + +  
Sbjct: 338 QGHFDATNAVTYSPDGSRVVTASEDGKIKIWDV-VSGF---CLVTFQEHTAAVSALAFAK 393

Query: 164 SEALLASSSYDDTVRIW-----KDYDD-------DWECVA-------------------- 191
              +L S+S D TVR W     +++          + C+A                    
Sbjct: 394 RGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHV 453

Query: 192 ----------VLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMG 230
                      L+GHEG V    F +   V  L S S D T+R+W   G
Sbjct: 454 WSVQTGQLVETLDGHEGPVSCLSFSQENSV--LASASWDKTIRIWSIFG 500

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 62/141 (43%), Gaps = 16/141 (11%)

Query: 41  VKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDS-TVSIWAKEESADRTFEMDL 99
           V+Y +F         A +     +A  P   ++ AGS DS  V +W+ +          L
Sbjct: 413 VRYRNFRTF----TAAERIQFNCLAADPSGEVVCAGSVDSFAVHVWSVQTG-------QL 461

Query: 100 LAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHV 159
           +  ++GHE  V  +++S +   LA+ S DK++ IW      ++ E + V      DV  +
Sbjct: 462 VETLDGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPLEVY----ADVLSL 517

Query: 160 IWHPSEALLASSSYDDTVRIW 180
              P    +A+++ D  +  +
Sbjct: 518 SVRPDGNEVAAATLDGQILFF 538

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 65/155 (41%), Gaps = 15/155 (9%)

Query: 27  LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWA 86
           + T S D KIK+  V    F L+   + TA   A+ ++A+     +L + S D TV  W 
Sbjct: 356 VVTASEDGKIKIWDV-VSGFCLVTFQEHTA---AVSALAFAKRGQVLFSASLDGTVRAW- 410

Query: 87  KEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDK-SVWIWETDESGEEYEC 145
                D     +          +   +A    G  +   S D  +V +W    S +  + 
Sbjct: 411 -----DLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHVW----SVQTGQL 461

Query: 146 ISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
           +  L  H   V  + +    ++LAS+S+D T+RIW
Sbjct: 462 VETLDGHEGPVSCLSFSQENSVLASASWDKTIRIW 496

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 60/145 (41%), Gaps = 15/145 (10%)

Query: 5   NLIKSLKLYKEKIWSFDF--SQGILATGSTDRKIKLVSVKYD------DFTLIDVLDETA 56
           N +    L   K ++F++   + +       +   L+SV  D      +F    VL    
Sbjct: 35  NRVSVFDLIHNKSYTFEYEHRKNVQCVALNPQGTLLLSVDEDGRAILVNFRAKTVLHHFN 94

Query: 57  HKKAIRSVAWRPHTSL--LAAGSFDSTVSIWAKEESA-DRTFEMDLLAIIE-GHENEVKG 112
            K+ +  + + P   +  +A G F   V +W   + A DR F   +   +  GH + +  
Sbjct: 95  FKEPVSDLKFSPDGKVFAIACGRF---VQVWKTPDVAEDRQFAPFVRHRVHAGHFSNIIS 151

Query: 113 VAWSNDGYYLATCSRDKSVWIWETD 137
           + WS D  +L + S+D +  IW  D
Sbjct: 152 LTWSRDSRFLISTSKDLTARIWSLD 176

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 97/218 (44%), Gaps = 24/218 (11%)

Query: 78  FDSTVSIWAKE---ESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIW 134
            D+ V I AK    +  D   +  +++  E H +EV G+ +  DG  LA+   D +V IW
Sbjct: 315 LDTVVCIGAKSGEIQVNDVRVKDHIVSTWEKHTSEVCGIKFRQDGLQLASGGNDNTVMIW 374

Query: 135 ETDESGEEYECISVLQEHSQDVKHVIWHPSEA-LLAS--SSYDDTVRIWKDYDDDWECVA 191
           +T +     E + V + H+  VK + WHP    LLA+   S D  +  W +        +
Sbjct: 375 DTRQD----EPLWVKRNHNAAVKAITWHPDVVNLLATGGGSLDRHIHFW-NTTTGARIGS 429

Query: 192 VLNGHEGTV--WSSDFDKTEGVFRLCS--GSDDSTVRVWKYMGDDEDDQQEWVCEAILPD 247
           +  G + +   W   ++ +     + +  GS D+++ ++ Y      D +  V E  +  
Sbjct: 430 INTGSQVSSLHWGQSYEDSHMNREIVATGGSPDNSISIYNY------DSKVKVAE--ITQ 481

Query: 248 VHKRQVYNVAWGFNG-LIASVGADGVLAVYEEVDGEWK 284
            H+ ++ +     +G  IA+VG D  L  Y   D + K
Sbjct: 482 AHESRIVSSQLSPDGTTIATVGGDENLKFYRVFDAKRK 519

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 60/160 (37%), Gaps = 24/160 (15%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H   +  + +R     LA+G  D+TV IW        T + + L +   H   VK + W 
Sbjct: 346 HTSEVCGIKFRQDGLQLASGGNDNTVMIWD-------TRQDEPLWVKRNHNAAVKAITWH 398

Query: 117 NDGYYLATC---SRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPS--------E 165
            D   L      S D+ +  W T         I  +   SQ V  + W  S        E
Sbjct: 399 PDVVNLLATGGGSLDRHIHFWNTTTGAR----IGSINTGSQ-VSSLHWGQSYEDSHMNRE 453

Query: 166 ALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDF 205
            +    S D+++ I+ +YD   +   +   HE  + SS  
Sbjct: 454 IVATGGSPDNSISIY-NYDSKVKVAEITQAHESRIVSSQL 492

>YIR012W (SQT1) [2677] chr9 (378483..379778) Protein that may be
           required for ribosomal assembly, contains WD (WD-40)
           repeats [1296 bp, 431 aa]
          Length = 431

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/244 (19%), Positives = 101/244 (41%), Gaps = 35/244 (14%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H  ++ ++   P+  L+  G  D+   +W       +         + G+   V   +++
Sbjct: 64  HTDSVFAIGHHPNLPLVCTGGGDNLAHLWTSHSQPPK-----FAGTLTGYGESVISCSFT 118

Query: 117 NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIW---HPSEA-LLASSS 172
           ++G +L T      V +    + G +++  S +QE    V+ ++W   HP+ A   A  +
Sbjct: 119 SEGGFLVTADMSGKVLVHMGQKGGAQWKLASQMQE----VEEIVWLKTHPTIARTFAFGA 174

Query: 173 YDDTVRIWKDYDDDWECVAVLNG--HEGTVWSSDF---DKTEGVFRLCSGSDDSTVRVWK 227
            D +V  ++  + D     +++G  H+      +F   DK E    L + S DST+  W 
Sbjct: 175 TDGSVWCYQINEQDGSLEQLMSGFVHQQDCSMGEFINTDKGENTLELVTCSLDSTIVAWN 234

Query: 228 -YMGDD---------EDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYE 277
            + G           +  +  W+  ++ P+   +       G +G++A    +G+LAV  
Sbjct: 235 CFTGQQLFKITQAEIKGLEAPWISLSLAPETLTK-------GNSGVVACGSNNGLLAVIN 287

Query: 278 EVDG 281
             +G
Sbjct: 288 CNNG 291

>Kwal_27.11126
          Length = 996

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 110/234 (47%), Gaps = 33/234 (14%)

Query: 106 HENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSE 165
           HE  +  V  S +G Y A+CS D+S+ +W+  +SG   + +S    H+  + ++++  ++
Sbjct: 180 HEGAIFFVTASKNGKYAASCSDDRSIKLWDL-KSG---QLLSTAWGHTARIWNLLFFDND 235

Query: 166 ALLASSSYDDTVRIWKDYDDDWECVAVLNGHEG----TVWSSDFDKTEGVFRLCSGSDD- 220
           + + S S D T R+W   +D+    A +  HEG    +VW  D D  E +    SG+D  
Sbjct: 236 SKVISVSEDCTCRVWDISEDNTLSQASV--HEGHLLKSVWGLDVDN-ERMIAATSGNDGR 292

Query: 221 ---STVRVWKYMGDD------EDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADG 271
              + ++    +GD+      ED +   V  A+ P   K  +    W   GLIA + ++G
Sbjct: 293 IKLTDLKAKSRVGDETMSSSLEDIEAAGV--AMKP---KEIIKGFHWFKFGLIA-MTSEG 346

Query: 272 VLAVYEEVDGEW------KVFAKRALCHGVYEINVVKWLELNGKTILATGGDDG 319
            +  +E+   +W        F+  ++  G+ E+N++ +       ++    DDG
Sbjct: 347 QVLKFEQSSKKWSSILNDSTFSNYSITAGLQELNLIVFCSSQCDLLVIKFNDDG 400

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 104/242 (42%), Gaps = 50/242 (20%)

Query: 20  FD-FSQGILATGSTDRKIKLVSVKYDDFTLIDVLDE-------------TAHKKAIRSVA 65
           FD F+   +A+GS D KI +  +  +++   D +DE             T H + +  V 
Sbjct: 89  FDPFNDHRIASGSDDSKIGIWDIP-ENYKFHDHVDEDGEPIDIKPVKFLTGHARKVGHVL 147

Query: 66  WRP-HTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLAT 124
           + P   ++LA+ S D TV +W  E   D         I   H + V  +++S DG YLAT
Sbjct: 148 YHPVAENVLASSSGDYTVKLWNVETGKD--------MITLKHPDMVTSMSFSYDGNYLAT 199

Query: 125 CSRDKSVWIWETDESGEEYECISVLQEHS-QDVKHVIWHPSEALLASSSY----DDTVRI 179
            +RDK + +W       E + +S    H+    + V+W  +   LA++ +    D  + I
Sbjct: 200 VARDKKLRVWNI----REEKIVSEGPAHTGAKNQRVVWLGNSDRLATTGFSKLSDRQIGI 255

Query: 180 WKDYDDDWECVAVLNGHEGTVWSSD---------FDKTEGVFRLCSGSDDSTVRVWKYMG 230
           W  ++       +  G  G  ++ D         +D+   +  L  G  D  +R +++  
Sbjct: 256 WDAFN-------IEKGDLGGFYTVDQSSGILMPFYDEGNKILYLV-GKGDGNIRYYEFQN 307

Query: 231 DD 232
           D+
Sbjct: 308 DE 309

>Scas_680.11
          Length = 347

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 6/81 (7%)

Query: 148 VLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDK 207
           VL  H + +  V ++    LL S S D+   +W  Y  + E +  LNGH GT+WS D DK
Sbjct: 5   VLMGHERPLTQVKYNREGDLLFSCSKDNFASVW--YSVNGERLGTLNGHAGTIWSIDVDK 62

Query: 208 -TEGVFRLCSGSDDSTVRVWK 227
            TE      +GS D ++++WK
Sbjct: 63  FTE---YCVTGSADYSIKMWK 80

>Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement
          Length = 555

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 103/237 (43%), Gaps = 24/237 (10%)

Query: 7   IKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAW 66
           I++L  + +++    ++  IL +GS DRKI    V+  +     V  ET H + +  + W
Sbjct: 326 IRTLSGHMDRVACLSWNNHILTSGSRDRKILHRDVRMPEPYFEQV--ET-HTQEVCGLKW 382

Query: 67  RPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY-YLAT- 124
               + LA+G  D+ V ++      D T     L + E H   VK +AWS      LAT 
Sbjct: 383 NTDENRLASGGNDNVVYVY------DGTSRKPTLKLAE-HTAAVKAIAWSPHKRGILATG 435

Query: 125 -CSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-SEALLASSSYDD-TVRIWK 181
             + DK + IW  + S +  +      +    V ++IW   +  L+ S  Y    + +W 
Sbjct: 436 GGTADKKMKIWNVNTSTKLRDI-----DTGSQVCNMIWSKNTNELVTSHGYSRYNLTLW- 489

Query: 182 DYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQE 238
           DY    E VA+L GH   V        +G   + SG+ D T+R WK     +   Q 
Sbjct: 490 DY-PSMEPVAILKGHSFRVLHLTLS-ADGTT-VVSGAGDETLRYWKLFDRPKPKAQP 543

>CAGL0L06952g complement(780793..781836) highly similar to sp|P40217
           Saccharomyces cerevisiae YMR146c TIF34 translation
           initiation factor eIF3, start by similarity
          Length = 347

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 49/101 (48%), Gaps = 6/101 (5%)

Query: 148 VLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDK 207
           VL  H + +  V ++    LL + S D +  +W  Y ++ E +  L+GH G++WS D D 
Sbjct: 5   VLMGHERPLTQVKYNREGDLLFTCSKDISASVW--YSNNGERLGTLDGHMGSIWSIDSDH 62

Query: 208 TEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDV 248
           T       +GS D T++VW  M  +    Q W C   +  V
Sbjct: 63  TS--LYCVTGSADYTIKVWTLM--NGQCVQTWNCPVPVKRV 99

>YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protein
           containing five WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           low similarity to a region of S. pombe Tup11p, which is
           a transcriptional repressor functioning redundantly with
           Tup12p [3042 bp, 1013 aa]
          Length = 1013

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 75/323 (23%), Positives = 143/323 (44%), Gaps = 50/323 (15%)

Query: 12  LYKEKIWSFDFSQGILATGST----DRKIKLVSVKYDDFTLIDVLDETAHKKAI---RSV 64
           L KE +  F+       TG+T    + +I L++  Y+   + D+  E   +K++   RS+
Sbjct: 78  LKKESLVDFERINSDWITGATFSFDNLQIYLLTC-YNKVLICDLNCEVLFRKSLGGERSI 136

Query: 65  AWR-------PHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSN 117
            +        P    + AG+    V IW         F    +  + GHE  +  V  SN
Sbjct: 137 LYSGIIKVFGPDKVYVNAGTVMGGVIIW-------DLFSETKIHNLLGHEGSIFYVNLSN 189

Query: 118 DGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTV 177
           +G Y+A+CS D+S+ +W+  E+G++   +SV   H+  + ++++  +++ L S S D T 
Sbjct: 190 NGRYVASCSDDRSIRLWDL-ETGKQ---LSVGWSHTARIWNLMFFDNDSKLISVSEDCTC 245

Query: 178 RIWK--DYDDDWECVAVLNGHE----GTVWSSDFDKTEGVFRLCSGSDDSTVRV----WK 227
           R+W   +  ++   +++ N +E     ++W  D  K + +  + SG+D     +     K
Sbjct: 246 RVWNIIESRENVAELSISNVYEVHLIKSIWGVDV-KDDEMIAVTSGNDGRLKLIDLLQLK 304

Query: 228 YMGDDED----DQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEW 283
             GD+E     D     C  I        +    W   G+IA + + G +  Y +V  +W
Sbjct: 305 RHGDEETSFSLDDIAKQCGDIFE--KNESIKGFQWFSFGVIA-ITSLGKILKYSDVTKQW 361

Query: 284 KV------FAKRALCHGVYEINV 300
           K+      F    + +G+   N+
Sbjct: 362 KLLLTNEKFNSYPITNGIQTQNI 384

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 67/154 (43%), Gaps = 15/154 (9%)

Query: 73  LAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVW 132
            A GS D T+ IW             L   ++ H+  V+ +A SN   Y+ + S DK+V 
Sbjct: 131 FATGSNDKTIKIWNLASGK-------LKVTLKAHDMTVRDLAISNRHPYMFSVSEDKTVK 183

Query: 133 IWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAV 192
            W+     E+   I     H   V  V  HP+  ++ ++  D  V++W D       V  
Sbjct: 184 CWDL----EKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVW-DIRTRLP-VMT 237

Query: 193 LNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           L GH+G +        +   ++ S S D+++R+W
Sbjct: 238 LPGHKGPITKVRCLPVDP--QVISSSVDASIRLW 269

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 57/131 (43%), Gaps = 13/131 (9%)

Query: 99  LLAIIEGHENEVKGVAWSN-DGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVK 157
           L  +I GH   V+ +A    D  + AT S DK++ IW    SG   +    L+ H   V+
Sbjct: 107 LTRVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNL-ASG---KLKVTLKAHDMTVR 162

Query: 158 HVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLN--GHEGTVWSSDFDKTEGVFRLC 215
            +        + S S D TV+ W    D  +  A+ N  GH   V + D   T  V  + 
Sbjct: 163 DLAISNRHPYMFSVSEDKTVKCW----DLEKNTAIRNYHGHLSGVHTVDIHPTVDV--VV 216

Query: 216 SGSDDSTVRVW 226
           +   DS V+VW
Sbjct: 217 TAGRDSVVKVW 227

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 79/182 (43%), Gaps = 38/182 (20%)

Query: 71  SLLAAGSFDSTVSIWAKEESADRTFE---MDLLAIIEGHENEVKGVAWSNDGYYLATCSR 127
           +++A GS D+TV +W   +   R  E    + L  ++ H +EV  +    DG  L T S+
Sbjct: 460 NMVATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAHLDEVSSLYI--DGANLMTASQ 517

Query: 128 DKSVWIWETDESGEEYECISVL-----------------QEHSQDVKHV------IWHPS 164
           DK++  W+   SG+   CI V                   E S  +K V           
Sbjct: 518 DKTIRRWDL-YSGK---CIQVFDVNFPSLSAYKSSFMKSNEDSMILKTVNTPIIGSIQSF 573

Query: 165 EALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVR 224
           +A LA+ + D  +R+W       E V VL GH   + S  FD T     + SGS D T+R
Sbjct: 574 DAALATGTKDGLIRLWDMRT--GEVVRVLEGHMDAITSLKFDATT----IISGSLDGTIR 627

Query: 225 VW 226
           +W
Sbjct: 628 LW 629

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 84/199 (42%), Gaps = 39/199 (19%)

Query: 56  AHKKAIRSVAWRPH-TSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
           AH  AI  + + PH ++L  AG  D  V +W      D T +  + A+ EGH   +  + 
Sbjct: 402 AHDDAITCLDFDPHFSTLCTAGYMDHIVKLW------DYTKKRQIGAM-EGHVATISCMQ 454

Query: 115 WSNDGYYLATCSRDKSVWIWETD------ESGEEYECISVLQEHSQDVKHVIWHPSEALL 168
              +   +AT S+D +V +W  +      E G   E +  L  H  +V  +  +   A L
Sbjct: 455 VDKNYNMVATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAHLDEVSSL--YIDGANL 512

Query: 169 ASSSYDDTVRIWKDYDDDWECVAV--LNGHEGTVWSSDFDKTE--------------GVF 212
            ++S D T+R W  Y    +C+ V  +N    + + S F K+               G  
Sbjct: 513 MTASQDKTIRRWDLY--SGKCIQVFDVNFPSLSAYKSSFMKSNEDSMILKTVNTPIIGSI 570

Query: 213 R-----LCSGSDDSTVRVW 226
           +     L +G+ D  +R+W
Sbjct: 571 QSFDAALATGTKDGLIRLW 589

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/255 (22%), Positives = 109/255 (42%), Gaps = 31/255 (12%)

Query: 79  DSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDE 138
           D+ +   +K  +   +  +  +  ++GH N+V    WS+D   + + S+D  + +W+   
Sbjct: 99  DADLQSLSKNVAPITSVNLKPVTTLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDA-A 157

Query: 139 SGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDD---WECVAVLNG 195
           +G +   I +   HSQ V      P+  L+AS+  D+   I++    D      V++  G
Sbjct: 158 TGLKSNAIPL---HSQWVLSCAICPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKG 214

Query: 196 HEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW-----KYMGDDEDDQQEWVCEAILPDVHK 250
           H   +   +F     +    + S D T  +W     K + +  D   + +  +  P   +
Sbjct: 215 HTCYISEIEFLDDNSIL---TASGDMTCALWDITKSKRINEFADHLGDVLSLSAAPTETE 271

Query: 251 RQVYNVAWGFNGLIASVGADGVLAVYEE-VDGEWKVFAKRALCHGVYEINVVKWLELNGK 309
                   G   + AS G+DG L ++++ V    + F          +++ VK+   NG 
Sbjct: 272 --------GNGNVFASGGSDGYLYIWDKRVPTSVQSFFVSD-----SDVSKVKFFR-NGN 317

Query: 310 TILATGGDDGIVNFW 324
           TI ATG DDG  N +
Sbjct: 318 TI-ATGSDDGCTNLY 331

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 23/38 (60%)

Query: 98  DLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWE 135
           +++  ++GH + + GVA S DG  + T S D ++ +W 
Sbjct: 426 EIIGKLDGHSDRISGVATSPDGLAICTGSWDMTMKVWS 463

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 70/184 (38%), Gaps = 48/184 (26%)

Query: 104 EGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP 163
           +GH +    + +S DG  + T + D  + +W+   SG    C++  +EH+  V  V +  
Sbjct: 338 QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDV-ASGF---CLATFEEHTSAVTAVQFAK 393

Query: 164 SEALLASSSYDDTVRIWK--DYDD----------DWECVAV------------------- 192
              +L S+S D TVR W    Y +           + C+AV                   
Sbjct: 394 KGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEVVSAGSTDSFDVFV 453

Query: 193 -----------LNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVC 241
                      L+GHEG V    F     V  L S S D T+R+W   G  +  +   V 
Sbjct: 454 WSVQTGQLLDTLSGHEGPVSCLAFSMENAV--LASASWDKTIRIWSIFGRSQQVEPLEVF 511

Query: 242 EAIL 245
             IL
Sbjct: 512 ADIL 515

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 60/129 (46%), Gaps = 9/129 (6%)

Query: 113 VAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQE-----HSQDVKHVIWHPSEAL 167
           V +S DG Y A  +  + + IW+T +  ++ +    ++      H QD+    W      
Sbjct: 102 VKFSPDGRYFA-LAVGRFLQIWKTPDVSQDRQFAPFVRYRVHAGHFQDITSFTWSHDSRF 160

Query: 168 LASSSYDDTVRIWKDYDDDWECVA-VLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           L ++S D T R+W    +D E VA  L GH   V  + F+ T+   ++ + S D  V  W
Sbjct: 161 LLTTSKDLTSRVWSINSEDKELVATTLAGHRDYVLGAYFNSTQE--KIYTISKDGAVFTW 218

Query: 227 KYMGDDEDD 235
           +Y+   + +
Sbjct: 219 EYISKAQKE 227

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 77/175 (44%), Gaps = 15/175 (8%)

Query: 13  YKEKIWSFDFS-QG-ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRP-- 68
           +++ I +FD + QG +L +  TD +  LV     +F   +VL     K    SV + P  
Sbjct: 54  HRKNIATFDVNKQGTLLLSVDTDGRAILV-----NFKTRNVLHHFNFKDKCYSVKFSPDG 108

Query: 69  HTSLLAAGSFDSTVSIWAKEE-SADRTFEMDL-LAIIEGHENEVKGVAWSNDGYYLATCS 126
               LA G F   + IW   + S DR F   +   +  GH  ++    WS+D  +L T S
Sbjct: 109 RYFALAVGRF---LQIWKTPDVSQDRQFAPFVRYRVHAGHFQDITSFTWSHDSRFLLTTS 165

Query: 127 RDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWK 181
           +D +  +W  +   +E    + L  H   V    ++ ++  + + S D  V  W+
Sbjct: 166 KDLTSRVWSINSEDKEL-VATTLAGHRDYVLGAYFNSTQEKIYTISKDGAVFTWE 219

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 57/125 (45%), Gaps = 17/125 (13%)

Query: 41  VKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDST-VSIWAKEESADRTFEMDL 99
           ++Y +F +    +    +     +A  P   +++AGS DS  V +W+ +          L
Sbjct: 413 IRYRNFRVFTATE----RVQFTCLAVEPSGEVVSAGSTDSFDVFVWSVQTG-------QL 461

Query: 100 LAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQE-----HSQ 154
           L  + GHE  V  +A+S +   LA+ S DK++ IW      ++ E + V  +      + 
Sbjct: 462 LDTLSGHEGPVSCLAFSMENAVLASASWDKTIRIWSIFGRSQQVEPLEVFADILAITITP 521

Query: 155 DVKHV 159
           D KHV
Sbjct: 522 DGKHV 526

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 61/173 (35%), Gaps = 47/173 (27%)

Query: 51  VLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEV 110
           +L +  H  A  S+ + P  S +   + D  + +W              LA  E H + V
Sbjct: 334 ILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGF-------CLATFEEHTSAV 386

Query: 111 KGVAWSNDGYYLATCSRDKSVWIWE----------TDESGEEYECISV------------ 148
             V ++  G  L + S D +V  W+          T     ++ C++V            
Sbjct: 387 TAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEVVSAGST 446

Query: 149 ------------------LQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDY 183
                             L  H   V  + +    A+LAS+S+D T+RIW  +
Sbjct: 447 DSFDVFVWSVQTGQLLDTLSGHEGPVSCLAFSMENAVLASASWDKTIRIWSIF 499

>AGR242C [4553] [Homologous to ScYIR012W (SQT1) - SH]
           (1203152..1204411) [1260 bp, 419 aa]
          Length = 419

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 95/239 (39%), Gaps = 42/239 (17%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H  ++ +VA  P   L+ +G  D+   +W       R         +E H   V G A++
Sbjct: 59  HTDSVFTVAAHPKLPLVVSGGGDNKAHLWTTHREPPRE-----AGSVE-HSESVIGAAFT 112

Query: 117 NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIW---HPSEA-LLASSS 172
            DG YL T   +  V +      G+E+   + LQE    V  V W   HP  A + A  +
Sbjct: 113 ADGRYLVTADMNGQVRVQVAARQGQEWRPAAELQE----VDEVTWLKVHPHRAGIFAIGA 168

Query: 173 YDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTV--------- 223
            D +V  ++    +   V ++ G      +   D T GVF L + +DD  V         
Sbjct: 169 VDGSVWCYEMDTQNNTPVLLMTG-----VAHAQDCTMGVF-LETAADDENVILVTCSLDG 222

Query: 224 -----------RVWKYMGDDEDDQQ-EWVCEAILPDVHKRQVYNVAWGFN-GLIASVGA 269
                      +V+K    +   Q+ +W+  + LP    R    VA G N GL+A + A
Sbjct: 223 TIIGWNCYSGQQVFKVTPSELKGQEAQWITLSTLPLGINRGSPIVACGSNSGLLAVINA 281

>Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement
          Length = 263

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 82/180 (45%), Gaps = 19/180 (10%)

Query: 8   KSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWR 67
           KS KL +     +     +LA G  D  IK+    +D  +   +++   HK AI  + + 
Sbjct: 71  KSTKLAESTYLQYHPETNLLAVGYADGVIKI----WDLISKTVLINFNGHKSAITVLRFD 126

Query: 68  PHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSR 127
           P  + L +GS DS + IW      D   E+ L   +  H++ + G+ W  +  +L + S+
Sbjct: 127 PTGTRLISGSKDSDIIIW------DLVGEVGLYK-LRSHKDSITGI-WCENEDWLISTSK 178

Query: 128 DKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWK-DYDDD 186
           D  + IW+     +  +C+     H+ +   +  H    L+ ++S +  ++IW  D D D
Sbjct: 179 DGLIKIWDL----KTQQCVETHMAHTSECWGLAIH--NDLVITTSTESQIKIWNLDLDKD 232

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 4/74 (5%)

Query: 158 HVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSG 217
           ++ +HP   LLA    D  ++IW         +   NGH+  +    FD T    RL SG
Sbjct: 80  YLQYHPETNLLAVGYADGVIKIWDLISK--TVLINFNGHKSAITVLRFDPTG--TRLISG 135

Query: 218 SDDSTVRVWKYMGD 231
           S DS + +W  +G+
Sbjct: 136 SKDSDIIIWDLVGE 149

>YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing
           five WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has a region of low
           similarity to a region of S. cerevisiae Sec27p, which a
           coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles [3447 bp, 1148 aa]
          Length = 1148

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 40/171 (23%), Positives = 72/171 (42%), Gaps = 12/171 (7%)

Query: 61  IRSVAWRPHTS--LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS-N 117
           +  V W PH +       + +    IW   +S+    E     ++ GH   +  + ++  
Sbjct: 70  VADVQWSPHPAKPYWIVSTSNQKAIIWNLAKSSSNAIEF----VLHGHSRAITDINFNPQ 125

Query: 118 DGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTV 177
               LATCS D  V  W+       +   S  +  +  VK   W+  +  + +SS+ + +
Sbjct: 126 HPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVK---WNYKDPNVLASSHGNDI 182

Query: 178 RIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKY 228
            +W D       +  L GH  +V S DF++ +    + S S+D TV+ W Y
Sbjct: 183 FVW-DLRKGSTPLCSLKGHVSSVNSIDFNRFK-YSEIMSSSNDGTVKFWDY 231

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 89/229 (38%), Gaps = 24/229 (10%)

Query: 5   NLIKSLKLYKEKIWSFDFSQGI--LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIR 62
           N + S + ++  + S  F Q    + T S D  IK+  ++        V     H   + 
Sbjct: 66  NPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPS-----VPRNYKHNAPVN 120

Query: 63  SVAWRPHTSLLAAGSFDSTVSIWAKEESA---DRTFEMDLLAIIEGHENEVKGVAWSNDG 119
            V   P+   L +   D  + IW   E+      T E D+          ++ ++ ++DG
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDV---------PLQSLSVASDG 171

Query: 120 YYLATCSRDKSVWIWETDES--GEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTV 177
             L   +   + ++WE          +  +  + H   +  V+       +A+ S D T 
Sbjct: 172 SMLVAANNKGNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCSADHTA 231

Query: 178 RIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           RIW   +D++   + L+GH+  VW   F        L + S D  VR+W
Sbjct: 232 RIWS-VEDNFNLESTLDGHQRWVWDCAFSADSAY--LVTASSDHYVRLW 277

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 41/88 (46%), Gaps = 5/88 (5%)

Query: 93  RTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEH 152
           +T   + +A  EGH   V  V++  D  ++ T S D ++ +W+          +    +H
Sbjct: 61  KTSNSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPS-----VPRNYKH 115

Query: 153 SQDVKHVIWHPSEALLASSSYDDTVRIW 180
           +  V  V+ HP++  L S   D  +RIW
Sbjct: 116 NAPVNEVVIHPNQGELISCDRDGNIRIW 143

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 6/80 (7%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           AH   I  V        +A  S D T  IW+ E++       +L + ++GH+  V   A+
Sbjct: 205 AHPSYITRVLLSSDVKHMATCSADHTARIWSVEDN------FNLESTLDGHQRWVWDCAF 258

Query: 116 SNDGYYLATCSRDKSVWIWE 135
           S D  YL T S D  V +W+
Sbjct: 259 SADSAYLVTASSDHYVRLWD 278

>Kwal_0.212
          Length = 303

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/226 (20%), Positives = 92/226 (40%), Gaps = 18/226 (7%)

Query: 5   NLIKSLKLYKEKIWSFDFSQGI--LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIR 62
           N + S + ++  + S  F Q    + + S D  IK+  V+        V     H+ A+ 
Sbjct: 66  NPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPS-----VQRNYKHQAAVN 120

Query: 63  SVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYL 122
            V   P+   L +   D  V IW   E+        +  +    +  ++ ++ ++DG  L
Sbjct: 121 EVVIHPNQGELISCDQDGNVRIWDLGEN------QCVHQLAPEDDTPLQSLSVASDGSML 174

Query: 123 ATCSRDKSVWIWETDESGE--EYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
              +   + ++W+     +    + ++  + H++ +  V+       LA+ S D T R+W
Sbjct: 175 VAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVW 234

Query: 181 KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
              DD+++    L+ H+  VW   F        L +   D  VR+W
Sbjct: 235 S-IDDNFQLETTLDNHQRWVWDCAFSADSAY--LVTACSDHYVRLW 277

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 60/135 (44%), Gaps = 8/135 (5%)

Query: 93  RTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEH 152
           RT   + +   EGH   V  +A+  +  ++ + S D ++ +W+      +        +H
Sbjct: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRN-----YKH 115

Query: 153 SQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVF 212
              V  V+ HP++  L S   D  VRIW D  ++ +CV  L   + T   S    ++G  
Sbjct: 116 QAAVNEVVIHPNQGELISCDQDGNVRIW-DLGEN-QCVHQLAPEDDTPLQSLSVASDGSM 173

Query: 213 RLCSGSDDSTVRVWK 227
            L +G++     VW+
Sbjct: 174 -LVAGNNKGNCYVWQ 187

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 6/80 (7%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           +H K I  V        LA  S D T  +W    S D  F+++    ++ H+  V   A+
Sbjct: 205 SHAKYITRVLLSSDVKHLATCSADHTARVW----SIDDNFQLE--TTLDNHQRWVWDCAF 258

Query: 116 SNDGYYLATCSRDKSVWIWE 135
           S D  YL T   D  V +W+
Sbjct: 259 SADSAYLVTACSDHYVRLWD 278

>CAGL0J06512g complement(620516..622153) similar to sp|Q04199
           Saccharomyces cerevisiae YML102w CAC2, start by
           similarity
          Length = 545

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 64/148 (43%), Gaps = 27/148 (18%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIW--AKEESADRTFEM----------------- 97
           H++A+  + +    ++LA+   D  V +W    EE+  +   M                 
Sbjct: 79  HEQAVNVIRFDHRGNVLASAGDDGQVLLWKLTNEETRKKQQRMGDEPVEGDGWAVWKRLR 138

Query: 98  ----DLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHS 153
               DL  +  G  +E+  ++WS D  YL T S D S+ ++  D       C++  ++H+
Sbjct: 139 GTANDLDNMPGGGASEIYDLSWSPDDKYLVTASMDNSLKVFNVDTGN----CVAFAKDHN 194

Query: 154 QDVKHVIWHPSEALLASSSYDDTVRIWK 181
             V+ V W P    + S S D ++ I++
Sbjct: 195 HYVQGVTWDPLNQYIISQSVDRSINIYE 222

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 59/135 (43%), Gaps = 8/135 (5%)

Query: 93  RTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEH 152
           RT   + +   EGH   V  +A+  D  ++ + S D ++ +W+      +        +H
Sbjct: 61  RTTNPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRN-----YKH 115

Query: 153 SQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVF 212
              V  V+ HP++  L S   D  ++IW D  ++ +C   L   + T   S    ++G  
Sbjct: 116 DAPVNEVVIHPNQGELISCDQDGNIKIW-DLGEN-QCTNQLALEDNTALQSLSIASDGSM 173

Query: 213 RLCSGSDDSTVRVWK 227
            L +G++     VWK
Sbjct: 174 -LVAGNNKGNCYVWK 187

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 69/158 (43%), Gaps = 7/158 (4%)

Query: 23  SQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTV 82
           +QG L +   D  IK+  +  +  T    L++     A++S++     S+L AG+     
Sbjct: 127 NQGELISCDQDGNIKIWDLGENQCTNQLALEDNT---ALQSLSIASDGSMLVAGNNKGNC 183

Query: 83  SIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEE 142
            +W      D T  +  +     H   +  V  S D  +LATCS D +  +W  +++   
Sbjct: 184 YVWKMPNHTD-TASLKPVTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWSVEDN--- 239

Query: 143 YECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
           ++  + L  HS+ V    +    A L ++  D  VR+W
Sbjct: 240 FQLETTLDAHSRWVWDCAFSADSAYLVTACSDHYVRLW 277

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/226 (20%), Positives = 91/226 (40%), Gaps = 18/226 (7%)

Query: 5   NLIKSLKLYKEKIWSFDFSQGI--LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIR 62
           N + S + ++  + S  F Q    + + S D  IK+  V+        V     H   + 
Sbjct: 66  NPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPS-----VQRNYKHDAPVN 120

Query: 63  SVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYL 122
            V   P+   L +   D  + IW   E+       + LA+ +     ++ ++ ++DG  L
Sbjct: 121 EVVIHPNQGELISCDQDGNIKIWDLGENQ----CTNQLALEDN--TALQSLSIASDGSML 174

Query: 123 ATCSRDKSVWIWETDESGE--EYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
              +   + ++W+     +    + ++  + HS+ +  V+       LA+ S D T R+W
Sbjct: 175 VAGNNKGNCYVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVDVKHLATCSADHTARVW 234

Query: 181 KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
              +D+++    L+ H   VW   F        L +   D  VR+W
Sbjct: 235 S-VEDNFQLETTLDAHSRWVWDCAFSADSAY--LVTACSDHYVRLW 277

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 6/92 (6%)

Query: 44  DDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAII 103
           D  +L  V    +H K I  V        LA  S D T  +W+ E++    F+++    +
Sbjct: 193 DTASLKPVTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWSVEDN----FQLE--TTL 246

Query: 104 EGHENEVKGVAWSNDGYYLATCSRDKSVWIWE 135
           + H   V   A+S D  YL T   D  V +W+
Sbjct: 247 DAHSRWVWDCAFSADSAYLVTACSDHYVRLWD 278

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 84/194 (43%), Gaps = 37/194 (19%)

Query: 55  TAHKKAIRSVAWRPHTS-LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGV 113
           T H++ +  V + P    +LA+ S D TV +W  E+  +         I+  H + V  +
Sbjct: 137 TGHQRKVGHVLYHPTAQGVLASSSLDHTVRLWNVEQGTN--------PIVLTHPDMVTSM 188

Query: 114 AWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHS-QDVKHVIWHPSEALLASSS 172
           ++S  G YLAT  RDK + +W+  +     E +S    HS    + V+W  +   LA++ 
Sbjct: 189 SFSYGGTYLATVCRDKMLRVWDIRKG----EVVSEGMGHSGPKNQRVVWLGNSDRLATTG 244

Query: 173 Y----DDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRL----------CSGS 218
           +    D  + +W  ++       +  G  G  +  + D++ G+              +G 
Sbjct: 245 FSKLSDRQIAVWDAFN-------LEKGQLGGFY--NVDQSSGILMPFYDDSNKILYVAGK 295

Query: 219 DDSTVRVWKYMGDD 232
            D  +R +++  D+
Sbjct: 296 GDGNIRYYEFQDDE 309

>Scas_718.6*
          Length = 546

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/264 (20%), Positives = 109/264 (41%), Gaps = 18/264 (6%)

Query: 23  SQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAG-SFDST 81
           ++ +LA G  D   K++    +D  +I  L E  H  A+ S+  R    + A   S D  
Sbjct: 193 NERLLAYGQEDSMAKMIEYNKEDKKIISSL-ELRHPFALSSITGRKTNQITALSWSPDGE 251

Query: 82  VSIWAKEESADRTFEMD--LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDES 139
           + I + E    R +  D  L  +   H + +  + W+ D  +  +   D    +W     
Sbjct: 252 LIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAING 311

Query: 140 --GEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHE 197
              + +E    L+ +++ +   I    +  L     + ++ ++    DD + +  L GH+
Sbjct: 312 IILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSI--DDNKPIGKLLGHQ 369

Query: 198 GTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVA 257
           GT+   +F+    +  L S   D ++R+W         Q+E  C       H + + +++
Sbjct: 370 GTISCIEFNVNSRLL-LTSSDSDYSIRIWH-------GQKENCCNCFYG--HSQSIISLS 419

Query: 258 WGFNGLIASVGADGVLAVYEEVDG 281
           W  + L+ S   DG + ++  V+ 
Sbjct: 420 WINDDLVISASMDGSVRIWSVVEN 443

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 85/188 (45%), Gaps = 26/188 (13%)

Query: 105 GHENEVKGVAWSNDGYYLATCS-RDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP 163
           GH+  +  + ++ +   L T S  D S+ IW     G++  C +    HSQ +  + W  
Sbjct: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH----GQKENCCNCFYGHSQSIISLSW-I 421

Query: 164 SEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTV 223
           ++ L+ S+S D +VRIW   ++    +A+++G+         DK     +   GS +  +
Sbjct: 422 NDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKN----KFAIGSMNGQI 477

Query: 224 RVW---KYMGD--DEDDQQEWVCEAILPDVHKRQ-------VYNVAWG-FNGLIA---SV 267
            V+   +++      D +QE V    +P     Q       +++++W   N LI    S+
Sbjct: 478 NVYDIKRFVSRLLKRDKKQELVVPITIPLYGSYQNEKIDDCIFDISWNKSNDLITVANSI 537

Query: 268 GADGVLAV 275
           G   ++A+
Sbjct: 538 GEGSIIAI 545

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 76/187 (40%), Gaps = 29/187 (15%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H   +  + W P    +A+ S D TV +  ++        + LL  + GH   V  + ++
Sbjct: 54  HAAGVSQICWSPDGKCIASCSDDFTVVVTHRQ--------LGLLHRLVGHTAPVISLCYN 105

Query: 117 NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSE-ALLASSSYDD 175
           N G  L T S D+S+ +W+          +  +  HS+ V  +    ++ ++L+S S+D 
Sbjct: 106 NKGNLLFTSSMDESIKVWDVLTG----TVMKTMSAHSEPVVSIDLSDNDGSILSSGSHDG 161

Query: 176 TVRIWK----------DYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRV 225
            +RI+            YD DW+         G V  +    +     L   S D  V++
Sbjct: 162 LIRIFDTATGHCLKTLTYDKDWQ------SETGVVPIAKVKFSANTKYLLVKSYDGVVKI 215

Query: 226 WKYMGDD 232
           W  +  D
Sbjct: 216 WDSVSGD 222

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 61/132 (46%), Gaps = 12/132 (9%)

Query: 97  MDLLAIIE--GHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQ 154
           M++L  IE  G      GV +S DG +LA   R   V+I+ET  SG +     VL EH+ 
Sbjct: 2   MEVLKQIEIPGGGPSTCGV-FSRDGQWLAV-VRGIEVYIYET--SGYQLRETLVL-EHAA 56

Query: 155 DVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRL 214
            V  + W P    +AS S D TV +          +  L GH   V S  ++    +  L
Sbjct: 57  GVSQICWSPDGKCIASCSDDFTVVVTH---RQLGLLHRLVGHTAPVISLCYNNKGNL--L 111

Query: 215 CSGSDDSTVRVW 226
            + S D +++VW
Sbjct: 112 FTSSMDESIKVW 123

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 75/319 (23%), Positives = 122/319 (38%), Gaps = 59/319 (18%)

Query: 23  SQGILATGSTDRKIKLVSVKYDDFTLIDVLDET---AHKKAIRSVAWR---PHTSLLAAG 76
           +Q ILA G T+  + + S+  +   +  +   T    H+  I+S+ +R   P   LLA+G
Sbjct: 163 TQFILAIGGTNVNVFIYSLVSNSEGVSKLEFATKLEGHEDWIKSLVFRETVPGDYLLASG 222

Query: 77  SFDSTVSIW---------AKEE-----------------SADRTFEMDLLAIIEGHENEV 110
           S D  + +W           EE                 SAD    ++  A+I GH++ +
Sbjct: 223 SQDRYIRLWRIRTNEKIDTSEEDEKKLTLLSNKIYKFDISADVHVAINFEALIMGHDDWI 282

Query: 111 KGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHV----------- 159
             + W      L T + D +V +WE D     + C S L E S                 
Sbjct: 283 SSLQWHKTKLQLLTSTADTAVMVWEPDTISGIWICSSRLGELSSKGASTATGSSGGFWSC 342

Query: 160 IW--HPSEALLASSSYDDTVRIWKDYDD-DWECVAVLNGHEGTV----WSSDFDKTEGVF 212
           IW  H  + ++ ++    + RIW   D   W+    + G   +V    WS D +      
Sbjct: 343 IWFTHDGKDVILTNGKTGSWRIWTSTDGLLWDQELGITGATKSVTDVAWSIDGN------ 396

Query: 213 RLCSGSDDSTVRV---WKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGA 269
            L S S D T R+   WKY     + +    CE   P +H   +  V    N    S G 
Sbjct: 397 YLLSTSLDQTTRLFAEWKYETSGVERKTPSWCEMARPQIHGYDMLCVEPISNTRFVSGGD 456

Query: 270 DGVLAVYEEVDGEWKVFAK 288
           + +L  ++E     ++  K
Sbjct: 457 EKILRSFDEPKAVAQLLQK 475

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 64/151 (42%), Gaps = 5/151 (3%)

Query: 176 TVRIWKDYDDDWECV-AVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDED 234
           T+ +WK  D     V   L GH   V    F K  G   + S S+D  VRVW +    E 
Sbjct: 34  TIALWKSMDTSHHGVFKTLKGHTAEVTCVRFVK--GTDMMVSASEDFEVRVWNFPKLREG 91

Query: 235 DQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEWKVFAKRALCHG 294
              E  C  ++   H +    V      L+    ADG ++V+  ++ ++ +  + ++  G
Sbjct: 92  HMDEVECIQVIK--HHKHTITVFAVLKNLLVVGCADGSISVWSFIEDQYVLQEEFSVQKG 149

Query: 295 VYEINVVKWLELNGKTILATGGDDGIVNFWS 325
           V+ + +        + ILA GG +  V  +S
Sbjct: 150 VFPLCLSMHEIEKTQFILAIGGTNVNVFIYS 180

 Score = 35.0 bits (79), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 66/333 (19%), Positives = 128/333 (38%), Gaps = 67/333 (20%)

Query: 1   MASINLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKA 60
           M  +  I+ +K +K  I  F   + +L  G  D  I + S   D + L    +E + +K 
Sbjct: 93  MDEVECIQVIKHHKHTITVFAVLKNLLVVGCADGSISVWSFIEDQYVL---QEEFSVQKG 149

Query: 61  IRSVAWRPH-----TSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           +  +    H       +LA G  +  V I++   +++   +++    +EGHE+ +K + +
Sbjct: 150 VFPLCLSMHEIEKTQFILAIGGTNVNVFIYSLVSNSEGVSKLEFATKLEGHEDWIKSLVF 209

Query: 116 SND---GYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSS 172
                  Y LA+ S+D+ + +W    +    E I   +E  + +          LL++  
Sbjct: 210 RETVPGDYLLASGSQDRYIRLWRIRTN----EKIDTSEEDEKKL---------TLLSNKI 256

Query: 173 YDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDD 232
           Y     I  D        A++ GH+  + S  + KT+   +L + + D+ V VW    + 
Sbjct: 257 YK--FDISADVHVAINFEALIMGHDDWISSLQWHKTK--LQLLTSTADTAVMVW----EP 308

Query: 233 EDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEWKVFAKRALC 292
           +     W+C + L ++  +          G   + G+ G         G W         
Sbjct: 309 DTISGIWICSSRLGELSSK----------GASTATGSSG---------GFWSCI------ 343

Query: 293 HGVYEINVVKWLELNGKTILATGGDDGIVNFWS 325
                     W   +GK ++ T G  G    W+
Sbjct: 344 ----------WFTHDGKDVILTNGKTGSWRIWT 366

 Score = 32.7 bits (73), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 44/227 (19%), Positives = 81/227 (35%), Gaps = 65/227 (28%)

Query: 70  TSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDK 129
           T ++A G+   T+++W   +++       +   ++GH  EV  V +      + + S D 
Sbjct: 24  TKVVAYGA-GKTIALWKSMDTSHH----GVFKTLKGHTAEVTCVRFVKGTDMMVSASEDF 78

Query: 130 SVWIWETDESGE----EYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDD 185
            V +W   +  E    E ECI V++ H   +   ++   + LL     D ++ +W   +D
Sbjct: 79  EVRVWNFPKLREGHMDEVECIQVIKHHKHTI--TVFAVLKNLLVVGCADGSISVWSFIED 136

Query: 186 DW-----------------------------------------------------ECVAV 192
            +                                                     E    
Sbjct: 137 QYVLQEEFSVQKGVFPLCLSMHEIEKTQFILAIGGTNVNVFIYSLVSNSEGVSKLEFATK 196

Query: 193 LNGHEGTVWSSDFDKT-EGVFRLCSGSDDSTVRVWKYMGDDEDDQQE 238
           L GHE  + S  F +T  G + L SGS D  +R+W+   +++ D  E
Sbjct: 197 LEGHEDWIKSLVFRETVPGDYLLASGSQDRYIRLWRIRTNEKIDTSE 243

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 43/91 (47%), Gaps = 3/91 (3%)

Query: 99  LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQE-HSQDVK 157
           L  ++  H   +  + +S D  YL + SRD+   +WE +     +   S  ++ HS+ + 
Sbjct: 599 LPQVLPFHNLTITKLRFSKDNRYLLSVSRDRLWSLWERNFDNNSFVLRSFKEKPHSRIIW 658

Query: 158 HVIWHPSEALLA--SSSYDDTVRIWKDYDDD 186
              W P    LA  ++S D T++ W+   +D
Sbjct: 659 DADWVPLAKGLAFITASRDKTLKFWRLSKED 689

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 59/135 (43%), Gaps = 8/135 (5%)

Query: 93  RTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEH 152
           RT   + +   EGH   V  +++  D  ++ + S D ++ +W+      +        +H
Sbjct: 61  RTTNPNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRN-----YKH 115

Query: 153 SQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVF 212
              V  V+ HP++  L S   D  +RIW D  ++ +C   L   + T   S    ++G  
Sbjct: 116 HAPVNEVVIHPNQGELISCDQDGNIRIW-DLGEN-QCTHQLTPEDDTPLQSLSIASDGSM 173

Query: 213 RLCSGSDDSTVRVWK 227
            L +G++     VW+
Sbjct: 174 -LVAGNNKGNCYVWQ 187

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/226 (19%), Positives = 90/226 (39%), Gaps = 18/226 (7%)

Query: 5   NLIKSLKLYKEKIWSFDFSQGI--LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIR 62
           N + S + ++  + S  F Q    + + S D  IK+  V+        V     H   + 
Sbjct: 66  NPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPS-----VQRNYKHHAPVN 120

Query: 63  SVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYL 122
            V   P+   L +   D  + IW   E+           +    +  ++ ++ ++DG  L
Sbjct: 121 EVVIHPNQGELISCDQDGNIRIWDLGEN------QCTHQLTPEDDTPLQSLSIASDGSML 174

Query: 123 ATCSRDKSVWIWETDESGE--EYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
              +   + ++W+     +    + ++  + H++ +  V+       LA+ S D T R+W
Sbjct: 175 VAGNNKGNCYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVW 234

Query: 181 KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
              +D+++    L+GH+  VW   F        L +   D  VR+W
Sbjct: 235 S-IEDNFKLETTLDGHQRWVWDCAFSADSAY--LVTACSDHYVRLW 277

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 38/92 (41%), Gaps = 6/92 (6%)

Query: 44  DDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAII 103
           D   L  V    +H K I  V        LA  S D T  +W+ E++        L   +
Sbjct: 193 DAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDN------FKLETTL 246

Query: 104 EGHENEVKGVAWSNDGYYLATCSRDKSVWIWE 135
           +GH+  V   A+S D  YL T   D  V +W+
Sbjct: 247 DGHQRWVWDCAFSADSAYLVTACSDHYVRLWD 278

>Kwal_47.17567
          Length = 590

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 104/236 (44%), Gaps = 24/236 (10%)

Query: 7   IKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAW 66
           I+++  + +++    ++  IL +GS DR+I    V+    +  ++     H + +  + W
Sbjct: 361 IRTIPGHIDRVACLSWNNHILTSGSRDRRILHRDVRTPQSSFEEI---RTHNQEVCGLKW 417

Query: 67  RPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY-YLATC 125
               + LA+G  D+ V ++      D T  +  L + E H   VK +AWS      LAT 
Sbjct: 418 NVEDNKLASGGNDNAVFVY------DGTSRLPFLKL-EEHTAAVKAMAWSPHRRGILATG 470

Query: 126 --SRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-SEALLASSSYDD-TVRIWK 181
             + DK + IW    S + ++  +  Q     V ++IW   +  ++ S  Y    + +W 
Sbjct: 471 GGTADKRLKIWNVKTSVKLHDVDTASQ-----VCNMIWSKNTNEIITSHGYSKYNLTLWD 525

Query: 182 DYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQ 237
              +  E +A+L GH   V       T+G   + SG+ D T+R WK     +   Q
Sbjct: 526 G--NTLEPMAILKGHSFRVLHMTLS-TDGTT-VVSGAGDETLRYWKLFEKSKSQAQ 577

 Score = 35.0 bits (79), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 72/170 (42%), Gaps = 25/170 (14%)

Query: 63  SVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYL 122
           S++W    S LA G  +  V+I+  E+          +  I GH + V  ++W+N  + L
Sbjct: 331 SLSWVGAGSHLAVGQTNGLVNIFDVEKKK-------CIRTIPGHIDRVACLSWNN--HIL 381

Query: 123 ATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKD 182
            + SRD+ +   +       +E I   + H+Q+V  + W+  +  LAS   D+ V ++  
Sbjct: 382 TSGSRDRRILHRDVRTPQSSFEEI---RTHNQEVCGLKWNVEDNKLASGGNDNAVFVY-- 436

Query: 183 YDDDWECVAVLNGHEGT------VWSSDFDKTEGVFRLCSGSDDSTVRVW 226
             D    +  L   E T       WS       G+     G+ D  +++W
Sbjct: 437 --DGTSRLPFLKLEEHTAAVKAMAWSP---HRRGILATGGGTADKRLKIW 481

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 57/253 (22%), Positives = 104/253 (41%), Gaps = 29/253 (11%)

Query: 78  FDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETD 137
            + T S+ A    A     +  + I++GH N++    WS D   + + S+D  + +W++ 
Sbjct: 59  LEMTASVPAITPGA---INLKPVGILKGHTNKIADFRWSRDSKLILSASQDGFMIVWDS- 114

Query: 138 ESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDD---DWECVAVLN 194
            +G +   I +    SQ V      PS AL AS+  ++   I++            ++  
Sbjct: 115 LTGLKRSAIPL---DSQWVLTCALSPSGALAASAGLNNNCTIYRMPRGSAVQQNVTSIFK 171

Query: 195 GHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVY 254
           GH G +   +F       R+ + S D T  +W    D    ++       L DV    + 
Sbjct: 172 GHTGYISGVEFVSES---RVVTSSGDMTCALW----DIPKAKRVREYSDHLGDVLAISIP 224

Query: 255 NVAWGFNGLIASVGADGVLAVYEEVDGEWKVFAKRALCH---GVYEINVVKWLELNGKTI 311
                 N + AS G+DG   +       W V +  A+     G  + N +K+   +G ++
Sbjct: 225 VTNLSKNNMFASCGSDGYTFI-------WDVRSPSAVQQFSIGSCDSNCLKFFP-DGNSV 276

Query: 312 LATGGDDGIVNFW 324
            A G DDG ++ +
Sbjct: 277 -AVGNDDGTISLF 288

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 20/32 (62%)

Query: 103 IEGHENEVKGVAWSNDGYYLATCSRDKSVWIW 134
           +EGH N + GV  S DG  + T S D+++ +W
Sbjct: 378 LEGHGNRLAGVKCSPDGMAICTGSWDQTLKLW 409

>CAGL0A00605g complement(67281..69203) similar to sp|P53197
           Saccharomyces cerevisiae YGL003c CDH1 substrate-specific
           activator of APC-dependent proteolysis, hypothetical
           start
          Length = 640

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 62/129 (48%), Gaps = 15/129 (11%)

Query: 55  TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
           + H   +  ++W  H  +L++GS D T+ +      AD  FE      IE HE E+ G+ 
Sbjct: 415 SGHLDRVACLSWNNH--ILSSGSRDRTI-LHRDVRMADPFFEK-----IETHEQEICGLK 466

Query: 115 WSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-SEALLAS--S 171
           W+ +   LA+   D  V++++    G        + EH   VK + W P  + +LA+   
Sbjct: 467 WNTNDNKLASGGNDNMVFVYD----GTSRTPFLSINEHKAAVKAMAWSPHKQGILATGGG 522

Query: 172 SYDDTVRIW 180
           + D T+++W
Sbjct: 523 TADRTLKMW 531

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 108/228 (47%), Gaps = 28/228 (12%)

Query: 7   IKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDD--FTLIDVLDETAHKKAIRSV 64
           I++L  + +++    ++  IL++GS DR I    V+  D  F  I+      H++ I  +
Sbjct: 411 IRTLSGHLDRVACLSWNNHILSSGSRDRTILHRDVRMADPFFEKIET-----HEQEICGL 465

Query: 65  AWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY-YLA 123
            W  + + LA+G  D+ V ++      D T     L+I E H+  VK +AWS      LA
Sbjct: 466 KWNTNDNKLASGGNDNMVFVY------DGTSRTPFLSINE-HKAAVKAMAWSPHKQGILA 518

Query: 124 TC--SRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-SEALLASSSYDD-TVRI 179
           T   + D+++ +W  + S +  +  +  Q     V +++W   ++ ++ S  Y    + I
Sbjct: 519 TGGGTADRTLKMWNVNTSVKLNDVDTGSQ-----VCNMVWSTNTDEIVTSHGYSKYNLTI 573

Query: 180 WKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
           W+    + E +A+L GH   V        +G   + SG+ D T+R WK
Sbjct: 574 WEA--SNLEPLAILKGHSFRVLHLTLS-ADGTT-IVSGAGDETLRYWK 617

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 73/163 (44%), Gaps = 21/163 (12%)

Query: 27  LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAA---GSFDSTVS 83
           LA+G  D  + +    YD  +    L    HK A++++AW PH   + A   G+ D T+ 
Sbjct: 474 LASGGNDNMVFV----YDGTSRTPFLSINEHKAAVKAMAWSPHKQGILATGGGTADRTLK 529

Query: 84  IWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCS--RDKSVWIWETDESGE 141
           +W    S      + L  +  G  ++V  + WS +   + T       ++ IWE      
Sbjct: 530 MWNVNTS------VKLNDVDTG--SQVCNMVWSTNTDEIVTSHGYSKYNLTIWE----AS 577

Query: 142 EYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYD 184
             E +++L+ HS  V H+        + S + D+T+R WK ++
Sbjct: 578 NLEPLAILKGHSFRVLHLTLSADGTTIVSGAGDETLRYWKLFE 620

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 53/231 (22%), Positives = 104/231 (45%), Gaps = 28/231 (12%)

Query: 102 IIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIW 161
           +++GH N++    WS D   + + S+D  + IW++  SG +   I +    SQ V     
Sbjct: 87  VLKGHNNKISDFRWSRDSKRILSASQDGFMLIWDS-ASGLKQNAIPL---DSQWVLSCAI 142

Query: 162 HPSEALLASSSYDDTVRIWKDYDDD---WECVAVLNGHEGTVWSSDFDKTEGVFRLCSGS 218
            PS  L+AS+  ++   I++   ++       ++  GH  T + SD + T+    L + S
Sbjct: 143 SPSSTLVASAGLNNNCTIYRVSKENRVAQNVASIFKGH--TCYISDIEFTDNAHIL-TAS 199

Query: 219 DDSTVRVW-----KYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVL 273
            D T  +W     K + +  D   + +  AI  + +     N         AS G+DG  
Sbjct: 200 GDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPNSENSSNT-------FASCGSDGYT 252

Query: 274 AVYEEVDGEWKVFAKRALCHGVYEINVVKWLELNGKTILATGGDDGIVNFW 324
            +++         A ++      +IN +++ + +G +I+A G D+G +N +
Sbjct: 253 YIWDSRSPS----AVQSFYVNDSDINALRFFK-DGMSIVA-GSDNGAINMY 297

>ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH]
           complement(140589..143003) [2415 bp, 804 aa]
          Length = 804

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 63/282 (22%), Positives = 111/282 (39%), Gaps = 45/282 (15%)

Query: 26  ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIW 85
           +LA+G+ DR I+L  +K ++    ++ +E   K  + S                    I+
Sbjct: 232 MLASGAQDRYIRLWRIKANN----NIEEEDPTKLKLLSN------------------KIY 269

Query: 86  AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYEC 145
             + +AD    ++  A+I GH++ +  + W      L   + D SV +WE DE    + C
Sbjct: 270 KFQVTADLHLSINFEALIMGHDDWISSLQWHESKCQLLAATADTSVMLWEPDEISGIWVC 329

Query: 146 ISVLQEHSQDVKHV-----------IWHPS---EALLASSSYDDTVRIWKDYDD--DWEC 189
            S L E S                 +W  +   E +LA+     + R+W++  D   WE 
Sbjct: 330 ASRLGEFSSKGASTATGSAGGFWSCLWFATGDAEYILANGK-TGSWRMWENRGDGGSWEQ 388

Query: 190 VAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRV---WKYMGDDEDDQQEWVCEAILP 246
           +  + G   +V  +D   +     L + S D T R+   W Y GD    +  W  E   P
Sbjct: 389 LPAITGPTRSV--TDVAWSPSGSYLLASSLDQTTRLYTRWMYEGDGSRRKHTW-HEFARP 445

Query: 247 DVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEWKVFAK 288
            +H   +  +    +    S G + VL  + E     K+  +
Sbjct: 446 QIHGYDMICLEPISDTQFISAGDEKVLRSFNEPRAIAKLLER 487

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 93/220 (42%), Gaps = 54/220 (24%)

Query: 94  TFEMDLLAIIEGHENEVKGVAWSNDG---YYLATCSRDKSVWIWET-------DESGEEY 143
           T +++L A +EGHE+ +K +A+ ++G   + LA+ ++D+ + +W         +E   + 
Sbjct: 202 TVDVELSATVEGHEDWIKDLAFRSNGPGDWMLASGAQDRYIRLWRIKANNNIEEEDPTKL 261

Query: 144 ECIS--------------------VLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWK-- 181
           + +S                    ++  H   +  + WH S+  L +++ D +V +W+  
Sbjct: 262 KLLSNKIYKFQVTADLHLSINFEALIMGHDDWISSLQWHESKCQLLAATADTSVMLWEPD 321

Query: 182 DYDDDWECVAVL-----------NGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMG 230
           +    W C + L            G  G  WS  +  T     + +     + R+W+  G
Sbjct: 322 EISGIWVCASRLGEFSSKGASTATGSAGGFWSCLWFATGDAEYILANGKTGSWRMWENRG 381

Query: 231 DDEDDQQEWVCEAILPDV--HKRQVYNVAWGFNG--LIAS 266
           D    +Q       LP +    R V +VAW  +G  L+AS
Sbjct: 382 DGGSWEQ-------LPAITGPTRSVTDVAWSPSGSYLLAS 414

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 61/141 (43%), Gaps = 12/141 (8%)

Query: 177 VRIWKDYDDDWECV-AVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDD 235
           + +W   D+    V   L  H   V S  F   E +  L S S D+T+ VW+  GD    
Sbjct: 58  IALWNPLDEHNAGVYCTLKAHNAEVTSVKFIGAEKL--LVSASADATINVWR--GD---- 109

Query: 236 QQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEWKVFAKRALCHGV 295
            + W     L +  K  V ++A    GLI +  ADG L+V+ E D  + + ++  +  G 
Sbjct: 110 -ERWELAQTL-EGPKSSVTSLAVA-AGLIVAGFADGTLSVWSEHDDAFVLSSQFLIRKGF 166

Query: 296 YEINVVKWLELNGKTILATGG 316
             + +      +G  +LA  G
Sbjct: 167 LPLALALQKLSDGCYMLAVSG 187

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 45/104 (43%), Gaps = 13/104 (12%)

Query: 97  MDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDV 156
           + L    E H   +  + +S D  +L + SRD+   +W  ++        S  + HS+ +
Sbjct: 609 LQLPPCPEFHNLTITRLRFSKDNRHLLSVSRDRMWAVWYRNDDDTFTLKYSDQKPHSRII 668

Query: 157 KHVIWHPSEALLA--SSSYDDTVRIWKDYDDDWECVAVLNGHEG 198
               W P+    A  ++S D TV+IW+           L+G EG
Sbjct: 669 WDGDWLPASCGTAFVTASRDKTVKIWR-----------LDGQEG 701

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 53/141 (37%), Gaps = 22/141 (15%)

Query: 105 GHENEVKGVAWSNDGYYLATCSRDK----------SVWIWETDESGEEYECISVLQ-EHS 153
           GH  E+  V  S DG  LA+  +            S   W       E+  +++ +   S
Sbjct: 569 GHGYEISCVDVSPDGKLLASACKSNNTSHAVVRIFSTHTWLQLPPCPEFHNLTITRLRFS 628

Query: 154 QDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLN--GHEGTVWSSDFDKTEGV 211
           +D +H++         S S D    +W   DDD   +   +   H   +W  D+      
Sbjct: 629 KDNRHLL---------SVSRDRMWAVWYRNDDDTFTLKYSDQKPHSRIIWDGDWLPASCG 679

Query: 212 FRLCSGSDDSTVRVWKYMGDD 232
               + S D TV++W+  G +
Sbjct: 680 TAFVTASRDKTVKIWRLDGQE 700

 Score = 28.9 bits (63), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 46/221 (20%), Positives = 96/221 (43%), Gaps = 22/221 (9%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
           AH   + SV +     LL + S D+T+++W  +E        +L   +EG ++ V  +A 
Sbjct: 77  AHNAEVTSVKFIGAEKLLVSASADATINVWRGDE------RWELAQTLEGPKSSVTSLAV 130

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA--LLASSSY 173
           +  G  +A  + D ++ +W   +         ++++    +   +   S+   +LA S  
Sbjct: 131 AA-GLIVAGFA-DGTLSVWSEHDDAFVLSSQFLIRKGFLPLALALQKLSDGCYMLAVSGT 188

Query: 174 DDTVRIWK---DYDDDWECVAVLNGHEGTVWSSDF---DKTEGVFRLCSGSDDSTVRVWK 227
              + ++        D E  A + GHE   W  D        G + L SG+ D  +R+W+
Sbjct: 189 STDLMVYSVCVAATVDVELSATVEGHED--WIKDLAFRSNGPGDWMLASGAQDRYIRLWR 246

Query: 228 YMGDDEDDQQEWVCEAILPD-VHKRQV---YNVAWGFNGLI 264
              ++  ++++     +L + ++K QV    +++  F  LI
Sbjct: 247 IKANNNIEEEDPTKLKLLSNKIYKFQVTADLHLSINFEALI 287

>Kwal_33.15475
          Length = 783

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 69/152 (45%), Gaps = 10/152 (6%)

Query: 176 TVRIWKDYDDDWECV-AVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDED 234
           T+ +WK  D     V   L GH   V    F    G   + S S+DS VR+W +   +E 
Sbjct: 34  TIALWKPLDPAHHGVYRTLKGHNAEVTCVKF--VPGTNLMVSSSEDSQVRLWAF---EEK 88

Query: 235 DQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVG-ADGVLAVYEEVDGEWKVFAKRALCH 293
           DQ    C  ++ D HK  + +++   N  I SVG ADG ++++   + +  +     L  
Sbjct: 89  DQDALKCVQVI-DHHKHTITSLSVISN--ILSVGCADGSVSLWLTENNQAILLHSFNLQT 145

Query: 294 GVYEINVVKWLELNGKTILATGGDDGIVNFWS 325
            VY + +   L    K +LA GG +  V  +S
Sbjct: 146 NVYPLCMALKLVEGDKYLLAIGGTNPRVFIYS 177

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 64/147 (43%), Gaps = 25/147 (17%)

Query: 7   IKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAW 66
           +K++  Y+E   +      +LATGS DR I+L  ++ ++  LID  DE   K        
Sbjct: 201 VKAMDFYEESPGNM-----LLATGSQDRYIRLWRIRTNE--LIDNSDEDEFK-------- 245

Query: 67  RPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCS 126
                L   G+  S   I     + D    ++  A+I GH++ +  + W  +   L   +
Sbjct: 246 -----LNLLGNKQSKFFI-----TPDLKVAINFDALIVGHDDWISCLKWHKERPQLLAST 295

Query: 127 RDKSVWIWETDESGEEYECISVLQEHS 153
            D +V +WE D     + C S L E S
Sbjct: 296 ADTAVMVWEPDADSGVWICASRLGELS 322

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 49/224 (21%), Positives = 92/224 (41%), Gaps = 37/224 (16%)

Query: 26  ILATGSTDRKIKLVSVKYDDFTLIDVLDETA--HKKAIRSVAWRPHTSLLAAGSFDSTVS 83
           I+A+      ++   +K+ D      L  T   H   I  + +   +  L + S D   +
Sbjct: 564 IIASACRSNNLQHAVIKFFDAKTWLQLKPTKQFHNLTITRLRFSSDSESLLSVSRDRQWA 623

Query: 84  IWAKEESADRTFEMDLLAIIEGHENEVKGVAWSND------GYYLATCSRDKSVWIWETD 137
           +W K+ SA   FE+        +E     + W  D      G+   T SRDK +  W+  
Sbjct: 624 VW-KKNSATNEFELTF-----KNEKAHTRIIWDCDWAPTEFGHVFVTASRDKHIKAWKLS 677

Query: 138 ESGEEYECISVLQEHSQDVKHVI--------WHPSEALLASSSYDDTVRIWKDYDDDWEC 189
           E G++YE     Q+H+  +   +         H  + L+A+   +  ++++  YD+ + C
Sbjct: 678 EDGQQYE-----QQHALKLAVPVTAISVFPGLHNGKLLVAAGLENGNIQVFT-YDNQFRC 731

Query: 190 VAVLNGHEGTV-------WSSDFDKTEGVFRLCSGSDDSTVRVW 226
            + ++             WSS+ +K  G   L   S D ++RV+
Sbjct: 732 YSEIDTRFTPADRVSRLRWSSNQEK--GRILLAVTSADHSIRVF 773

 Score = 35.0 bits (79), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 6/78 (7%)

Query: 129 KSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW----KDYD 184
           K++ +W+  +    +     L+ H+ +V  V + P   L+ SSS D  VR+W    KD  
Sbjct: 33  KTIALWKPLDPAH-HGVYRTLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAFEEKD-Q 90

Query: 185 DDWECVAVLNGHEGTVWS 202
           D  +CV V++ H+ T+ S
Sbjct: 91  DALKCVQVIDHHKHTITS 108

 Score = 32.0 bits (71), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 49/131 (37%), Gaps = 12/131 (9%)

Query: 164 SEALLASSSYDDTVRIWKDYDDDWECVAVLN---GHEGTVWSSDFDKTEGVFRLCSGSDD 220
           SE+LL S S D    +WK      E          H   +W  D+  TE      + S D
Sbjct: 610 SESLL-SVSRDRQWAVWKKNSATNEFELTFKNEKAHTRIIWDCDWAPTEFGHVFVTASRD 668

Query: 221 STVRVWKYMGDDEDDQQEWVCE--------AILPDVHKRQVYNVAWGFNGLIASVGADGV 272
             ++ WK   D +  +Q+   +        ++ P +H  ++   A   NG I     D  
Sbjct: 669 KHIKAWKLSEDGQQYEQQHALKLAVPVTAISVFPGLHNGKLLVAAGLENGNIQVFTYDNQ 728

Query: 273 LAVYEEVDGEW 283
              Y E+D  +
Sbjct: 729 FRCYSEIDTRF 739

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 54/138 (39%), Gaps = 23/138 (16%)

Query: 81  TVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESG 140
           T+++W   + A       +   ++GH  EV  V +      + + S D  V +W  +E  
Sbjct: 34  TIALWKPLDPAHH----GVYRTLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAFEEKD 89

Query: 141 EE-YECISVLQEHSQDVKHVIWHPS--EALLASSSYDDTVRIWKDYDDDWECVAVLNGHE 197
           ++  +C+ V+  H    KH I   S    +L+    D +V +W            L  + 
Sbjct: 90  QDALKCVQVIDHH----KHTITSLSVISNILSVGCADGSVSLW------------LTENN 133

Query: 198 GTVWSSDFDKTEGVFRLC 215
             +    F+    V+ LC
Sbjct: 134 QAILLHSFNLQTNVYPLC 151

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 61/128 (47%), Gaps = 23/128 (17%)

Query: 22  FSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVA-------------WRP 68
           F+  I+A+GS D KI +  +  +D+ L + +DE  + K ++ V              + P
Sbjct: 104 FNDHIVASGSDDGKIGIWEIP-EDYGLHEYVDEEGNPKDLKPVRMLSGHSRKVGHLLFHP 162

Query: 69  -HTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSR 127
              ++LA+ S D TV IW            + +     H + V  +++S DG +L T SR
Sbjct: 163 LAENILASSSLDYTVKIW--------DISQEEVKFTLKHPDMVTSMSFSYDGKHLVTVSR 214

Query: 128 DKSVWIWE 135
           DK + +W+
Sbjct: 215 DKKLRVWD 222

>AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH]
           complement(1497416..1499560) [2145 bp, 714 aa]
          Length = 714

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/268 (24%), Positives = 104/268 (38%), Gaps = 62/268 (23%)

Query: 73  LAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEV-KGVAWSNDGYYLATCSRDKSV 131
           L + S+D T  +W +E + +R         + GH   V   +A   D +   T S DK++
Sbjct: 121 LVSSSWDQTARVW-REGTEERA--------LSGHNATVWHALALGYDRFL--TASADKTI 169

Query: 132 WIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVA 191
            +W+       Y        H+  V+H+   P     AS S D +V++   +  D + V 
Sbjct: 170 KLWDGARDLATYNV------HTDVVRHLALAPDGHHFASCSNDGSVKV---HTLDGKTVR 220

Query: 192 VLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKR 251
             +GHE  V+   +    G   L S  +D TVRVW   G                  H R
Sbjct: 221 TFDGHESFVYCVKYLPDGG---LVSCGEDKTVRVWDMSG------------------HVR 259

Query: 252 QVYNVA----WGF----NGLIASVGADGVLAVY----------EEVDGEWKVFAKRALCH 293
           QV  +     W      NG I   G+DG + ++          EE++   +  A  A+  
Sbjct: 260 QVIRLCATSLWSLDVLPNGDIVVGGSDGKILIFTVDPARVAPVEELEQLREAVASTAIIA 319

Query: 294 GVYEINVVKWLELNGKTILATGGDDGIV 321
            V + +  K      +TI A G  +G V
Sbjct: 320 KVIDFDESKLSPY--ETIQAPGKSEGQV 345

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 69/269 (25%), Positives = 112/269 (41%), Gaps = 34/269 (12%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H   ++SV     T + A+GS D TV +W ++ S  R +     AI+   E  V  V + 
Sbjct: 17  HSMDVKSVVAISDTQI-ASGSRDGTVRVWTRDTSDSRLWSG---AILHSTERYVNAVCY- 71

Query: 117 NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDT 176
            +   L      ++V    +    E  +   +L  HS +V        +  L SSS+D T
Sbjct: 72  EENEQLVFFGGQEAVIGAVSPLVLEVQDASYLLAGHSGNV--CALEARDGQLVSSSWDQT 129

Query: 177 VRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQ 236
            R+W++  ++      L+GH  TVW +      G  R  + S D T+++W    D   D 
Sbjct: 130 ARVWREGTEER----ALSGHNATVWHA---LALGYDRFLTASADKTIKLW----DGARDL 178

Query: 237 QEWVCEAILPDVHKRQVYNVAWGFNG-LIASVGADGVLAVYEEVDGEWKVFAKRALCHGV 295
             +       +VH   V ++A   +G   AS   DG + V+  +DG+      R      
Sbjct: 179 ATY-------NVHTDVVRHLALAPDGHHFASCSNDGSVKVH-TLDGK----TVRTFDGHE 226

Query: 296 YEINVVKWLELNGKTILATGGDDGIVNFW 324
             +  VK+L   G   L + G+D  V  W
Sbjct: 227 SFVYCVKYLPDGG---LVSCGEDKTVRVW 252

 Score = 32.7 bits (73), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 60/131 (45%), Gaps = 6/131 (4%)

Query: 98  DLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVK 157
           +L + + GH  +VK V   +D   +A+ SRD +V +W  D S       ++L    + V 
Sbjct: 9   ELSSSLLGHSMDVKSVVAISD-TQIASGSRDGTVRVWTRDTSDSRLWSGAILHSTERYVN 67

Query: 158 HVIWHPSEALLASSSYDDTV-RIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCS 216
            V +  +E L+     +  +  +     +  +   +L GH G V +   +  +G  +L S
Sbjct: 68  AVCYEENEQLVFFGGQEAVIGAVSPLVLEVQDASYLLAGHSGNVCA--LEARDG--QLVS 123

Query: 217 GSDDSTVRVWK 227
            S D T RVW+
Sbjct: 124 SSWDQTARVWR 134

 Score = 32.0 bits (71), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 143 YECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
           YE  S L  HS DVK V+   S+  +AS S D TVR+W
Sbjct: 8   YELSSSLLGHSMDVKSVVAI-SDTQIASGSRDGTVRVW 44

>CAGL0F07337g complement(714870..716735) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 621

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 93/213 (43%), Gaps = 31/213 (14%)

Query: 106 HENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSE 165
           H  EV G+++  DG  LA+   D ++ IW+T  S  ++    V ++HS  VK + W P+ 
Sbjct: 376 HTGEVCGLSYKADGLQLASGGNDNTMMIWDTRTSMPQF----VKKDHSAAVKALAWSPTN 431

Query: 166 A-LLAS--SSYDDTVRIWKDYDDDWECVAVLNGHEGTV--WSSDFDKTEGVFRL----CS 216
           A LLAS     D  +  W +     +   +  G + +   W   +D T+G   +      
Sbjct: 432 AGLLASGGGQTDQQIHFW-NSTTGAKLHTINTGSQVSSLHWGQSYD-TKGNMNVEIVATG 489

Query: 217 GSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNG-LIASVGADGVLAV 275
           GS D+++ ++ Y      + +  V E +    H  ++       +G ++A++G D  L  
Sbjct: 490 GSPDNSISIYNY------ETRYKVAEVV--HAHDARICCSKLSPDGTVLATIGGDENLKF 541

Query: 276 YEEVDGEWKVFAKRALCHGVYEINVVKWLELNG 308
           Y       K+F  +       + NVV+ L  N 
Sbjct: 542 Y-------KIFEPKRKYKQKSKGNVVEELMTNN 567

 Score = 32.0 bits (71), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 48/224 (21%), Positives = 95/224 (42%), Gaps = 30/224 (13%)

Query: 16  KIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAA 75
           +I S  + + +LATG    +I++  V+  D  +++  DE  H   +  ++++     LA+
Sbjct: 338 RIGSQSWLETLLATGFRSGEIQINDVRIKDH-IVNTWDE--HTGEVCGLSYKADGLQLAS 394

Query: 76  GSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS--NDGYYLATCSR-DKSVW 132
           G  D+T+ IW    S  +  + D       H   VK +AWS  N G   +   + D+ + 
Sbjct: 395 GGNDNTMMIWDTRTSMPQFVKKD-------HSAAVKALAWSPTNAGLLASGGGQTDQQIH 447

Query: 133 IWETDESGEEYECISVLQEHSQDVKHVIWHPS---------EALLASSSYDDTVRIWKDY 183
            W +  +G +   I+        V  + W  S         E +    S D+++ I+ +Y
Sbjct: 448 FWNS-TTGAKLHTINT----GSQVSSLHWGQSYDTKGNMNVEIVATGGSPDNSISIY-NY 501

Query: 184 DDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
           +  ++   V++ H+  +  S       V     G  D  ++ +K
Sbjct: 502 ETRYKVAEVVHAHDARICCSKLSPDGTVLATIGG--DENLKFYK 543

>ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH]
           complement(1012413..1013798) [1386 bp, 461 aa]
          Length = 461

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 68/145 (46%), Gaps = 16/145 (11%)

Query: 41  VKYDDFTLIDVLDET-AHKKAIRSVAWRPHTS---LLAAGSFDSTVSIWAKEESADRTFE 96
           V YD F     L  T AH K + S+A     +   L++  S D    IW+  ++A     
Sbjct: 145 VAYDLFNRSMPLHSTQAHMKGVTSLAVMEAENGSLLISTTSKDLQCKIWSFTDNA----A 200

Query: 97  MDLLAIIEGHENEVKGVAWSNDG--YYLATCSRDKSVWIWETDESGEEYECISVLQEHSQ 154
             LL  +  HE+ V    +   G    LATCSRD +V +W+T +SG    CI   Q H+Q
Sbjct: 201 FQLLRTLSSHEHIVSQSCFLRSGSDLLLATCSRDLTVKVWDT-KSG---WCIKSFQPHNQ 256

Query: 155 DVKHVIWHPSEALLASSSYDDTVRI 179
            V+ +  H    +  S+  D T+R+
Sbjct: 257 WVRTLELHGDYVITGSN--DATIRL 279

 Score = 32.3 bits (72), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 53/112 (47%), Gaps = 11/112 (9%)

Query: 117 NDGYYLATCSRDKSVWIWE-TDESGEEYECISVLQEHSQDVKH--VIWHPSEALLASSSY 173
           N    ++T S+D    IW  TD +   ++ +  L  H   V     +   S+ LLA+ S 
Sbjct: 176 NGSLLISTTSKDLQCKIWSFTDNAA--FQLLRTLSSHEHIVSQSCFLRSGSDLLLATCSR 233

Query: 174 DDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRV 225
           D TV++W D    W C+     H   V + +     G + + +GS+D+T+R+
Sbjct: 234 DLTVKVW-DTKSGW-CIKSFQPHNQWVRTLEL---HGDY-VITGSNDATIRL 279

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 167 LLASSSYDDTVRIWKDYDDD-WECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRV 225
           L++++S D   +IW   D+  ++ +  L+ HE  V  S F ++     L + S D TV+V
Sbjct: 180 LISTTSKDLQCKIWSFTDNAAFQLLRTLSSHEHIVSQSCFLRSGSDLLLATCSRDLTVKV 239

Query: 226 W 226
           W
Sbjct: 240 W 240

>Scas_658.1
          Length = 442

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 80/175 (45%), Gaps = 18/175 (10%)

Query: 56  AHKKAIRSVAWRPHT-SLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
            H     S+ + P++ +LL +G  D+ V +W      D   + +LL   +GH   +  + 
Sbjct: 147 GHTNGTTSLTFLPNSGNLLLSGGNDNIVKVW------DFYHKRNLLRDYKGHSKAINSLD 200

Query: 115 WSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLA---SS 171
           +++DG    + S D ++ IW+T++   + +     +    DVK   ++ SE ++    S 
Sbjct: 201 FNDDGTNFISSSFDHTIKIWDTEQGKVKTKL--HFKSTPNDVKFRPFNSSEFIVGFANSK 258

Query: 172 SYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            Y    RI    ++D   V V + H  ++ +  F      F   S S+D TVR+W
Sbjct: 259 IYHYDTRI---SENDGR-VQVYDHHMSSILALKFFPDGSKF--ISSSEDKTVRIW 307

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 88/206 (42%), Gaps = 18/206 (8%)

Query: 23  SQGILATGSTDRKIKLVSVKYDDFTLIDVL-DETAHKKAIRSVAWRPHTSLLAAGSFDST 81
           S  +L +G  D  +K+    +D +   ++L D   H KAI S+ +    +   + SFD T
Sbjct: 161 SGNLLLSGGNDNIVKV----WDFYHKRNLLRDYKGHSKAINSLDFNDDGTNFISSSFDHT 216

Query: 82  VSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGE 141
           + IW  E+   +T         +   N+VK   +++  + +     +  ++ ++T  S E
Sbjct: 217 IKIWDTEQGKVKT-----KLHFKSTPNDVKFRPFNSSEFIVGFA--NSKIYHYDTRIS-E 268

Query: 142 EYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVW 201
               + V   H   +  + + P  +   SSS D TVRIW    D+   V +    + T +
Sbjct: 269 NDGRVQVYDHHMSSILALKFFPDGSKFISSSEDKTVRIW----DNQVNVPIKQISDTTQY 324

Query: 202 S-SDFDKTEGVFRLCSGSDDSTVRVW 226
           S    D        C+ S D+T+  +
Sbjct: 325 SMPSIDIHPDKKNFCAQSMDNTIYTY 350

>CAGL0L03201g complement(366795..368534) some similarities with
           sp|P47025 Saccharomyces cerevisiae YJL112w MDV1 or
           sp|P36130 Saccharomyces cerevisiae YKR036c CAF4 CCR4,
           hypothetical start
          Length = 579

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 107/242 (44%), Gaps = 34/242 (14%)

Query: 6   LIKSLKLYKEKIWSFDFSQ--GILA-TGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIR 62
           L K+LK + + I S   +   G+L+ T + D +IKL  +       + VL  + H+  + 
Sbjct: 272 LGKTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQ--CLGVL--SGHRATVN 327

Query: 63  SVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMD---LLAIIEGHENEVKGVAWSNDG 119
           +  +   T LLA+   D++V +W  +   D+    +    LA  +GH++ V  +A +  G
Sbjct: 328 TTRFIDDTRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTALATT--G 385

Query: 120 YYLATCSRDKSVWIWETDESGEEYECISV---LQEHSQDVKHVIWHPS------------ 164
             + + S DK++  W+   SG+  + I +   L+   Q V  +   PS            
Sbjct: 386 NAIVSGSNDKTLRHWDLG-SGKCIQSIDLTIALKMVPQSVSKLDITPSFNTPLIGGADCI 444

Query: 165 EALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVR 224
           +  L + + D  V +W         V  L GH G + S  +  +E    L +GS D + R
Sbjct: 445 DNALVTGTKDGIVYLWDLR--IGRVVGSLEGHRGPITSLKYMGSE----LITGSMDKSTR 498

Query: 225 VW 226
           +W
Sbjct: 499 IW 500

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 76/175 (43%), Gaps = 24/175 (13%)

Query: 166 ALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRV 225
            L ++++ D+ +++W       +C+ VL+GH  TV ++ F   +    L S   D++V+V
Sbjct: 294 VLSSTANLDNEIKLWDI--STTQCLGVLSGHRATVNTTRF--IDDTRLLASAGKDASVKV 349

Query: 226 WKY--MGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEW 283
           W    + D + +  + +C A   D HK  V  +A   N +++    D  L  ++   G+ 
Sbjct: 350 WDVDNIVDKDGNANDNLCLATF-DGHKDSVTALATTGNAIVSG-SNDKTLRHWDLGSGKC 407

Query: 284 -----KVFAKRALCHGVYEINVVKWLELNGKTI---------LATGGDDGIVNFW 324
                   A + +   V ++++      N   I         L TG  DGIV  W
Sbjct: 408 IQSIDLTIALKMVPQSVSKLDITP--SFNTPLIGGADCIDNALVTGTKDGIVYLW 460

>KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces
           cerevisiae YGL003c CDH1 substrate-specific activator of
           APC-dependent proteolysis, start by similarity
          Length = 582

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 107/228 (46%), Gaps = 28/228 (12%)

Query: 7   IKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDD--FTLIDVLDETAHKKAIRSV 64
           I++L  + +++    ++  +L++GS DRKI    V+  +  F  ID      H + +  +
Sbjct: 353 IRTLSGHVDRVACLSWNNHVLSSGSRDRKILHRDVRAPEPFFEQIDT-----HSQEVCGL 407

Query: 65  AWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY-YLA 123
            W  + + LA+G  D+ V ++      D T    +L+ +E H   VK +AWS      LA
Sbjct: 408 KWNVNENKLASGGNDNMVYVY------DGTLRQPMLS-MEEHTAAVKAMAWSPHTRGVLA 460

Query: 124 T--CSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-SEALLASSSYDD-TVRI 179
           T   + DK + IW   ++ +  E  +  Q     + +++W   ++ ++ S  Y    + +
Sbjct: 461 TGGGTADKKLKIWNISKAVKLNEVDTGSQ-----LCNMLWSKNTDEIITSHGYSKYNLTL 515

Query: 180 WKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
           W +Y    E +AVL GH   V        +G   + SG+ D T+R WK
Sbjct: 516 W-NY-PTLEPMAVLKGHSFRVLHLTL-SADGT-TVVSGAGDETLRYWK 559

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 87/213 (40%), Gaps = 26/213 (12%)

Query: 40  SVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDL 99
           S+   D T  DV      +    S++W    S LA G     V I+          +   
Sbjct: 300 SIFLSDNTTNDVTHLATSESDFTSLSWVDSGSHLAVGLSSGIVEIYD-------VLKNKC 352

Query: 100 LAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHV 159
           +  + GH + V  ++W+N  + L++ SRD+ +   +       +E I     HSQ+V  +
Sbjct: 353 IRTLSGHVDRVACLSWNN--HVLSSGSRDRKILHRDVRAPEPFFEQIDT---HSQEVCGL 407

Query: 160 IWHPSEALLASSSYDDTVRIWKDYDDDW-ECVAVLNGHEGTV----WSSDFDKTEGVFRL 214
            W+ +E  LAS   D+ V +   YD    + +  +  H   V    WS     T GV   
Sbjct: 408 KWNVNENKLASGGNDNMVYV---YDGTLRQPMLSMEEHTAAVKAMAWSP---HTRGVLAT 461

Query: 215 CSGSDDSTVRVW---KYMGDDEDDQQEWVCEAI 244
             G+ D  +++W   K +  +E D    +C  +
Sbjct: 462 GGGTADKKLKIWNISKAVKLNEVDTGSQLCNML 494

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 53/102 (51%), Gaps = 9/102 (8%)

Query: 81  TVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWE-TDES 139
           T+++W   E  ++     + A ++GHE EV  V +  D  ++ + S D  V IW+ TD S
Sbjct: 37  TIALWDPIEPNNK----GVYATLKGHEAEVTCVRFVPDSDFMVSASEDHHVKIWKFTDYS 92

Query: 140 GEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWK 181
               +CI  +Q +S+ +  +   PS  L++    D T+ IW+
Sbjct: 93  --HLQCIQTIQHYSKTIVALSALPS--LISVGCADGTISIWR 130

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 78/200 (39%), Gaps = 28/200 (14%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
            H+  +  V + P +  + + S D  V IW   + +     +  +  I+ +   +  VA 
Sbjct: 57  GHEAEVTCVRFVPDSDFMVSASEDHHVKIWKFTDYS----HLQCIQTIQHYSKTI--VAL 110

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP----------SE 165
           S     ++    D ++ IW  +   +E+        H   +K   ++P           +
Sbjct: 111 SALPSLISVGCADGTISIWRQNIQNDEFGL-----AHEFTIKKGFFYPLCLSLSKVEEKK 165

Query: 166 ALLASSSYDDTVRIWKDYDDD-----WECVAVLNGHEGTVWSSDF--DKTEGVFRLCSGS 218
            LLA    +  V I      D        VA L GHE  V S  F   +T G + LCSGS
Sbjct: 166 YLLAIGGTNVNVFIASFILSDSGIEKCRVVAELEGHEDWVKSLAFRHQETPGDYLLCSGS 225

Query: 219 DDSTVRVWKYMGDDEDDQQE 238
            D  +R+W+   +D  D  E
Sbjct: 226 QDRYIRLWRIRINDLIDDSE 245

 Score = 36.2 bits (82), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 68/161 (42%), Gaps = 33/161 (20%)

Query: 26  ILATGSTDRKIKLVSVKYDDFTLID---VLDETAHKKAIRSVAWR----PHTSLLAAGSF 78
           +LA G T+  + + S    D  +     V +   H+  ++S+A+R    P   LL +GS 
Sbjct: 167 LLAIGGTNVNVFIASFILSDSGIEKCRVVAELEGHEDWVKSLAFRHQETPGDYLLCSGSQ 226

Query: 79  DSTVSIW----------AKEESADRT--------FEMD--------LLAIIEGHENEVKG 112
           D  + +W          ++E+S   T        F++D          A+I GH++ +  
Sbjct: 227 DRYIRLWRIRINDLIDDSEEDSKKLTLLSNKQYKFQIDDELRVGINFEALIMGHDDWISS 286

Query: 113 VAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHS 153
           + W      L   + D S+ +WE DE+   + C   L E S
Sbjct: 287 LQWHESRLQLLAATADTSLMVWEPDETSGIWVCSLRLGEMS 327

 Score = 32.7 bits (73), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 95/234 (40%), Gaps = 18/234 (7%)

Query: 105 GHENEVKGVAWSNDGYYLATCSRDKSVW--IWETDESGEEYECISVLQEHSQDVKHVIWH 162
           GH  E+  +  S D   +A+  R  +V   +     +    E    L  HS  +  + + 
Sbjct: 556 GHGFEITCLDISPDQKLIASACRSNNVQNAVIRIFSTENWLEIKPALPFHSLTITRLKFS 615

Query: 163 PSEALLASSSYDDTVRIW-KDYDDDWECVAVLN--GHEGTVWSSDFDKTEGVFRLCSGSD 219
                L S   D    +W ++ +D+   +   N   H   +W +D+   E      + S 
Sbjct: 616 KDGKFLLSVCRDRKWALWERNMEDNTFELRFKNEKPHTRIIWDADWAPLEFGNVFVTASR 675

Query: 220 DSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWG----FNGLIASVGA-DGVLA 274
           D TV+VW++  +  DD   +V EA +   H + V  ++         ++ SVG  +G + 
Sbjct: 676 DKTVKVWRHQKEPADD---YVLEASIK--HTKAVTAISIHDSMIREKILISVGLENGEIY 730

Query: 275 VYEEVDGEWKVFAK-RALCHGVYEINVVKW--LELNGKTILATGGDDGIVNFWS 325
           +Y    G++++  +         +I  ++W  L+ NGK  L  G  D     +S
Sbjct: 731 LYSYTLGKFELITQLNEDITPADKITRLRWSHLKRNGKLFLGVGSSDLSTRIYS 784

 Score = 31.6 bits (70), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 44/223 (19%), Positives = 92/223 (41%), Gaps = 52/223 (23%)

Query: 4   INLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKL--VSVKYDDFTLIDVLDETAHKKAI 61
           +  I++++ Y + I +      +++ G  D  I +   +++ D+F L       AH+  I
Sbjct: 94  LQCIQTIQHYSKTIVALSALPSLISVGCADGTISIWRQNIQNDEFGL-------AHEFTI 146

Query: 62  RSVAWRP----------HTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVK 111
           +   + P             LLA G  +  V I +   S     +  ++A +EGHE+ VK
Sbjct: 147 KKGFFYPLCLSLSKVEEKKYLLAIGGTNVNVFIASFILSDSGIEKCRVVAELEGHEDWVK 206

Query: 112 GVAWSND----GYYLATCSRDKSVWIWET------DESGEEYECISVLQE---------- 151
            +A+ +      Y L + S+D+ + +W        D+S E+ + +++L            
Sbjct: 207 SLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLIDDSEEDSKKLTLLSNKQYKFQIDDE 266

Query: 152 -------------HSQDVKHVIWHPSEALLASSSYDDTVRIWK 181
                        H   +  + WH S   L +++ D ++ +W+
Sbjct: 267 LRVGINFEALIMGHDDWISSLQWHESRLQLLAATADTSLMVWE 309

>KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces
           cerevisiae YDR142c PAS7 peroxisomal import protein -
           peroxin singleton, start by similarity
          Length = 372

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 80/213 (37%), Gaps = 26/213 (12%)

Query: 14  KEKIWSFDFSQGILATGSTD--------RKIKLVSVKYDDFTLIDVLDETAHKKAIRSVA 65
           K K+WS    Q ++     D        R   +  V+       +      +K+ I    
Sbjct: 128 KVKLWSLMRPQSLMTMSPNDTNAASTLSRTSAVAPVRVPMSNQKEHQHADGNKECIYQAT 187

Query: 66  WRPH-TSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLAT 124
           + PH  +L+   S +S +S++      +   +   L    G    +         + +AT
Sbjct: 188 FSPHDPNLVLCSSGNSFISLYDLRVPNNGLPQHQFLG--HGGFEALTCDFNKYRPHIIAT 245

Query: 125 CSRDKSVWIWETD------ESGEEYECISVLQEHSQDVKHVIWHPSEA-LLASSSYDDTV 177
              DK + +W+          G +   I+ +Q H   V+ V W P  + +L S+SYD T 
Sbjct: 246 GGVDKMIKVWDLRMCRKMLSQGHQPININEIQGHELAVRKVTWSPHHSNMLLSTSYDMTC 305

Query: 178 RIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEG 210
           R+W D  DD        GH  T  ++  D   G
Sbjct: 306 RVWTDLSDD--------GHGLTGKTNSIDPAHG 330

>ACL034W [1015] [Homologous to ScYER082C (KRE31) - SH]
           complement(302396..304048) [1653 bp, 550 aa]
          Length = 550

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 63/143 (44%), Gaps = 14/143 (9%)

Query: 41  VKYDDFTLIDVLDETAHK-KAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDL 99
           +KY D +   ++ E   K     S+A  P  +++  G  + TV++WA             
Sbjct: 212 LKYQDVSTGQLVAELRTKLGPTSSMAQNPWNAVMHLGHNNGTVTLWAPNMPTP------- 264

Query: 100 LAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHV 159
           LA I      V GVA    GYY+AT   DKS+ +W+   + +E   +  L   + +VK  
Sbjct: 265 LARILTARGPVTGVAVDRQGYYMATTGADKSMRLWDI-RNFKELHSVENLPIPASNVKI- 322

Query: 160 IWHPSEALLASSSYDDTVRIWKD 182
               S+  L + S    V +WKD
Sbjct: 323 ----SDMGLLAVSRGPHVTLWKD 341

>KLLA0C07513g complement(656060..657379) similar to sp|P39946
           Saccharomyces cerevisiae YOR269w PAC1 singleton, start
           by similarity
          Length = 439

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 76/190 (40%), Gaps = 25/190 (13%)

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVK--HVIWHPSEALLASSSYDDTVR 178
           YLAT S+D +  IWE  E       I  L  H   V         ++ LLA+ S D  ++
Sbjct: 170 YLATTSKDLNTKIWEL-ELDSTLSHIKTLAGHEHTVSDCQFFERGADLLLATCSRDLYLK 228

Query: 179 IWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKY-------MGD 231
           IW D  + W C+     H  T W        G F L +GS+DS +R+  +       MG 
Sbjct: 229 IW-DISNGW-CIKSFQPH--TQWIRSL-HVHGEFVL-TGSNDSAIRLTHWPSGNGLSMGI 282

Query: 232 DEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEWKVFAKRAL 291
             D   E V   ++PD    Q      GF   +AS   DG + +       WKV   + +
Sbjct: 283 GHDFPVEKVL-ILIPDPQHLQPQYQPLGFQH-VASASRDGTIRL-------WKVSLPKFI 333

Query: 292 CHGVYEINVV 301
            H     N +
Sbjct: 334 PHRPPRPNPL 343

>KLLA0F10791g complement(991642..993279) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 545

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 42/80 (52%), Gaps = 6/80 (7%)

Query: 104 EGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP 163
           E H+ EV G+++  DG  LA+ + D +V IW+T ++ +    I   + H   VK + WHP
Sbjct: 330 ERHQGEVCGLSFREDGIQLASGANDNTVMIWDTRQNNDP---IWTKRNHKAAVKAISWHP 386

Query: 164 S-EALLAS--SSYDDTVRIW 180
               LLA+   S D  +  W
Sbjct: 387 EITNLLATGGGSLDKHIHFW 406

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 69/160 (43%), Gaps = 21/160 (13%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H+  +  +++R     LA+G+ D+TV IW   ++ D  +          H+  VK ++W 
Sbjct: 332 HQGEVCGLSFREDGIQLASGANDNTVMIWDTRQNNDPIWTK------RNHKAAVKAISWH 385

Query: 117 ND-GYYLAT--CSRDKSVWIWETD--------ESGEEYECISVLQEHSQDVKHVIWHPSE 165
            +    LAT   S DK +  W T         ++G +   +   Q +S   KH     +E
Sbjct: 386 PEITNLLATGGGSLDKHIHFWNTTTGNRLGTIDTGSQVSSLHWGQSYS---KHSGCMDTE 442

Query: 166 ALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDF 205
            +    + ++ + I+ +Y+  ++   +   H+  + SS  
Sbjct: 443 IVATGGTPNNCITIY-NYETKFKVAEIQQAHDSRIVSSQL 481

>AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH]
           complement(1256750..1258087) [1338 bp, 445 aa]
          Length = 445

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 96/239 (40%), Gaps = 45/239 (18%)

Query: 27  LATGSTDRKIKLVSVKYDDFTLIDVLD--ETAHKKAIRSVAWRPHTSL------LAAGSF 78
           L +G  DR ++L   K DD   +D L+  E AH  AI      P  S+      + + S+
Sbjct: 156 LVSGGNDRTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQAPVVSVDVQGDRILSASY 215

Query: 79  DSTVSIWA-----------------KEESA---DRTFEMD--------LLAIIEGHENEV 110
           D+++  W+                 K  SA    R   M          L+++E H+  V
Sbjct: 216 DNSIGFWSTNHKDMTAVDPMDSLGDKASSAAKKRRKLTMKDGSVRRRAPLSLLESHKAPV 275

Query: 111 KGVAW-SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLA 169
           + V + SND     + S+D ++  W+   S     C+   +  S  +  ++  P   LLA
Sbjct: 276 EQVIFASNDSTVAYSVSQDHTIKTWDLVTS----RCVDT-KSTSYSLLSMVELPKLRLLA 330

Query: 170 SSSYDDTVRIWKDYDDDWECVAV--LNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
             S    + +     D    +    L GH+  V + D    E  + LCS S D TV+VW
Sbjct: 331 CGSSARHITLHDPRADSSAKITQQQLLGHKNFVVALD-TCPENEYMLCSASHDGTVKVW 388

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 68/165 (41%), Gaps = 42/165 (25%)

Query: 55  TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKE-------ESADRTFEMDLLAIIEGHE 107
           + H  A+R+V +   T L++ G+ D T+ +W  +       +  + T E   LAI+EGH+
Sbjct: 139 SGHTGAVRAVKFISSTRLVSGGN-DRTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQ 197

Query: 108 NEVKGVAWSNDGYYLATCSRDKSVWIWET------------------------------- 136
             V  V    D   + + S D S+  W T                               
Sbjct: 198 APVVSVDVQGD--RILSASYDNSIGFWSTNHKDMTAVDPMDSLGDKASSAAKKRRKLTMK 255

Query: 137 DESGEEYECISVLQEHSQDVKHVIWHPSEALLA-SSSYDDTVRIW 180
           D S      +S+L+ H   V+ VI+  +++ +A S S D T++ W
Sbjct: 256 DGSVRRRAPLSLLESHKAPVEQVIFASNDSTVAYSVSQDHTIKTW 300

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 6/65 (9%)

Query: 168 LASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
           + S SYD  VR W   +   +     +GH G V +  F  +    RL SG +D T+R+WK
Sbjct: 116 IVSGSYDGVVRTW---NLSGKIEKQYSGHTGAVRAVKFISST---RLVSGGNDRTLRLWK 169

Query: 228 YMGDD 232
              DD
Sbjct: 170 TKNDD 174

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 16/75 (21%)

Query: 164 SEALLASSSYDDTVRIWKDYDDDWECV------------AVLNGHEGTVWSSDFDKTEGV 211
           S   L S   D T+R+WK  +DD + V            A+L GH+  V S D       
Sbjct: 152 SSTRLVSGGNDRTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQAPVVSVDVQGD--- 208

Query: 212 FRLCSGSDDSTVRVW 226
            R+ S S D+++  W
Sbjct: 209 -RILSASYDNSIGFW 222

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 115/298 (38%), Gaps = 74/298 (24%)

Query: 71  SLLAAGSFDSTVSIWAKEES----------ADRTFEMDLLAI--IEGHENEVKGVAWSND 118
           ++L  GS D+T+ +W    S           ++T E+    I   E H++E+   A S D
Sbjct: 392 NMLITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEI--TALSFD 449

Query: 119 GYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEAL----------- 167
              L + SRDK ++ W+        +CI  L          I  P+ +L           
Sbjct: 450 SEALVSGSRDKKIFHWDLTTG----KCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEA 505

Query: 168 ------------LASSSYDDTVRIWKDYDDDWEC---VAVLNGHEGTVWSSDFDKTEGVF 212
                       LA+ + D  VR+W     D      V +L GH   + S  FD      
Sbjct: 506 PMIGALQCYNSALATGTKDGIVRLW-----DLRVGKPVRLLEGHTDGITSLKFDSE---- 556

Query: 213 RLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGAD-- 270
           +L +GS D++VR+W           +    +IL DV    +   +  F+G + +VGA+  
Sbjct: 557 KLVTGSMDNSVRIW-----------DLRTSSIL-DVIAYDLPVSSLDFDGKLITVGANEG 604

Query: 271 GVLAVYEEVDGEWKVFAKRALCHG---VYEINVVKWLELNGKTILATGGDDGIVNFWS 325
           GV     E D  W          G      I +VK+ +      L  G +DG +N W+
Sbjct: 605 GVNVFNMERDEHWMTPEPPHSLDGDELSRRIAIVKYKD----GFLINGHNDGDINVWT 658

>CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces
           cerevisiae YGR200c subunit of elongating RNA polymerase
           II holoenzyme, start by similarity
          Length = 793

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 82/196 (41%), Gaps = 17/196 (8%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
            H+  +  V + P T +L + S D  V +W  +  A  + E++ +  I  + + +  +  
Sbjct: 56  GHEAEVTCVKFMPGTDILVSASEDHHVKLWKYK--APESEELECIQTITHYSHTIVSIET 113

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA-----LLAS 170
                 + +     S+W+ ET+  G +   IS      ++V  + +  S       LLA 
Sbjct: 114 LAGLIVIGSAGGLVSIWVPETE--GSDTYIISHEYSLPRNVFPLCFSLSNVVGNKYLLAI 171

Query: 171 SSYDDTVRIWK------DYDDDWECVAVLNGHEGTVWSSDF--DKTEGVFRLCSGSDDST 222
                 + I+          +++   A L GHE  V S  F   +T G + LCSGS D  
Sbjct: 172 GGTTVKIFIYSFVLSEGKVIENFNLAAELEGHEDWVKSIQFRHQETPGDYLLCSGSQDRY 231

Query: 223 VRVWKYMGDDEDDQQE 238
           +R+W+   +D  D  E
Sbjct: 232 IRIWRIRTNDLIDDSE 247

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 68/162 (41%), Gaps = 34/162 (20%)

Query: 26  ILATGSTDRKIKLVSVKYDDFTLIDVLDETA----HKKAIRSVAWR----PHTSLLAAGS 77
           +LA G T  KI + S    +  +I+  +  A    H+  ++S+ +R    P   LL +GS
Sbjct: 168 LLAIGGTTVKIFIYSFVLSEGKVIENFNLAAELEGHEDWVKSIQFRHQETPGDYLLCSGS 227

Query: 78  FDSTVSIWAK------EESADRTFEMDLL--------------------AIIEGHENEVK 111
            D  + IW        ++S D   ++ LL                    A+I GH++ V 
Sbjct: 228 QDRYIRIWRIRTNDLIDDSEDDETKLTLLSSKQHKFHISEDLRIGINFEALIIGHDDWVS 287

Query: 112 GVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHS 153
            + W      L   + D +V IWE DES   + C S L E S
Sbjct: 288 SLQWHESKLQLLASTADTAVMIWEPDESSGVWVCSSRLGEMS 329

 Score = 36.6 bits (83), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 99/238 (41%), Gaps = 53/238 (22%)

Query: 72  LLAAGSFDSTVSIWAKEESADRTFE-MDLLAIIEGHENEVKGVAWSND----GYYLATCS 126
           LLA G     + I++   S  +  E  +L A +EGHE+ VK + + +      Y L + S
Sbjct: 168 LLAIGGTTVKIFIYSFVLSEGKVIENFNLAAELEGHEDWVKSIQFRHQETPGDYLLCSGS 227

Query: 127 RDKSVWIWET------DESGEEYECISVL--QEH----SQDVKHVI-------------- 160
           +D+ + IW        D+S ++   +++L  ++H    S+D++  I              
Sbjct: 228 QDRYIRIWRIRTNDLIDDSEDDETKLTLLSSKQHKFHISEDLRIGINFEALIIGHDDWVS 287

Query: 161 ---WHPSEALLASSSYDDTVRIWKDYDDD--WECVAVL-----------NGHEGTVWSSD 204
              WH S+  L +S+ D  V IW+  +    W C + L            G  G  WS  
Sbjct: 288 SLQWHESKLQLLASTADTAVMIWEPDESSGVWVCSSRLGEMSSKGASTATGSSGGFWSCL 347

Query: 205 FDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNG 262
           + +  G   + +     + R+W+   +   +Q+  +  A+ P      V +VAW   G
Sbjct: 348 WFEENGADYILTNGKTGSWRIWEAKDEIMCEQRVGITGAVRP------VTDVAWAPCG 399

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 88/245 (35%), Gaps = 47/245 (19%)

Query: 26  ILATGSTDRKIKLVSVKYDDF--------TLIDVLDETAHKKAIR--------------- 62
           +L +GS DR I++  ++ +D         T + +L    HK  I                
Sbjct: 222 LLCSGSQDRYIRIWRIRTNDLIDDSEDDETKLTLLSSKQHKFHISEDLRIGINFEALIIG 281

Query: 63  ------SVAWRPHTSLLAAGSFDSTVSIWAKEESA------DRTFEMDL--LAIIEGHEN 108
                 S+ W      L A + D+ V IW  +ES+       R  EM     +   G   
Sbjct: 282 HDDWVSSLQWHESKLQLLASTADTAVMIWEPDESSGVWVCSSRLGEMSSKGASTATGSSG 341

Query: 109 EVKGVAW--SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA 166
                 W   N   Y+ T  +  S  IWE  +     + + +     + V  V W P   
Sbjct: 342 GFWSCLWFEENGADYILTNGKTGSWRIWEAKDEIMCEQRVGITGA-VRPVTDVAWAPCGK 400

Query: 167 LLASSSYDDTVRIWKD--YDDDWECVAVLNGHE---GTVWSSDFDKTEGVF--RLCSGSD 219
            L S+S D T R++    Y+++ E  +    HE     +   D    E V   R  SG D
Sbjct: 401 YLLSTSLDQTTRLFAPWIYNENNELRSRKTWHEFSRPQIHGYDMICVEPVNDERFISGGD 460

Query: 220 DSTVR 224
           +  +R
Sbjct: 461 EKILR 465

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 9/85 (10%)

Query: 55  TAHKKAIRSVAWRPHTS-LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGV 113
           T H + +  + + P    +LA+ S D TV IW  E   D  +++        H + V  +
Sbjct: 136 TGHSRKVGHILYHPTAKDVLASSSLDYTVRIWNVETGED-IYKLK-------HPDMVTSM 187

Query: 114 AWSNDGYYLATCSRDKSVWIWETDE 138
           ++S DG +LAT +RDK + +W   E
Sbjct: 188 SFSYDGTHLATVARDKKLRVWNVRE 212

>Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement
          Length = 587

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 106 HENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP 163
           H  EV G+++  DG  LA+ S D SV IW+T  S  ++    V + H+  VK + W P
Sbjct: 374 HSGEVCGLSYRKDGLQLASGSNDNSVMIWDTRTSMPQF----VKRNHTAAVKAISWCP 427

>Sklu_1880.3 YDR364C, Contig c1880 4293-5708
          Length = 471

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 93/218 (42%), Gaps = 22/218 (10%)

Query: 56  AHKKAIRSVAWRPHTS-LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
            H      + + P T  L  +G  D+ ++IW      D   E  LL    GH   V+ + 
Sbjct: 176 GHVNGTTKLKFLPETGHLFLSGGNDNVINIW------DMYHERTLLRDYRGHRKAVRDIN 229

Query: 115 WSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPS---EALLASS 171
           +++DG    + S D+++ +W+T E+G   +  S L+ HS       +HP+   E ++  S
Sbjct: 230 FNSDGTEFLSVSFDQTLKVWDT-ETG---KVKSRLKWHSVP-NCATYHPTNNNEYIVGLS 284

Query: 172 SYDDTVRIWKDYDDDWE-CVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMG 230
             +  +R +     + E  +   N H  ++ S  +      F   S S+D TVR+W+   
Sbjct: 285 --NSEIRHYDSRVSNKEGLIQTYNHHLSSIISLKYFPDGSKF--ISSSEDKTVRIWENQV 340

Query: 231 DDEDDQQEWVCEAILP--DVHKRQVYNVAWGFNGLIAS 266
           +    Q     +  +P  ++H  Q Y  A   +  I S
Sbjct: 341 NIPIKQISDTSQYSMPYLEIHPEQHYFSAQSMDNAIYS 378

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 61/141 (43%), Gaps = 12/141 (8%)

Query: 43  YDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAI 102
           Y + TL+   D   H+KA+R + +    +   + SFD T+ +W  E          + + 
Sbjct: 209 YHERTLLR--DYRGHRKAVRDINFNSDGTEFLSVSFDQTLKVWDTETGK-------VKSR 259

Query: 103 IEGHE-NEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIW 161
           ++ H          +N+  Y+   S +  +  +++  S +E   I     H   +  + +
Sbjct: 260 LKWHSVPNCATYHPTNNNEYIVGLS-NSEIRHYDSRVSNKE-GLIQTYNHHLSSIISLKY 317

Query: 162 HPSEALLASSSYDDTVRIWKD 182
            P  +   SSS D TVRIW++
Sbjct: 318 FPDGSKFISSSEDKTVRIWEN 338

>Scas_571.4
          Length = 601

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 63/136 (46%), Gaps = 18/136 (13%)

Query: 55  TAHKKAIRSVAWRPH-TSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGV 113
           + H + +  V + P   ++LA+ S D TV IW  ++         ++  ++ H + V  +
Sbjct: 145 SGHTRKVGHVLFHPRIRNVLASSSLDFTVKIWNIKKGK-------VIGTLQ-HSDMVTAM 196

Query: 114 AWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHS-QDVKHVIWHPSEALLA--- 169
           A+  DG YLAT +R+K + IW+        + +S  + H     + V+W     ++A   
Sbjct: 197 AFDPDGAYLATITRNKKLTIWDI----ASKQIVSQTKSHQGPKNQRVVWLGYSRIIATTG 252

Query: 170 -SSSYDDTVRIWKDYD 184
            S S D  + IW   D
Sbjct: 253 FSKSMDREIGIWDALD 268

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 16/98 (16%)

Query: 98  DLLAIIEGHENEVKGVAWS--NDGYYLATCSRDKSVWIW------------ETDESGEEY 143
           D +++  GH+ +V    +   ND + +A+ S D  + IW            +++    + 
Sbjct: 80  DHVSLFRGHKGQVLDTDFDPFND-FKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMDI 138

Query: 144 ECISVLQEHSQDVKHVIWHPS-EALLASSSYDDTVRIW 180
               +L  H++ V HV++HP    +LASSS D TV+IW
Sbjct: 139 RPSKILSGHTRKVGHVLFHPRIRNVLASSSLDFTVKIW 176

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 190 VAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           V++  GH+G V  +DFD     F++ S SDD  + +W
Sbjct: 82  VSLFRGHKGQVLDTDFDPFND-FKIASASDDGKIGIW 117

>AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH]
           (424004..425659) [1656 bp, 551 aa]
          Length = 551

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 107/238 (44%), Gaps = 28/238 (11%)

Query: 7   IKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETA--HKKAIRSV 64
           I++L  + +++    ++Q IL++GS D KI      + D  + +   ETA  H + +  +
Sbjct: 322 IRTLSGHLDRVACLSWNQHILSSGSKDHKI-----LHRDVRMPEHYFETANTHSQEVCGL 376

Query: 65  AWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS-NDGYYLA 123
            W    + LA+G  D+ V ++      D   +  +L   E H   VK +AWS +    LA
Sbjct: 377 KWNVDENRLASGGNDNVVYVY------DGPSKKPVLKFTE-HNAAVKAMAWSPHRRATLA 429

Query: 124 T--CSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-SEALLASSSYDD-TVRI 179
           T   + D+ + IW  + SG     +    +    V +++W   ++ ++ S  Y    + +
Sbjct: 430 TGGGTADRRLKIWNVN-SGVRLNDV----DTGSQVCNMVWSKNTDEIVTSHGYSKFNLTL 484

Query: 180 WKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQ 237
           W       E +AVL GH   V       T+G   + SG+ D T+R WK  G  +   Q
Sbjct: 485 WD--CPTLEPLAVLKGHSFRVLHLTL-STDGTT-IVSGAGDETLRYWKLFGKSKFGNQ 538

>CAGL0L09647g 1032740..1034029 highly similar to sp|P35184
           Saccharomyces cerevisiae YIR012w SQT1, start by
           similarity
          Length = 429

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 48/110 (43%), Gaps = 12/110 (10%)

Query: 57  HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS 116
           H  ++  VA  P   L+A+G  D+ + +W       +         + GH   V    ++
Sbjct: 63  HTDSVFVVAHHPSLPLVASGGADNVIHLWTSHSQPPK-----FAGTLSGHTESVIAAHFT 117

Query: 117 NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIW---HP 163
            DG +L +      + +  + + G +++ +S LQE    V+ +IW   HP
Sbjct: 118 PDGKFLVSADMTGKLLVHASVKGGAQWKLVSELQE----VEEIIWLKVHP 163

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 35/80 (43%), Gaps = 9/80 (11%)

Query: 135 ETDESGEEYECISV---------LQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDD 185
           E  E GE  E I V           +H+  V  V  HPS  L+AS   D+ + +W  +  
Sbjct: 37  EAMEGGEVEETIEVDLSNNSRTYFDKHTDSVFVVAHHPSLPLVASGGADNVIHLWTSHSQ 96

Query: 186 DWECVAVLNGHEGTVWSSDF 205
             +    L+GH  +V ++ F
Sbjct: 97  PPKFAGTLSGHTESVIAAHF 116

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 99/228 (43%), Gaps = 30/228 (13%)

Query: 95  FEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQ 154
           ++ +L+  + GHE  +  +  S     +A+CS D+S+ +W+  E+G+E   +S+   H+ 
Sbjct: 167 YKEELIHNLTGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDR-ETGKE---LSIGWSHTA 222

Query: 155 DVKHVIWHPSEALLASSSYDDTVRIWKDYDDD-----WECVAVLNGH-EGTVWSSDFDKT 208
            + ++ +  ++  L S S D T R+W    +D      +   +  GH    VW  D +  
Sbjct: 223 RIWNLKFFNNDENLVSVSEDCTCRVWNIIPNDISGYELQISNIFEGHLLKNVWGVDVNDE 282

Query: 209 EGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQ---------VYNVAWG 259
           + +  + +  +D  + V   +  D +   E +   I  D+ K           +    W 
Sbjct: 283 KRI--IATSGNDGRINVID-LNTDTNSGDEVIGYEI-ADIEKAAGISFEKDEIIKGFYWF 338

Query: 260 FNGLIASVGADGVLAVYEEVDGEWKV------FAKRALCHGVYEINVV 301
             GL+       VLA   E   +W+       FA  ++ +G+YE N+V
Sbjct: 339 KFGLVCITSQGRVLAFQTETK-QWRQCLLDSRFASYSITNGIYESNIV 385

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 45/101 (44%), Gaps = 10/101 (9%)

Query: 55  TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
           T H+ +I  +    H  L+A+ S D ++ +W +E   +       L+I   H   +  + 
Sbjct: 176 TGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDRETGKE-------LSIGWSHTARIWNLK 228

Query: 115 WSNDGYYLATCSRDKSVWIWE---TDESGEEYECISVLQEH 152
           + N+   L + S D +  +W     D SG E +  ++ + H
Sbjct: 229 FFNNDENLVSVSEDCTCRVWNIIPNDISGYELQISNIFEGH 269

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 105/226 (46%), Gaps = 36/226 (15%)

Query: 110 VKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQE----HSQDVKHVIWHPSE 165
           +  + +S DG  L   +    V I  TD +G+  E   ++ E    +S  +K  +   SE
Sbjct: 94  ITAIEFSKDGSKLYILTNYNKVLI--TDLTGKVVEEKKLVGERSILYSGSIK--VISESE 149

Query: 166 ALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVW---SSDFDKTEGVFRLCSGSDDST 222
             + + +      +W  Y +  E +  L GHEG+++   SS+ +K      + S SDD +
Sbjct: 150 VQINAGTVMGGAIVWDLYKE--ELIHNLTGHEGSIFYIQSSEHNKL-----IASCSDDRS 202

Query: 223 VRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNG--LIASVGADGVLAVYEEVD 280
           +R+W    D E  ++  +  +     H  +++N+ + FN    + SV  D    V+  + 
Sbjct: 203 IRLW----DRETGKELSIGWS-----HTARIWNLKF-FNNDENLVSVSEDCTCRVWNIIP 252

Query: 281 GEWKVFAKRALCHGVYEINVVK---WLELNG-KTILATGGDDGIVN 322
            +   +  +     ++E +++K    +++N  K I+AT G+DG +N
Sbjct: 253 NDISGYELQI--SNIFEGHLLKNVWGVDVNDEKRIIATSGNDGRIN 296

>KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces
           cerevisiae YML102w CAC2 chromatin assembly complex,
           subunit p60, start by similarity
          Length = 493

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 64/156 (41%), Gaps = 20/156 (12%)

Query: 49  IDVLDE-TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMD--------- 98
           ID L   T H++A+    +      LA    D  + +W K E+  + F +D         
Sbjct: 61  IDFLSSLTQHEQAVNVCRFNKQGDTLATAGDDGLLLLWKKNETMVKEFGVDDDEFQDFKE 120

Query: 99  ------LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEH 152
                  L        E+  ++W+  G  +A  S D +V ++  D+     + +  + EH
Sbjct: 121 SWAVWKRLRSGSASNAEIYDISWNPQGTCIAIASLDNTVRVFNVDQG----KVVGHITEH 176

Query: 153 SQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWE 188
           +  V+ ++W P    + S S D ++ I K   +D E
Sbjct: 177 NHYVQGIVWDPQGEFIVSQSADRSLAICKMIYEDNE 212

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 62/268 (23%), Positives = 100/268 (37%), Gaps = 76/268 (28%)

Query: 60  AIRSVAWRP------HTSLLAAGSFDSTVSIWAKEESAD--RTFEMDLLAIIEGHENEVK 111
            I S+ ++P      +T  L     D+ + +W   ES +  +   +D L+ +  HE  V 
Sbjct: 16  PIYSLCFQPLSETNQNTRRLFTSGGDNKIRVWQLNESENDGKIETIDFLSSLTQHEQAVN 75

Query: 112 GVAWSNDGYYLATCSRDKSVWIWETDESG-EEYECISVLQEHSQDVKH--VIWHPSEALL 168
              ++  G  LAT   D  + +W+ +E+  +E+    V  +  QD K    +W   + L 
Sbjct: 76  VCRFNKQGDTLATAGDDGLLLLWKKNETMVKEF---GVDDDEFQDFKESWAVW---KRLR 129

Query: 169 ASSSYDDTVRIWKDYDDDWE----CVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVR 224
           + S+ +  +     YD  W     C+A+                         S D+TVR
Sbjct: 130 SGSASNAEI-----YDISWNPQGTCIAI------------------------ASLDNTVR 160

Query: 225 VWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNG-LIASVGADGVLAVYEEVDGEW 283
           V+        DQ + V        H   V  + W   G  I S  AD  LA+        
Sbjct: 161 VFNV------DQGKVVGHIT---EHNHYVQGIVWDPQGEFIVSQSADRSLAI-------- 203

Query: 284 KVFAKRALCHGVYEINVVKWLELNGKTI 311
                   C  +YE N VK L+L  K +
Sbjct: 204 --------CKMIYEDNEVKGLQLVNKIL 223

>Scas_558.3
          Length = 725

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 83/174 (47%), Gaps = 25/174 (14%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEV---KG 112
            H   + +++++ H S + +GS+D+T  +W             L   +EGH+  V   K 
Sbjct: 100 GHHSNVCALSYK-HMSAIISGSWDTTAKVWINGA---------LQWSLEGHQASVWDAKI 149

Query: 113 VAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSS 172
           ++   + +   T S D++V +W+ ++  + +  I     HS  ++++    S   +A+ S
Sbjct: 150 ISVEENTF--ITASADRTVKLWKENKLLKTFSGI-----HSDVIRNIEVLSSGKEIATCS 202

Query: 173 YDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            D T++I    D D     VL+GHE  V++    K     +L S  +D ++R+W
Sbjct: 203 NDGTIKI---SDLDGNIKQVLSGHESFVYNVKLSKQGD--KLVSCGEDRSLRIW 251

 Score = 35.4 bits (80), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 76/177 (42%), Gaps = 20/177 (11%)

Query: 9   SLKLYKEKIWS---FDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVA 65
           SL+ ++  +W        +    T S DR +KL    + +  L+       H   IR++ 
Sbjct: 136 SLEGHQASVWDAKIISVEENTFITASADRTVKL----WKENKLLKTF-SGIHSDVIRNIE 190

Query: 66  WRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATC 125
                  +A  S D T+ I           + ++  ++ GHE+ V  V  S  G  L +C
Sbjct: 191 VLSSGKEIATCSNDGTIKI--------SDLDGNIKQVLSGHESFVYNVKLSKQGDKLVSC 242

Query: 126 SRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKD 182
             D+S+ IW+ + +   +    V++  +  +  V   P+  ++   S D+TVRI+ +
Sbjct: 243 GEDRSLRIWDINNN---FNIKQVIKLPAVSIWCVDTLPNGDIVVGCS-DNTVRIFTE 295

 Score = 32.3 bits (72), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 61/135 (45%), Gaps = 17/135 (12%)

Query: 99  LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQE------- 151
           L A + GH  +VK +   +D   +A+ SRD ++ +W+ +++G   + +    E       
Sbjct: 4   LSATLLGHTQDVKDIVVIDDSQ-VASVSRDGTLRLWKHNDNGTWQDIVMATSEKFLNAVC 62

Query: 152 HSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGV 211
           + +D + + +   E+L+   S  D   I KD       +  L GH   V +  +     +
Sbjct: 63  YDKDHELLFYSGQESLINGVSLLDIESIDKD------PLYTLIGHHSNVCALSYKHMSAI 116

Query: 212 FRLCSGSDDSTVRVW 226
               SGS D+T +VW
Sbjct: 117 I---SGSWDTTAKVW 128

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 143 YECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDD 185
           Y+  + L  H+QDVK ++    ++ +AS S D T+R+WK  D+
Sbjct: 2   YQLSATLLGHTQDVKDIVV-IDDSQVASVSRDGTLRLWKHNDN 43

>Scas_693.36
          Length = 375

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 64/142 (45%), Gaps = 23/142 (16%)

Query: 16  KIWSFDFSQ---GILATGSTDRKIKL----VSVKYDDFTLIDVLDETAHKKAIRSVAWRP 68
           ++ S DF++    +LAT   D  I++    + V  D    I+ +   AH  A+R V W P
Sbjct: 231 EVLSADFNKYRPNVLATAGVDNSIRIWDFRMLVARDAAICINEI-VNAHDLAVRKVVWSP 289

Query: 69  HTS-LLAAGSFDSTVSIW-------AKEESADRTFEMDLLA-----IIEGHENEVKGVAW 115
           H S +L + S+D +  IW        ++    +T  +D        I+  H   V G  W
Sbjct: 290 HHSDILLSTSYDMSCKIWNDLSYDPIQQRKTGKTNSLDFTGNGCRFIMNQHTEFVFGADW 349

Query: 116 SNDGY--YLATCSRDKSVWIWE 135
           S  G   Y+A+   D +V+IW 
Sbjct: 350 SMWGQPGYVASTGWDGNVFIWN 371

 Score = 36.2 bits (82), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 4/69 (5%)

Query: 122 LATCSRDKSVWIWETDE--SGEEYECIS-VLQEHSQDVKHVIWHPSEA-LLASSSYDDTV 177
           LAT   D S+ IW+     + +   CI+ ++  H   V+ V+W P  + +L S+SYD + 
Sbjct: 245 LATAGVDNSIRIWDFRMLVARDAAICINEIVNAHDLAVRKVVWSPHHSDILLSTSYDMSC 304

Query: 178 RIWKDYDDD 186
           +IW D   D
Sbjct: 305 KIWNDLSYD 313

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 56/134 (41%), Gaps = 20/134 (14%)

Query: 66  WRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS-NDGYYLAT 124
           +RP  ++LA    D+++ IW       R   + +  I+  H+  V+ V WS +    L +
Sbjct: 240 YRP--NVLATAGVDNSIRIWDFRMLVARDAAICINEIVNAHDLAVRKVVWSPHHSDILLS 297

Query: 125 CSRDKSVWIW--------ETDESGEEYE-------CISVLQEHSQDVKHVIWH--PSEAL 167
            S D S  IW        +  ++G+          C  ++ +H++ V    W        
Sbjct: 298 TSYDMSCKIWNDLSYDPIQQRKTGKTNSLDFTGNGCRFIMNQHTEFVFGADWSMWGQPGY 357

Query: 168 LASSSYDDTVRIWK 181
           +AS+ +D  V IW 
Sbjct: 358 VASTGWDGNVFIWN 371

 Score = 28.9 bits (63), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 31/67 (46%), Gaps = 5/67 (7%)

Query: 146 ISVLQEHSQDVKHVIWHP-SEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSD 204
           I++  EH ++V    W+  ++ +  SSS+D TV+IW     +    ++L       W   
Sbjct: 97  IAIFNEHKKEVMSCNWNLINKTMFTSSSWDGTVKIWSPTRKE----SLLTLRPTPKWKKH 152

Query: 205 FDKTEGV 211
            D  E +
Sbjct: 153 LDSMEPI 159

>Sklu_2317.3 YDR142C, Contig c2317 5804-6910
          Length = 368

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 59/129 (45%), Gaps = 18/129 (13%)

Query: 26  ILATGSTDRKIKL----VSVKYDDF--TLIDVLDETAHKKAIRSVAWRPHTS-LLAAGSF 78
           I+ATG  D+ +K+    +  K+ +     + + +   H+ AIR V+W PH S L+ + S+
Sbjct: 237 IVATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSNLVLSTSY 296

Query: 79  DSTVSIW-----AKEESADRTFEMDLLA----IIEGHENEVKGVAWS--NDGYYLATCSR 127
           D T  +W     +      +T  +D       I   H   V G  WS      Y+A+ + 
Sbjct: 297 DMTCRVWDDLSDSNGRPTGKTNSIDPTKGCRFIFPHHTEFVFGADWSLWGQPGYVASTAW 356

Query: 128 DKSVWIWET 136
           D +V IW T
Sbjct: 357 DGNVCIWHT 365

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 7/73 (9%)

Query: 120 YYLATCSRDKSVWIWET------DESGEEYECISVLQEHSQDVKHVIWHPSEA-LLASSS 172
           + +AT   DK V IW+           ++   I+ +  H   ++ V W P  + L+ S+S
Sbjct: 236 HIVATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSNLVLSTS 295

Query: 173 YDDTVRIWKDYDD 185
           YD T R+W D  D
Sbjct: 296 YDMTCRVWDDLSD 308

 Score = 28.9 bits (63), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 16/78 (20%)

Query: 104 EGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWH- 162
           EGH N+V  +A   DG          S+ +++ +    +Y  IS+ QEH ++V    W+ 
Sbjct: 70  EGHANQV--LAAQGDG----------SLRLFDINL--PQYP-ISIFQEHQKEVFSCNWNL 114

Query: 163 PSEALLASSSYDDTVRIW 180
            ++    SSS+D TV+IW
Sbjct: 115 VNKQTFVSSSWDGTVKIW 132

>Scas_719.52
          Length = 628

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 97/239 (40%), Gaps = 44/239 (18%)

Query: 20  FD-FSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTS------- 71
           FD F+  I+A+ S D KI +  +  +D++    LD     K I+ V +    S       
Sbjct: 89  FDPFNDHIIASSSDDSKIGIWKIP-EDYSFQHYLDPDGEPKNIKPVKFLSGHSRKVGHVL 147

Query: 72  -------LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLAT 124
                  +LA+ S D TV +W          E     I   H + V  +++S  G +LAT
Sbjct: 148 FHPVAENVLASSSLDYTVKLW--------NIETGEAVITLKHPDMVTSMSFSYGGNHLAT 199

Query: 125 CSRDKSVWIWETDESGEEYECISVLQEHS-QDVKHVIWHPSEALLASSSYDDTVRIWKDY 183
             RDK + +W+  E     + +S    H+    + V+W  +   LA++ +    R+    
Sbjct: 200 VCRDKKLRVWDIREG----KIVSEGPAHAGAKNQRVVWLGNSDRLATTGFS---RLSDRQ 252

Query: 184 DDDWECVAVLNGHEGTVWSSDFDKTEGVFRL----------CSGSDDSTVRVWKYMGDD 232
              W+   +  G  G  ++   D++ G+              +G  D  +R +++  D+
Sbjct: 253 IGIWDAFNLEKGDLGGFYT--VDQSSGILMPFYDDGNKILYLAGKGDGNIRYYEFQNDE 309

>KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1
           Kluyveromyces lactis heterotrimeric G protein beta
           subunit, start by similarity
          Length = 436

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 64/136 (47%), Gaps = 12/136 (8%)

Query: 96  EMDLLAI--IEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHS 153
           E++L  +  ++GH N++  V WS D   + + S+D  + IW+   +G +   I +L   S
Sbjct: 73  ELNLQPVRTLKGHNNKISDVKWSQDSASVLSSSQDGFIIIWDP-FTGLKKSAIPLL---S 128

Query: 154 QDVKHVIWHPSEALLASSSYDD---TVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEG 210
           Q V      PS  L+AS+  D+     R+ +D       +++  GH   + +++F     
Sbjct: 129 QWVLSSAISPSGNLVASAGLDNHCSVYRVSRDNRIQQNVISIFKGHTCYISATEFLDERT 188

Query: 211 VFRLCSGSDDSTVRVW 226
           +    + S D T  +W
Sbjct: 189 IL---TASGDMTCAMW 201

>Scas_442.2*
          Length = 795

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 54/116 (46%), Gaps = 13/116 (11%)

Query: 70  TSLLAAGSFDSTVSIWAK-EESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRD 128
           T ++A G+   T+++W   +E++   F     A ++GHE EV  V +  D  Y+ +CS D
Sbjct: 27  THIVAFGA-GQTIALWNPLDENSQGVF-----ATLKGHEAEVTCVKFITDTPYMVSCSED 80

Query: 129 KSVWIWETDESGEE----YECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
             V IW+ +         + C+  L  +S  V  +   P   L+A    D  V +W
Sbjct: 81  HHVKIWKQNPGVAREVDGWTCVQTLDHYSHTVVALAVLP--GLIAVGCADGKVSLW 134

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 55/252 (21%), Positives = 109/252 (43%), Gaps = 41/252 (16%)

Query: 7   IKSLKLYKEKIWSFDFSQGILATGSTDRKIKL--VSVKYDDFTLIDVLDETAHKKAIRSV 64
           +++L  Y   + +     G++A G  D K+ L    +K D F L +   E   +K +  +
Sbjct: 102 VQTLDHYSHTVVALAVLPGLIAVGCADGKVSLWVQKMKEDVFILGE---EFEVQKGVLPL 158

Query: 65  AWR-----PHTSLLAAGSFDSTVSIWA--KEESADRTFEMDLLAIIEGHENEVKGVAWSN 117
           A           LLA G  +  V +++     +A+    + L A +EGHE+ +K +A+ +
Sbjct: 159 ALAFSKVIDDKYLLAVGGTNVNVFVFSFVLNATAETIETLQLAAKLEGHEDWIKSLAFRH 218

Query: 118 D----GYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSY 173
                 Y L + S+D+ + +W    +    + +    E  +D+   +     ALL +  Y
Sbjct: 219 QETPGDYLLCSGSQDRYIRLWRIRIN----DLMKKQDEDDEDIATKL-----ALLNNKQY 269

Query: 174 D----DTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYM 229
                D +R+  +++      A++ GH+   W S     E   +L + + D+ + VW   
Sbjct: 270 KFHVTDALRVCINFE------ALIMGHDD--WISSLQWHETRLQLLASTADTALMVW--- 318

Query: 230 GDDEDDQQEWVC 241
            + ++    WVC
Sbjct: 319 -EPDEASGIWVC 329

 Score = 36.2 bits (82), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 66/163 (40%), Gaps = 13/163 (7%)

Query: 76  GSFD--STVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKS--- 130
           GS+D    ++   KE+   R      +  + GH  E+  +  S DG ++A+  R  +   
Sbjct: 535 GSYDMLGELTTPPKEDQLQRHLLWPEIEKLYGHGYEITCLDVSPDGKFIASACRSNTPQH 594

Query: 131 --VWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW-KDYDDDW 187
             V I+ TD      E    L  H+  V  + + P    L S   D    +W +D + D 
Sbjct: 595 AVVRIFNTDN---WLEVKPPLAFHTLTVTKLRFSPDSKYLLSVCRDRQWVVWERDPETDK 651

Query: 188 ECVA--VLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKY 228
             +       H   +W  D+   E      +GS D T+++WK+
Sbjct: 652 FTLKYKTAKPHTRIIWDGDWAPLEFGNVFVTGSRDRTIKLWKF 694

 Score = 32.7 bits (73), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 64/146 (43%), Gaps = 7/146 (4%)

Query: 176 TVRIWKDYDDDWECV-AVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDED 234
           T+ +W   D++ + V A L GHE  V    F         CS  +D  V++WK       
Sbjct: 37  TIALWNPLDENSQGVFATLKGHEAEVTCVKFITDTPYMVSCS--EDHHVKIWKQNPGVAR 94

Query: 235 DQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGE--WKVFAKRALC 292
           +   W C   L D +   V  +A    GLIA   ADG ++++ +   E  + +  +  + 
Sbjct: 95  EVDGWTCVQTL-DHYSHTVVALA-VLPGLIAVGCADGKVSLWVQKMKEDVFILGEEFEVQ 152

Query: 293 HGVYEINVVKWLELNGKTILATGGDD 318
            GV  + +     ++ K +LA GG +
Sbjct: 153 KGVLPLALAFSKVIDDKYLLAVGGTN 178

 Score = 32.3 bits (72), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 66/318 (20%), Positives = 114/318 (35%), Gaps = 55/318 (17%)

Query: 26  ILATGSTDRKIKLVSVKYDDFT-LIDVLDETA----HKKAIRSVAWR----PHTSLLAAG 76
           +LA G T+  + + S   +     I+ L   A    H+  I+S+A+R    P   LL +G
Sbjct: 171 LLAVGGTNVNVFVFSFVLNATAETIETLQLAAKLEGHEDWIKSLAFRHQETPGDYLLCSG 230

Query: 77  SFDSTVSIW----------AKEESADRTFEMDLL--------------------AIIEGH 106
           S D  + +W            E+  D   ++ LL                    A+I GH
Sbjct: 231 SQDRYIRLWRIRINDLMKKQDEDDEDIATKLALLNNKQYKFHVTDALRVCINFEALIMGH 290

Query: 107 ENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHV------- 159
           ++ +  + W      L   + D ++ +WE DE+   + C   L E S             
Sbjct: 291 DDWISSLQWHETRLQLLASTADTALMVWEPDEASGIWVCGLRLGELSSKGASTATGSAGG 350

Query: 160 ----IW--HPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFR 213
               +W  H ++  + ++    + R+W   + +  C   L     T   +D   +     
Sbjct: 351 FWSCLWFSHQNKDYILTNGKTGSWRVWTTEEGNTLCDQELGITGATKQVTDIAWSPKGEY 410

Query: 214 LCSGSDDSTVRV---WKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGAD 270
           L S S D T R+   W Y  D          E   P +H   +  V         S G +
Sbjct: 411 LLSTSLDQTTRLFAPWIYNNDGTKRNTATWHEFSRPQIHGYDMICVEPMSGARFVSGGDE 470

Query: 271 GVLAVYEEVDGEWKVFAK 288
            +L  ++E  G  ++  K
Sbjct: 471 KILRSFDEPKGVAELLQK 488

>CAGL0K03861g complement(359448..360989) highly similar to sp|Q04225
           Saccharomyces cerevisiae YMR131c Ribosome assembly
           protein, start by similarity
          Length = 513

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 84/188 (44%), Gaps = 23/188 (12%)

Query: 105 GHENEVKGVAWS-NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP 163
           G+   ++ + WS  +    AT   D  + +W+T  S +    ISV +  + DV  + W+ 
Sbjct: 321 GNNKSIEDIQWSKTESTVFATAGCDGYIRVWDT-RSKKHKPAISV-KASNTDVNVISWNE 378

Query: 164 SEALLASSSYD-------DTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCS 216
               L +S  D       D  +   D   + + VA  N H+G + S  F+  E    +  
Sbjct: 379 KIGYLLASGDDNGSWGVWDLRQFTPDNAANIQPVAQYNFHKGAITSIAFNPLEESI-VAV 437

Query: 217 GSDDSTVRVWKYM--GDDEDDQQEW----VCEAILPD---VH-KRQVYNVAW--GFNGLI 264
           GS+D+TV +W      DDE+ +Q+       + I P    VH ++++ +V W     G +
Sbjct: 438 GSEDNTVTLWDLSVEADDEEIKQQTEETKELKEIPPQLLFVHWQKEIKDVKWHKQIPGCL 497

Query: 265 ASVGADGV 272
            S G DG+
Sbjct: 498 VSTGTDGL 505

 Score = 32.0 bits (71), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 15/91 (16%)

Query: 57  HKKAIRSVAWRP-HTSLLAAGSFDSTVSIW------AKEESADRTFEMDLLAIIEGH--- 106
           HK AI S+A+ P   S++A GS D+TV++W        EE   +T E   L  I      
Sbjct: 418 HKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADDEEIKQQTEETKELKEIPPQLLF 477

Query: 107 ---ENEVKGVAWSND--GYYLATCSRDKSVW 132
              + E+K V W     G  ++T +   ++W
Sbjct: 478 VHWQKEIKDVKWHKQIPGCLVSTGTDGLNIW 508

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 78/178 (43%), Gaps = 23/178 (12%)

Query: 55  TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMD------LLAIIEGHEN 108
           + H   IR+V +   T L++AG+ D T+ +W  +    ++ + +       LAI+EGH+ 
Sbjct: 139 SGHSGPIRAVHYISSTRLVSAGN-DRTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKA 197

Query: 109 EVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALL 168
            V  +  S D    A+C  D +V +W T+   +E   I  +++   +V        +  L
Sbjct: 198 PVVSIDVSKDRILSASC--DNTVSLWSTNY--KEMTVIDPMEDLGGNVSTAAKKRRKLTL 253

Query: 169 ASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
                D ++R           +A+   H   V +  FDK++      S S D T++ W
Sbjct: 254 K----DGSIR-------RRAPLALFESHSAPVEAVIFDKSDDTVGY-SVSQDHTIKTW 299

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 12/92 (13%)

Query: 170 SSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYM 229
           S SYD  VR    Y+   +     +GH G + +  +  +    RL S  +D T+R+WK  
Sbjct: 118 SGSYDGIVRT---YNLSGKVEKQYSGHSGPIRAVHYISST---RLVSAGNDRTLRLWKTK 171

Query: 230 GD-----DEDDQQEWVCEAILPDVHKRQVYNV 256
            D     DE++ ++    AIL + HK  V ++
Sbjct: 172 NDDLKSIDEEEIEDGKTLAIL-EGHKAPVVSI 202

>YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translation
           initiation factor eIF3, p39 subunit, contains two WD
           (WD-40) repeats [1044 bp, 347 aa]
          Length = 347

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 149 LQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKT 208
           L  H + +  V ++    LL S S D +  +W  Y  + E +  L+GH GT+WS D D  
Sbjct: 6   LTGHERPLTQVKYNKEGDLLFSCSKDSSASVW--YSLNGERLGTLDGHTGTIWSIDVD-- 61

Query: 209 EGVFRLC-SGSDDSTVRVW 226
               + C +GS D ++++W
Sbjct: 62  -CFTKYCVTGSADYSIKLW 79

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 15/85 (17%)

Query: 55  TAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
           T H++ +  V +     LL + S DS+ S+W        +   + L  ++GH     G  
Sbjct: 7   TGHERPLTQVKYNKEGDLLFSCSKDSSASVW-------YSLNGERLGTLDGH----TGTI 55

Query: 115 WSND----GYYLATCSRDKSVWIWE 135
           WS D      Y  T S D S+ +W+
Sbjct: 56  WSIDVDCFTKYCVTGSADYSIKLWD 80

>Scas_692.25
          Length = 488

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 96/243 (39%), Gaps = 54/243 (22%)

Query: 25  GILATGSTDRKIKLV--SVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTV 82
            I+AT S D  IKL   S K + F L  VL    H  +   +  + +   LA+ S D+++
Sbjct: 202 AIIATSSKDLSIKLFRWSAKENKFLLFRVLMNHEHIVSEVKLFRKLNNIYLASCSRDTSI 261

Query: 83  SIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWI--WETDES- 139
            IW  E+         +L     H   V+ +  S D  ++ + S+D S+ +  W +    
Sbjct: 262 RIWTAEDGM-------ILNSFHPHNEWVRCLDVSGD--FVLSGSQDASLRLTHWPSGNGL 312

Query: 140 ----GEEYECISV-------LQEHSQDVKHVIWHPSE----------ALLASSSYDDTVR 178
               G E+   SV         E +    + +  P E             AS+S D  ++
Sbjct: 313 SIGIGHEFPIESVKFILPLSTNEKASPTINYLRKPLEIDSDYEKMSFKYCASASRDRLIK 372

Query: 179 IWK---------------DYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTV 223
           IW+                 + +++C+  L GH    W  D  +  G + L S SDD T+
Sbjct: 373 IWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHAS--WVKDL-RIRGNY-LFSCSDDKTI 428

Query: 224 RVW 226
           R W
Sbjct: 429 RCW 431

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 51/111 (45%), Gaps = 20/111 (18%)

Query: 43  YDDFTLIDVLDET-AHKKAIRSV----------AWRPHTSLLAAGSFDSTVSI--WAKEE 89
           YD F     LD T AH K I S+               ++++A  S D ++ +  W+ +E
Sbjct: 163 YDIFNYSLPLDSTQAHIKGITSIDAIMEFKNNNKTEEPSAIIATSSKDLSIKLFRWSAKE 222

Query: 90  SADRTFEMDLLAIIEGHENEVKGVAWSN--DGYYLATCSRDKSVWIWETDE 138
           +     +  L  ++  HE+ V  V      +  YLA+CSRD S+ IW  ++
Sbjct: 223 N-----KFLLFRVLMNHEHIVSEVKLFRKLNNIYLASCSRDTSIRIWTAED 268

>YER066W (YER066W) [1497] chr5 (290240..290797) Protein containing
           three WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has high similarity to a
           region of S. cerevisiae Cdc4p, which is a component of
           the SCF-Cdc4p complex involved in ubiquitin-dependent
           degradation [558 bp, 185 aa]
          Length = 185

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/143 (20%), Positives = 60/143 (41%), Gaps = 12/143 (8%)

Query: 188 ECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPD 247
           +C+ +L+GH   ++S+ +D      R  S S D+T+R+W       + +  +   +  P 
Sbjct: 2   KCLYILSGHTDRIYSTIYDHERK--RCISASMDTTIRIWDLENIRNNGECSYATNSASPC 59

Query: 248 VHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEWKV------FAKRALCHGVYEINVV 301
                      G   L+  +G      V   VDG  +       F K    H   ++N +
Sbjct: 60  AKILGAMYTLRGHRALVGLLGLSDKFLVSASVDGSIRCWDANTYFLKHFFDHT--QLNTI 117

Query: 302 KWLELNGKTILATGGDDGIVNFW 324
             L ++ + +++  G +G++N +
Sbjct: 118 TALHVSDEVLVS--GSEGLLNIY 138

 Score = 28.5 bits (62), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 144 ECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW--KDYDDDWEC 189
           +C+ +L  H+  +   I+        S+S D T+RIW  ++  ++ EC
Sbjct: 2   KCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGEC 49

>CAGL0J03344g complement(322226..323857) highly similar to sp|P40055
           Saccharomyces cerevisiae YER082c, hypothetical start
          Length = 543

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 47/96 (48%), Gaps = 8/96 (8%)

Query: 41  VKYDDFTLIDVLDETAHK-KAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDL 99
           +KY D +   ++ E   K     S+   P  +++  G  + TV++W+       +    L
Sbjct: 203 LKYHDVSTGQMVSELRTKLGPTTSMTHNPWNAVMHLGHSNGTVTLWSP------SMPEPL 256

Query: 100 LAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWE 135
           + ++ G    +  VA    GYY+AT S+DKS+ IW+
Sbjct: 257 VKLLSG-RGPINSVAVDRSGYYMATVSQDKSLKIWD 291

>Kwal_56.24478
          Length = 1296

 Score = 40.4 bits (93), Expect = 0.002,   Method: Composition-based stats.
 Identities = 47/216 (21%), Positives = 84/216 (38%), Gaps = 13/216 (6%)

Query: 18  WSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGS 77
           WS+D S   + TG+ D  +       +  ++  +   +   K +R  A + H  L + GS
Sbjct: 70  WSYDNS---VLTGALDNGVVEFFSPSEYKSIAKLAQHSTPVKTVRFNA-KQHNVLCSGGS 125

Query: 78  FDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS-NDGYYLATCSRDKSVWIWET 136
               + IW   +     +   +        +E+  +AW+ N G+  A+        IW+ 
Sbjct: 126 -KGEIYIWDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQGHVFASAGSSGFASIWDL 184

Query: 137 DESGE--EYECISVLQEHSQDVKHVIWHPSE----ALLASSSYDDTVRIWKDYDDDWECV 190
               E       S +      +  V WHP+     A  + S  D ++ +W   + +    
Sbjct: 185 KAKKEVIHLSHTSSITGQKNQLSIVEWHPNNSTRIATASGSDSDPSILVWDLRNANVPLQ 244

Query: 191 AVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            +  GH   V S D+ K +    L SG D+S V +W
Sbjct: 245 TLSQGHTKGVLSLDWCKQDETLLLSSGRDNSCV-LW 279

>AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146)
           [2931 bp, 976 aa]
          Length = 976

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 63/133 (47%), Gaps = 12/133 (9%)

Query: 73  LAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVW 132
           + AG+    V +W     A       ++  +EGHE  +     S+DG  +A+CS D+S+ 
Sbjct: 154 VCAGTVMGGVVVWELHTGA-------VVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIR 206

Query: 133 IWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAV 192
           +W   E+GE+   + +   H+  +  + +      L S S D T R+W    +  +  AV
Sbjct: 207 VWSL-ETGEQ---VGIAWGHTARIWDLRFLRVADKLVSVSEDCTCRVWAVGAERMQEEAV 262

Query: 193 LNGHEG-TVWSSD 204
            + H+  +VW+ D
Sbjct: 263 YDVHQTKSVWAVD 275

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 72/175 (41%), Gaps = 22/175 (12%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
            HK  + S++ +   + + + S+D T  +W    +       DL+    GH   V    +
Sbjct: 97  GHKGNVCSLSSK--NNFVISSSWDKTAKVWHNGSAI-----YDLV----GHSASVWDAKF 145

Query: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175
             +  +  T S D ++ +W  ++  + +  I     H   ++H+   P     AS S D 
Sbjct: 146 LPEKDFFLTASADCTIKLWHGNKLIKTFSGI-----HKDVIRHLDISPDGETFASCSNDG 200

Query: 176 TVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMG 230
           TV+I    D D   +    GHE  V+S  F        L S  +D +VRVW   G
Sbjct: 201 TVKI---NDMDGNILKTFTGHESFVYSVKFLPNGD---LVSCGEDRSVRVWSKTG 249

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 71/168 (42%), Gaps = 47/168 (27%)

Query: 99  LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDE---------SGEEY---EC- 145
           L A ++GHE +VK V   ND   +A+CSRD +V +W  ++         + E++    C 
Sbjct: 4   LSADLKGHEQDVKSVVAINDS-QVASCSRDGTVRVWSNNDGVWNGVIAHNSEKFINSLCY 62

Query: 146 ------------------ISVLQEHSQD-VKHVIWHPSEA--------LLASSSYDDTVR 178
                             IS L    +D V  +I H             + SSS+D T +
Sbjct: 63  DKSSQLLFYGGQDTLVGGISPLATTDEDPVYMLIGHKGNVCSLSSKNNFVISSSWDKTAK 122

Query: 179 IWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           +W +    ++ V    GH  +VW + F   +  F   + S D T+++W
Sbjct: 123 VWHNGSAIYDLV----GHSASVWDAKFLPEKDFF--LTASADCTIKLW 164

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 43/81 (53%), Gaps = 4/81 (4%)

Query: 143 YECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWS 202
           Y+  + L+ H QDVK V+   +++ +AS S D TVR+W + D  W  V   N  E  + S
Sbjct: 2   YKLSADLKGHEQDVKSVVAI-NDSQVASCSRDGTVRVWSNNDGVWNGVIAHNS-EKFINS 59

Query: 203 SDFDKTEGVFRLCSGSDDSTV 223
             +DK+  +  L  G  D+ V
Sbjct: 60  LCYDKSSQL--LFYGGQDTLV 78

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 97/232 (41%), Gaps = 33/232 (14%)

Query: 103 IEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWH 162
           ++GH N++    WS D   + + S+D  + IW+   SG +   I +    SQ V      
Sbjct: 84  LKGHNNKISDFRWSRDSKSILSASQDGFMLIWDP-MSGLKKNAIPL---DSQWVLACAIS 139

Query: 163 PSEALLASSSYDDTV---RIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSD 219
           PS  L+AS    +     RI ++     + V++  GH   V   +F   E +    + S 
Sbjct: 140 PSRNLVASGGLSNNCTIYRISQENRTQQKIVSIFKGHTCYVSDLEFINNESIL---TASG 196

Query: 220 DSTVRVW-----KYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLA 274
           D T  +W     K + +  D   + +  ++ P             ++ + AS G+DG + 
Sbjct: 197 DMTCALWDIPKSKRVSEYSDHLGDVLTLSVPP--------AGTTSYDSMFASGGSDGYVY 248

Query: 275 VYEEVDGE--WKVFAKRALCHGVYEINVVKWLELNGKTILATGGDDGIVNFW 324
           +++          F   +      +I+ V++   +G +I+ TG DDGI   +
Sbjct: 249 LWDTRSPSSVQNFFVSDS------DISTVRFFS-DGNSII-TGSDDGIARLF 292

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 23/41 (56%)

Query: 94  TFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIW 134
           T   +++  +EGH + + GV  S DG  + T S D ++ +W
Sbjct: 381 TLRGEIVGRLEGHSSRISGVRTSPDGMCVCTGSWDSTMKLW 421

>ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH]
           (1158218..1159258) [1041 bp, 346 aa]
          Length = 346

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 6/81 (7%)

Query: 148 VLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDK 207
           +L  H + +  V ++    L+ +S  D+   +W  Y  + E +  L GH G++WS D D+
Sbjct: 5   MLMGHERSLTQVKYNREGDLIFTSGKDNVASVW--YAMNGERLGTLEGHNGSIWSIDVDQ 62

Query: 208 -TEGVFRLCSGSDDSTVRVWK 227
            TE      +GS D +V+VW+
Sbjct: 63  HTE---YAVTGSADFSVKVWR 80

>Scas_670.21
          Length = 595

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 104/226 (46%), Gaps = 24/226 (10%)

Query: 7   IKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAW 66
           +++L  + +++    ++  IL +GS D  I    V+  D    + L+   H + +  + W
Sbjct: 366 VRTLSGHVDRVACLSWNGHILTSGSRDHNILHRDVRMPD-PFFERLN--THSQEVCGLQW 422

Query: 67  RPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY-YLATC 125
               + LA+G  D+ V ++      D T    ++  IE H+  VK +AWS      LAT 
Sbjct: 423 NTEENKLASGGNDNVVCVY------DGTSRNPMIKFIE-HKAAVKALAWSPHKRGILATG 475

Query: 126 --SRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-SEALLASSSYDD-TVRIWK 181
             + D+ + IW  + S +    +S +   SQ V ++IW   ++ ++ S  Y    + +W 
Sbjct: 476 GGTVDRRLKIWNVNTSMK----LSDVDTGSQ-VCNMIWSKNTDEIVTSHGYSKYHLTLW- 529

Query: 182 DYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
           DY      VA+L GH   V        +G   + SG+ D T+R WK
Sbjct: 530 DYPT-MNPVAILKGHSFRVLHLTL-SADGTT-VVSGAGDETLRYWK 572

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 71/165 (43%), Gaps = 25/165 (15%)

Query: 27  LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAA---GSFDSTVS 83
           LA+G  D     V   YD  +   ++    HK A++++AW PH   + A   G+ D  + 
Sbjct: 429 LASGGNDN----VVCVYDGTSRNPMIKFIEHKAAVKALAWSPHKRGILATGGGTVDRRLK 484

Query: 84  IWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATC----SRDKSVWIWETDES 139
           IW    S      M L  +  G  ++V  + WS +   + T         ++W + T   
Sbjct: 485 IWNVNTS------MKLSDVDTG--SQVCNMIWSKNTDEIVTSHGYSKYHLTLWDYPT--- 533

Query: 140 GEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYD 184
                 +++L+ HS  V H+        + S + D+T+R WK ++
Sbjct: 534 ---MNPVAILKGHSFRVLHLTLSADGTTVVSGAGDETLRYWKLFE 575

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 53/118 (44%), Gaps = 12/118 (10%)

Query: 63  SVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYL 122
           S++W    S LA G  +  V I+          +   +  + GH + V  ++W  +G+ L
Sbjct: 336 SLSWVGAGSHLAVGQGNGLVEIYD-------VVKRKCVRTLSGHVDRVACLSW--NGHIL 386

Query: 123 ATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
            + SRD ++   +       +E    L  HSQ+V  + W+  E  LAS   D+ V ++
Sbjct: 387 TSGSRDHNILHRDVRMPDPFFE---RLNTHSQEVCGLQWNTEENKLASGGNDNVVCVY 441

>Sklu_2435.13 YPR137W, Contig c2435 18346-20073
          Length = 575

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 56/126 (44%), Gaps = 10/126 (7%)

Query: 104 EGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP 163
           EGH +E+  VA S DG Y+ T  RD+ + +W T ES    + I       + +       
Sbjct: 235 EGHYDEILTVAASPDGKYVVTGGRDRKLIVWST-ESLSPVKVIPTKDRRGEVLSLAFRKN 293

Query: 164 SEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLC--SGSDDS 221
           S+ L AS + D  VR +    + +  + VL GH+  V     D +      C   GS D 
Sbjct: 294 SDQLFASCA-DYKVRTYA--INQFSQLEVLYGHQDLV----VDISALSMERCVTVGSRDR 346

Query: 222 TVRVWK 227
           T  +WK
Sbjct: 347 TAMLWK 352

 Score = 28.5 bits (62), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 23/109 (21%), Positives = 50/109 (45%), Gaps = 9/109 (8%)

Query: 27  LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWA 86
           + TG  DRK+ + S   +  + + V+     +  + S+A+R ++  L A   D  V  +A
Sbjct: 253 VVTGGRDRKLIVWST--ESLSPVKVIPTKDRRGEVLSLAFRKNSDQLFASCADYKVRTYA 310

Query: 87  KEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWE 135
                    +   L ++ GH++ V  ++  +    +   SRD++  +W+
Sbjct: 311 -------INQFSQLEVLYGHQDLVVDISALSMERCVTVGSRDRTAMLWK 352

>Scas_693.22
          Length = 1145

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 73/166 (43%), Gaps = 12/166 (7%)

Query: 64  VAWRPHTSLL--AAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY- 120
           V W PH +       + +    IW    +  RT    +  ++ GH   +  + ++ +   
Sbjct: 76  VQWSPHPAKPYWVVSTSNQKALIW----NLARTSSDAIDHVLHGHSRAITDINFNPENPD 131

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
            LATCS D  V  W+       +   S  +  +  VK   W+  ++ + +S++ + + IW
Sbjct: 132 ILATCSVDTYVHAWDMRSPHRPFYTTSAWRSGASQVK---WNYKDSNILASAHSNDIYIW 188

Query: 181 KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            D       +  L GH+ +V S DF++ +    + S S+D TV+ W
Sbjct: 189 -DLRMGSTPLHKLVGHDSSVNSIDFNRFKSS-EIMSSSNDGTVKFW 232

>YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of
           the WD (WD-40) repeat family that binds to substrates
           (CLB2, CLB3, CDC5, HSL1) of the anaphase promoting
           complex (APC) and targets them for degradation [1701 bp,
           566 aa]
          Length = 566

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 74/163 (45%), Gaps = 21/163 (12%)

Query: 27  LATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAA---GSFDSTVS 83
           LA+G  D  + +    Y+  +   +L    HK A++++AW PH   + A   G+ D  + 
Sbjct: 400 LASGGNDNVVHV----YEGTSKSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLK 455

Query: 84  IWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCS--RDKSVWIWETDESGE 141
           IW    S      + +  I  G  +++  + WS +   L T       ++ +W+ +    
Sbjct: 456 IWNVNTS------IKMSDIDSG--SQICNMVWSKNTNELVTSHGYSKYNLTLWDCNS--- 504

Query: 142 EYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYD 184
             + I++L+ HS  V H+        + S + D+T+R WK +D
Sbjct: 505 -MDPIAILKGHSFRVLHLTLSNDGTTVVSGAGDETLRYWKLFD 546

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 106/235 (45%), Gaps = 42/235 (17%)

Query: 7   IKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDET--AHKKAIRSV 64
           I++L  + +++    ++  +L +GS D +I      + D  + D   ET  +H + +  +
Sbjct: 337 IRTLSGHIDRVACLSWNNHVLTSGSRDHRIL-----HRDVRMPDPFFETIESHTQEVCGL 391

Query: 65  AWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY-YLA 123
            W    + LA+G  D+ V ++      + T +  +L   E H+  VK +AWS      LA
Sbjct: 392 KWNVADNKLASGGNDNVVHVY------EGTSKSPILTFDE-HKAAVKAMAWSPHKRGVLA 444

Query: 124 TC--SRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASS----SYDDTV 177
           T   + D+ + IW  + S +    +S +   SQ + +++W  +   L +S     Y+ T+
Sbjct: 445 TGGGTADRRLKIWNVNTSIK----MSDIDSGSQ-ICNMVWSKNTNELVTSHGYSKYNLTL 499

Query: 178 RIWKDYDDDWEC-----VAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
                    W+C     +A+L GH   V        +G   + SG+ D T+R WK
Sbjct: 500 ---------WDCNSMDPIAILKGHSFRVLHLTLSN-DGT-TVVSGAGDETLRYWK 543

 Score = 35.4 bits (80), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 71/168 (42%), Gaps = 21/168 (12%)

Query: 63  SVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYL 122
           S++W    S LA G  +  V I+          +   +  + GH + V  ++W+N  + L
Sbjct: 307 SLSWIGAGSHLAVGQANGLVEIYD-------VMKRKCIRTLSGHIDRVACLSWNN--HVL 357

Query: 123 ATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKD 182
            + SRD  +   +       +E I   + H+Q+V  + W+ ++  LAS   D+ V +++ 
Sbjct: 358 TSGSRDHRILHRDVRMPDPFFETI---ESHTQEVCGLKWNVADNKLASGGNDNVVHVYEG 414

Query: 183 YDDDWECVAVLNGHEGTV----WSSDFDKTEGVFRLCSGSDDSTVRVW 226
                  +   + H+  V    WS       GV     G+ D  +++W
Sbjct: 415 TSK--SPILTFDEHKAAVKAMAWSP---HKRGVLATGGGTADRRLKIW 457

>Kwal_55.21450
          Length = 503

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 50/104 (48%), Gaps = 15/104 (14%)

Query: 55  TAHKKAIRSVAWRPHTS--LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKG 112
             HK    S+   P +    L+AG+ D+ V IW      D   + +LL    GH   V+G
Sbjct: 207 PGHKNGTNSILLLPKSGHLCLSAGN-DNQVKIW------DLYRDRELLRDYRGHSKAVRG 259

Query: 113 VAWSNDGYYLATCSRDKSVWIWETDESGE-----EYECISVLQE 151
           ++++++G    + S D+ + IW+T E+G+      Y CI    E
Sbjct: 260 ISFNSEGSEFLSVSFDQQIKIWDT-ETGKVRHQYSYSCIPNCAE 302

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 32/165 (19%), Positives = 62/165 (37%), Gaps = 41/165 (24%)

Query: 51  VLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADR----------------- 93
           + D   H KA+R +++    S   + SFD  + IW  E    R                 
Sbjct: 247 LRDYRGHSKAVRGISFNSEGSEFLSVSFDQQIKIWDTETGKVRHQYSYSCIPNCAEFRPS 306

Query: 94  ---------------------TFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVW 132
                                + +  L+ + + H + +  + +  DG    + S DKS+ 
Sbjct: 307 NSNEFIVGLSNSEIRHYDLRTSHKNGLVQVYDHHLSSIIALKYFPDGSKFVSSSEDKSMR 366

Query: 133 IWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTV 177
           IWE ++     + IS   ++S  + ++  HP +   A+ S D+ +
Sbjct: 367 IWE-NQINIPIKQISDTSQYS--MPYIGIHPEQNYFAAQSMDNAI 408

>Kwal_27.12586
          Length = 509

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/192 (20%), Positives = 71/192 (36%), Gaps = 35/192 (18%)

Query: 47  TLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGH 106
           T I+V D ++    +  + W P       G     + +W  +      F+         H
Sbjct: 196 TAINVADASSSCD-VTCLEWSPKGDSFLTGVESGEIRLWTHDAKLQNAFDF--------H 246

Query: 107 ENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDV---------- 156
           ++ +  + W++D  +  T   D    +W   ++G   +  S  +  + D           
Sbjct: 247 KSSIVTIKWNSDATHFLTYDVDNVAIVWNA-QTGTALQQFSFRENGTVDSLGVDASWIGP 305

Query: 157 -KHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLC 215
            K VI  P  ++      +               +  LNGH  T+ + DF+    +  L 
Sbjct: 306 DKFVIPGPQGSIYICGMGES------------RPLGKLNGHSATITAFDFNSENNM--LL 351

Query: 216 SGSDDSTVRVWK 227
           SGSDD T+RVW+
Sbjct: 352 SGSDDKTLRVWR 363

>Kwal_26.8628
          Length = 422

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 101/234 (43%), Gaps = 37/234 (15%)

Query: 103 IEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWH 162
           + GH N++   AWS+D   + + S+D  + +W+     ++    + +   SQ V     +
Sbjct: 82  LNGHNNKISDFAWSSDSRSILSASQDGFMIVWDASLGFKK----NAIPLDSQWVLTCAIN 137

Query: 163 PSEALLASSSYDDTVRIWKDYDDD---WECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSD 219
            S  L+AS+   ++  I++   ++    + V++  GH   V   +F +   +    + S 
Sbjct: 138 SSGNLVASAGLTNSCTIYRISQENRVQQQIVSMFKGHTCYVSQVEFFENNSII---TASG 194

Query: 220 DSTVRVW-----KYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLA 274
           D T  +W     K + +  D   + +  A LP  H       A   + + AS G+DG + 
Sbjct: 195 DMTCALWDIPKAKRIAEFSDHLGDVLALA-LPPPH-------AQTSSPIFASGGSDGYVY 246

Query: 275 VYEEVDGEWKVFAKRALCHGVY----EINVVKWLELNGKTILATGGDDGIVNFW 324
           +       W   A RA     +    +I+ +K+   NG  I+ TG DDG+   +
Sbjct: 247 I-------WDTRA-RAAAQSFFVSESDISTLKFFN-NGYAIV-TGADDGVARMF 290

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 24/44 (54%)

Query: 94  TFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETD 137
           T   +++  +EGH + + GV  S DG  + T S D ++ +W  +
Sbjct: 377 TLRAEIVGKLEGHSSRISGVKTSPDGMAVCTGSWDATLKLWSPN 420

 Score = 28.9 bits (63), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 4/66 (6%)

Query: 115 WSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYD 174
           +S  G  +  C  D    IW+T  +    E +  L+ HS  +  V   P    + + S+D
Sbjct: 356 FSGSGRLMHACYTDYGCVIWDTLRA----EIVGKLEGHSSRISGVKTSPDGMAVCTGSWD 411

Query: 175 DTVRIW 180
            T+++W
Sbjct: 412 ATLKLW 417

>Sklu_2233.2 YMR049C, Contig c2233 5630-8059 reverse complement
          Length = 809

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 162 HPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDS 221
           HP    L +SS+D  V +W D D        L  HE  V S DF K   +F  CS +DD 
Sbjct: 691 HPRGDNLIASSFDKRV-LWHDLDLSSTPYKTLRYHEKAVRSVDFHKKLPLF--CSAADDG 747

Query: 222 TVRVW 226
           T+ V+
Sbjct: 748 TIHVF 752

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 93  RTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEH 152
           R F +    I  GH+ +++ ++    G +LAT S D +V IWE     E Y+   +  + 
Sbjct: 430 RPFPIRSSTIYAGHKGKIRTLSIDPSGLWLATGSDDGTVRIWEILTGREVYKVTIIDIDD 489

Query: 153 SQD--VKHVIWHP 163
           +Q+  ++ V W+P
Sbjct: 490 NQEDHIETVEWNP 502

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAW 115
            HK  IR+++  P    LA GS D TV IW +  +    +++ ++ I +  E+ ++ V W
Sbjct: 442 GHKGKIRTLSIDPSGLWLATGSDDGTVRIW-EILTGREVYKVTIIDIDDNQEDHIETVEW 500

Query: 116 SND 118
           + D
Sbjct: 501 NPD 503

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 11/59 (18%)

Query: 195 GHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDE---------DDQQEWVCEAI 244
           GH+G + +   D + G++ L +GSDD TVR+W+ +   E         DD QE   E +
Sbjct: 442 GHKGKIRTLSIDPS-GLW-LATGSDDGTVRIWEILTGREVYKVTIIDIDDNQEDHIETV 498

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 15/22 (68%)

Query: 159 VIWHPSEALLASSSYDDTVRIW 180
            IWHP EA L S+  D+T R+W
Sbjct: 786 TIWHPREAWLFSAGADNTARLW 807

>AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248)
           [1242 bp, 413 aa]
          Length = 413

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 48/108 (44%), Gaps = 12/108 (11%)

Query: 28  ATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAK 87
           A G T+ ++ L + ++ D   +D      H   I S+ + P   +L + S D  + IW+ 
Sbjct: 121 AIGDTEGRLTLHNAEFSDCRSLD-----GHSGHITSLHYFPSGKVLLSASIDMQLKIWS- 174

Query: 88  EESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWE 135
             +AD T    L     GH   + G      G  + + S+D SV +WE
Sbjct: 175 --AADGTNPRTLF----GHTAPITGCGLIERGRNVLSSSKDGSVRLWE 216

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 68/158 (43%), Gaps = 15/158 (9%)

Query: 72  LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSV 131
           L  +G  D  + IW      D   E  LL    GH   +   ++S+D    A+ S DK+V
Sbjct: 189 LFLSGGNDGVLKIW------DMYHERLLLRDYCGHRKAISATSFSHDNVQFASSSYDKTV 242

Query: 132 WIWETDESGEEYECISVLQEHSQDVKHVIWHPS--EALLASSSYDDTVRIWKDYDDDWEC 189
            IW+T E+G+    +S           + +HP   E LL   S D  +R +    D  + 
Sbjct: 243 KIWDT-ETGDIINRLSF----KATPNCMTFHPQNKEQLLVGFS-DSKIRHFDLRVDKKDG 296

Query: 190 VAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
           V  +  H     ++     +G  +  S SDD ++R+W+
Sbjct: 297 VIQIYDHHLAAINALRYFPDGS-KFISSSDDKSIRIWE 333

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 43/216 (19%), Positives = 75/216 (34%), Gaps = 48/216 (22%)

Query: 53  DETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKE------------------------ 88
           D   H+KAI + ++       A+ S+D TV IW  E                        
Sbjct: 213 DYCGHRKAISATSFSHDNVQFASSSYDKTVKIWDTETGDIINRLSFKATPNCMTFHPQNK 272

Query: 89  --------ESADRTFEMD------LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIW 134
                   +S  R F++       ++ I + H   +  + +  DG    + S DKS+ IW
Sbjct: 273 EQLLVGFSDSKIRHFDLRVDKKDGVIQIYDHHLAAINALRYFPDGSKFISSSDDKSIRIW 332

Query: 135 ETDESGEEYECISVLQEHSQDVKHVIW---HPSEALLASSSYDDTVRIWKDYDD-DWECV 190
           E   +      I + Q    D     W   HP     A+ S D+++ ++           
Sbjct: 333 ENQIN------IPIKQISDTDQYPAPWIQLHPEHNQFAAQSMDNSIYVYSMKPKYKRHPR 386

Query: 191 AVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
               GH+   ++S FD       + +G     + +W
Sbjct: 387 KAFRGHKSAGYNSMFDIAPDGRYVAAGDTSGRLFIW 422

>Kwal_27.12070
          Length = 418

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 7/86 (8%)

Query: 57  HKKAIRSVAWRPH--TSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
           H  ++ ++ W PH  T L  AG  D  V IW   +  D+  +        GH   V  ++
Sbjct: 332 HHGSVSALQWNPHHPTILATAGQDDGLVKIWDLSQPVDQELKF----THGGHMLGVNDIS 387

Query: 115 W-SNDGYYLATCSRDKSVWIWETDES 139
           W  ND + + + S D S+ +W+  ++
Sbjct: 388 WDPNDPWMMCSVSNDNSIQLWKPSQN 413

>KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomyces
           cerevisiae YDR128w, start by similarity
          Length = 1133

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 70/168 (41%), Gaps = 12/168 (7%)

Query: 64  VAWRPHTSLL--AAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSN-DGY 120
           V W PH +       + +    +W    S+ +  E     ++ GH   +  + +      
Sbjct: 73  VQWCPHPAKHHWVISTSNQKAIVWNLSRSSSKAVEH----VLHGHFRAITDINFHPLQPE 128

Query: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
            LAT S D     W+     + Y   S  +  +  VK   W+   + + ++S+ + V +W
Sbjct: 129 ILATSSIDTYALAWDMRSPKKPYFRTSNWRSGAAQVK---WNHKNSNVLATSHSNIVYVW 185

Query: 181 KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKY 228
            D       ++VL GH G+V S DF+       + SG +D TV+ W Y
Sbjct: 186 -DVRKGTSPLSVLEGHSGSVNSIDFNPFNETEIMSSG-NDGTVKFWDY 231

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 53/131 (40%), Gaps = 12/131 (9%)

Query: 56  AHKKAIRSVAWRP-HTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
            H +AI  + + P    +LA  S D+    W         F            +    V 
Sbjct: 112 GHFRAITDINFHPLQPEILATSSIDTYALAWDMRSPKKPYFR------TSNWRSGAAQVK 165

Query: 115 WSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-SEALLASSSY 173
           W++    +   S    V++W+  +       +SVL+ HS  V  + ++P +E  + SS  
Sbjct: 166 WNHKNSNVLATSHSNIVYVWDVRKGTSP---LSVLEGHSGSVNSIDFNPFNETEIMSSGN 222

Query: 174 DDTVRIWKDYD 184
           D TV+ W DY+
Sbjct: 223 DGTVKFW-DYN 232

>Kwal_26.8975
          Length = 445

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 45/97 (46%), Gaps = 15/97 (15%)

Query: 168 LASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
           + S SYD  VR W       +  A   GH G V +  +  +    RL SG++D T+R+WK
Sbjct: 115 IVSGSYDGIVRTWNLSGKVEKQYA---GHSGAVRAVKYISST---RLVSGANDRTLRLWK 168

Query: 228 YMGD--------DEDDQQEWVCEAILPDVHKRQVYNV 256
              D        +EDD +E    AIL + HK  V  V
Sbjct: 169 TKNDELKNNLAAEEDDVEEGKTLAIL-EAHKAPVVTV 204

 Score = 36.2 bits (82), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 88/226 (38%), Gaps = 39/226 (17%)

Query: 10  LKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPH 69
           L+ +K  + + D S   + +GS D  I   S  + + T +D +D  A    + S A +  
Sbjct: 194 LEAHKAPVVTVDVSGDRIISGSYDNSIGFWSTNHKEMTAVDPMD--ALGSNVSSAAKKRR 251

Query: 70  TSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS-NDGYYLATCSRD 128
              L  GS         +  S         LA++E H   V+ V +   D     + S+D
Sbjct: 252 RLALKDGSV--------RRRSP--------LALLESHTAPVEEVLFDFADKTVGYSVSQD 295

Query: 129 KSVWIWE------TDESGEEYECISVLQEHSQDVKHVIWHPSEALLA--SSSYDDTVRIW 180
            ++  W+       D     Y  +S+ Q            P   LLA  SS+   T+   
Sbjct: 296 HTIKTWDLVTARCVDTKSTSYSLLSLAQ-----------LPQLNLLACGSSARHITLHDP 344

Query: 181 KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           +           LNGH+  V + D    E  + LCSGS D TV+VW
Sbjct: 345 RVGSSTKITQQQLNGHKNFVVALD-TCPEMEYMLCSGSHDGTVKVW 389

 Score = 34.7 bits (78), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 2/114 (1%)

Query: 26  ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTS-LLAAGSFDSTVSI 84
           +LA GS+ R I L   +    T I       HK  + ++   P    +L +GS D TV +
Sbjct: 329 LLACGSSARHITLHDPRVGSSTKITQQQLNGHKNFVVALDTCPEMEYMLCSGSHDGTVKV 388

Query: 85  WAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDE 138
           W    SA          +++G  ++V  V W+  G  + +  +DK + I + D+
Sbjct: 389 WDVRSSAPMYTITREAEVVKGINDKVFDVKWAK-GLGIISGGQDKKIQINKGDD 441

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 19/89 (21%)

Query: 152 HSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDW--------------ECVAVLNGHE 197
           HS  V+ V +  S  L+ S + D T+R+WK  +D+               + +A+L  H+
Sbjct: 140 HSGAVRAVKYISSTRLV-SGANDRTLRLWKTKNDELKNNLAAEEDDVEEGKTLAILEAHK 198

Query: 198 GTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
             V + D        R+ SGS D+++  W
Sbjct: 199 APVVTVDVSGD----RIISGSYDNSIGFW 223

>CAGL0L04950g complement(562491..564908) highly similar to sp|Q04660
           Saccharomyces cerevisiae YMR049c, start by similarity
          Length = 805

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 47/87 (54%), Gaps = 11/87 (12%)

Query: 189 CVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDV 248
           C  + +GHEG + +   D T G++ L +GSDD +VR+W+ +   E  + + V +    D 
Sbjct: 428 CSTIYSGHEGKIRTLSIDPT-GIW-LATGSDDGSVRIWEILTGREVYRVQLVNKE---DN 482

Query: 249 HKRQVYNVAWGFNGLIASVGADGVLAV 275
            +  +++V W  +G +      G+LAV
Sbjct: 483 PEDNIHSVEWNPDGSV------GILAV 503

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 61/142 (42%), Gaps = 10/142 (7%)

Query: 29  TGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSV----AWRPHTSLLAAGSFDSTVSI 84
           T  ++R+   V  KYD    +    E+  ++  RS+    A R   + L   + D    I
Sbjct: 356 TEYSERERNFVPKKYDSLRKVPGYTESVRERFERSLDLYLAPRMRKNKL---NIDPESLI 412

Query: 85  WAKEESAD-RTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEY 143
                  D R F +    I  GHE +++ ++    G +LAT S D SV IWE     E Y
Sbjct: 413 PELPSPKDLRPFPIRCSTIYSGHEGKIRTLSIDPTGIWLATGSDDGSVRIWEILTGREVY 472

Query: 144 ECISVLQEHSQ--DVKHVIWHP 163
               V +E +   ++  V W+P
Sbjct: 473 RVQLVNKEDNPEDNIHSVEWNP 494

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 15/22 (68%)

Query: 159 VIWHPSEALLASSSYDDTVRIW 180
            IWHP EA L S+  D+T R+W
Sbjct: 782 TIWHPKEAWLFSAGADNTARMW 803

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/253 (19%), Positives = 92/253 (36%), Gaps = 65/253 (25%)

Query: 24  QGILATGSTDRKIKLVSVKYDDF------TLIDVLDETAHKKAIRSVAWRPHTSLLAAGS 77
           +G+ A G  D +  +V+    D       T++     T  +  +  + W P    L  G 
Sbjct: 154 EGVFAYGERDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGV 213

Query: 78  FDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWET- 136
               + +W        + E  L  I+  H   +  + W++D  ++ TC  D    +W   
Sbjct: 214 ESGELRLW--------SVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVL 265

Query: 137 ----------DESGEE-------------------------------YECISVLQEHSQD 155
                      E+G E                                + I  L+ HS+ 
Sbjct: 266 SGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKT 325

Query: 156 VKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDF--DKTEGVFR 213
           +  + ++    LL S+S D+T+R+W+    +     V  GH  ++ S+ +  D T     
Sbjct: 326 LTTIAYNEHNKLLLSASDDNTLRVWR--GGNLNPSHVFYGHSQSITSAHWVDDDT----- 378

Query: 214 LCSGSDDSTVRVW 226
           + S S D ++RVW
Sbjct: 379 IISTSMDGSIRVW 391

 Score = 32.0 bits (71), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 52/124 (41%), Gaps = 9/124 (7%)

Query: 103 IEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWH 162
           + GH   +  +A++     L + S D ++ +W     G       V   HSQ +    W 
Sbjct: 319 LRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR----GGNLNPSHVFYGHSQSITSAHWV 374

Query: 163 PSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDST 222
             + ++ S+S D ++R+W    +     A ++G     ++      +G F   +G+ D  
Sbjct: 375 DDDTII-STSMDGSIRVWSLASNSTVASATVDGVPN--FTGALSPDQGKF--ATGTLDGE 429

Query: 223 VRVW 226
           V V+
Sbjct: 430 VMVY 433

>Kwal_33.15591
          Length = 714

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 64/132 (48%), Gaps = 13/132 (9%)

Query: 99  LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKH 158
           L A + GHE +VK VA  N+   +ATCSRD SV +W+   +    +  +V+ +  + V  
Sbjct: 8   LSATLSGHEQDVKSVAVLNNDT-VATCSRDGSVRLWKKGHNNLWQD--AVVYQSDEFVNS 64

Query: 159 VIWHPSEALLASSSYDDTVR----IWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRL 214
           + +  +  LL     +  +     +  D   D E V +  GHE  V     + ++G   +
Sbjct: 65  LCYDNTSGLLFCGGQNCLINSVSPLLGDVGQDSEFVLI--GHENNVCV--LNSSQGY--V 118

Query: 215 CSGSDDSTVRVW 226
            SGS D+T +VW
Sbjct: 119 LSGSWDTTAKVW 130

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 88/234 (37%), Gaps = 31/234 (13%)

Query: 56  AHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEG-HENEVKGVA 114
            H  ++  V   P        S D T+ +W  E+         +L    G H + ++ + 
Sbjct: 141 GHTASVWDVKMLPEVGFYMTASADGTIKLWEGEK---------VLKTFTGLHTDVIRHID 191

Query: 115 WSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYD 174
               G   A+CS D +V I +      E + +  L  H   V  V + P+  ++ S   D
Sbjct: 192 IDASGEKFASCSNDGTVKINDM-----EGKTLKTLVGHESFVYSVKFAPNGDVI-SCGED 245

Query: 175 DTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDED 234
            TVRIWK    D     V+     + W  D      +   CS   DS  R++        
Sbjct: 246 RTVRIWK---ADGTVKQVIRVPAVSTWDLDILPNGDILIGCS---DSFARIFTCDEKRVA 299

Query: 235 DQQEWVCEAILPDVHKRQVYNVAWGFN-------GLIASVGADGVLAVYEEVDG 281
            Q+E   E +   +    + + A GF+        +++S G +G + V +   G
Sbjct: 300 PQKEQ--ELLAKMIEDTAINSQAMGFDESKLSPKEILSSPGKEGQVVVVKSPSG 351

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 80/184 (43%), Gaps = 26/184 (14%)

Query: 102 IIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIW 161
           ++ GHEN V  V  S+ GY L+  S D +  +W       E      L+ H+  V  V  
Sbjct: 100 VLIGHENNV-CVLNSSQGYVLSG-SWDTTAKVWFQGALKHE------LKGHTASVWDVKM 151

Query: 162 HPSEALLASSSYDDTVRIWKDYDDDWECVAVLNG-HEGTVWSSDFDKTEGVFRLCSGSDD 220
            P      ++S D T+++W    +  + +    G H   +   D D +   F  CS  +D
Sbjct: 152 LPEVGFYMTASADGTIKLW----EGEKVLKTFTGLHTDVIRHIDIDASGEKFASCS--ND 205

Query: 221 STVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVD 280
            TV++        +D +    + ++   H+  VY+V +  NG + S G D  + ++ + D
Sbjct: 206 GTVKI--------NDMEGKTLKTLVG--HESFVYSVKFAPNGDVISCGEDRTVRIW-KAD 254

Query: 281 GEWK 284
           G  K
Sbjct: 255 GTVK 258

>CAGL0K00275g complement(25300..27447) similar to sp|P36037
           Saccharomyces cerevisiae YKL213c DOA1, hypothetical
           start
          Length = 715

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 64/273 (23%), Positives = 101/273 (36%), Gaps = 76/273 (27%)

Query: 99  LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQ-------- 150
           L A + GH  +VK +   ND   +A+ SRD S+ +W    SG ++E + V Q        
Sbjct: 4   LSATLRGHSQDVKDITAVNDN-KIASVSRDGSLRVWTRSSSG-DWEDVLVYQSDKFLNAV 61

Query: 151 --------------------EHSQDVKHVIWHP----------------SEALLASSSYD 174
                                H +DV      P                   LL SSS+D
Sbjct: 62  CYDKTSQTVYYGGQDTLINGSHIEDVIGSSADPMYTLVGHTGNVCGLRFQNGLLLSSSWD 121

Query: 175 DTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDED 234
            T +IW    D+ +    L  HE +VW S     + +    + S D ++ VW        
Sbjct: 122 KTAKIW----DNNKLKYDLRNHEASVWDSTMVSDDIIL---TASADKSIGVW-------- 166

Query: 235 DQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEWK-VF-AKRALC 292
              E      L ++H   + ++ +  N + AS   DG + +   ++GE K VF    +  
Sbjct: 167 --MEGKLIKKLSNIHDDVIRHLEYISNDIFASCSNDGTIKLL-NLEGEIKNVFEGHESFV 223

Query: 293 HGVYEINVVKWLELNGKTILATGGDDGIVNFWS 325
           + V  +N            L + G+D  V  WS
Sbjct: 224 YCVKHMN----------NTLFSCGEDSTVRIWS 246

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 68/165 (41%), Gaps = 25/165 (15%)

Query: 67  RPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCS 126
           R    LL + S+D T  IW   +      + DL      HE  V      +D   L T S
Sbjct: 109 RFQNGLLLSSSWDKTAKIWDNNK-----LKYDL----RNHEASVWDSTMVSDDIIL-TAS 158

Query: 127 RDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDD 186
            DKS+ +W       E + I  L     DV   + + S  + AS S D T+++    + +
Sbjct: 159 ADKSIGVWM------EGKLIKKLSNIHDDVIRHLEYISNDIFASCSNDGTIKLL---NLE 209

Query: 187 WECVAVLNGHEGTVWS-SDFDKTEGVFRLCSGSDDSTVRVWKYMG 230
            E   V  GHE  V+     + T     L S  +DSTVR+W   G
Sbjct: 210 GEIKNVFEGHESFVYCVKHMNNT-----LFSCGEDSTVRIWSING 249

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 143 YECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW-KDYDDDWECVAV 192
           Y+  + L+ HSQDVK  I   ++  +AS S D ++R+W +    DWE V V
Sbjct: 2   YQLSATLRGHSQDVKD-ITAVNDNKIASVSRDGSLRVWTRSSSGDWEDVLV 51

>AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH]
           complement(341382..342494) [1113 bp, 370 aa]
          Length = 370

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 62/146 (42%), Gaps = 20/146 (13%)

Query: 53  DETAHKKAIRSVAWRPH-TSLLAAGSFDSTVSIWAKEESA----DRTFEMDLLAIIEGHE 107
           D   +K  I    + PH  +L+ + S +S VS++   + A     R      L  +    
Sbjct: 171 DAADNKDCIYQAQFSPHDPNLVMSCSGNSYVSLFDLRQPAASNQQRFIAHSGLEALSCDF 230

Query: 108 NEVKGVAWSNDGYYLATCSRDKSVWIWET-------DESGEEYECISVLQEHSQDVKHVI 160
           N+ +        + +AT   DK V +W+          S      I+ +Q HS  V+ V+
Sbjct: 231 NKYRP-------HVIATGGVDKMVKVWDLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVV 283

Query: 161 WHPSEA-LLASSSYDDTVRIWKDYDD 185
           W P  + +L S+SYD T R W D  D
Sbjct: 284 WSPHHSNILLSTSYDMTCRAWHDLAD 309

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 52/129 (40%), Gaps = 20/129 (15%)

Query: 26  ILATGSTDRKIKLVSVKYDDFTL-------IDVLDETAHKKAIRSVAWRPHTS-LLAAGS 77
           ++ATG  D+ +K+  ++    TL       + + +   H  A+R V W PH S +L + S
Sbjct: 237 VIATGGVDKMVKVWDLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHSNILLSTS 296

Query: 78  FDSTVSIW------AKEESADRTFEMDLLA----IIEGHENEVKGVAWS--NDGYYLATC 125
           +D T   W         + + RT   D       +   H   V G  WS      Y+AT 
Sbjct: 297 YDMTCRAWHDLADGPGGQHSGRTNNSDPQRGCSYVFSKHSEFVFGADWSLWGQPGYVATT 356

Query: 126 SRDKSVWIW 134
             D  V  W
Sbjct: 357 GWDGQVCAW 365

>YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anaphase
           promoting complex (APC), required for microtubule
           function at mitosis and for exit from anaphase, contains
           WD (WD-40) repeats [1833 bp, 610 aa]
          Length = 610

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 49/101 (48%), Gaps = 11/101 (10%)

Query: 71  SLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKS 130
           +L+A GS    + I       D   +  +++    H  EV G+++ +DG  LA+   D +
Sbjct: 355 TLIATGSRSGEIQI------NDVRIKQHIVSTWAEHTGEVCGLSYKSDGLQLASGGNDNT 408

Query: 131 VWIWETDESGEEYECISVLQEHSQDVKHVIWHP-SEALLAS 170
           V IW+T  S  ++      + H+  VK + W P S  +LAS
Sbjct: 409 VMIWDTRTSLPQFS----KKTHTAAVKALSWCPYSPNILAS 445

>KLLA0C09262g 805512..807188 similar to sp|P40055 Saccharomyces
           cerevisiae YER082c singleton, start by similarity
          Length = 558

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 8/96 (8%)

Query: 41  VKYDDFTLIDVLDETAHK-KAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDL 99
           +KY D +   ++ E   K     ++A  P  +++  G  + TV++W+       +    L
Sbjct: 219 LKYQDVSTGQLVSEIRTKLGPTTAMAQNPWNAVMHLGHSNGTVTLWSP------SMPSPL 272

Query: 100 LAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWE 135
           + ++      + G+A    GYY+AT   DKS+ IW+
Sbjct: 273 VRLLSS-RGSITGIAVDRQGYYMATTGSDKSLKIWD 307

>YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal
           biogenesis protein (peroxin) that serves as import
           receptor for proteins containing peroxisomal targeting
           signal 2 (PTS2), member of WD (WD-40) repeat family
           [1128 bp, 375 aa]
          Length = 375

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 12/94 (12%)

Query: 54  ETAHKKAIRSVAWRP-HTSLLAAGSFDSTVSIWA--KEESADRTFEMDLLAIIEG----- 105
             AH  AIR V W P H+++L + S+D T  IW     + A  T++ +     +G     
Sbjct: 279 PNAHGLAIRKVTWSPHHSNILMSASYDMTCRIWRDLSNDGAKETYKTNSTDATKGSIFNF 338

Query: 106 --HENEVKGVAWS--NDGYYLATCSRDKSVWIWE 135
             H   V G  WS      Y+A+ + D ++++W 
Sbjct: 339 TQHSEFVFGADWSLWGKPGYVASTAWDGNLFVWN 372

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 17/84 (20%)

Query: 120 YYLATCSRDKSVWIWET-----DESG----------EEYECIS-VLQEHSQDVKHVIWHP 163
           Y +AT   D ++ IW+      +ES               CI+ +   H   ++ V W P
Sbjct: 234 YVVATGGVDNAIRIWDIRMLNKNESATIKRTVPGQLHNSSCINEIPNAHGLAIRKVTWSP 293

Query: 164 SEA-LLASSSYDDTVRIWKDYDDD 186
             + +L S+SYD T RIW+D  +D
Sbjct: 294 HHSNILMSASYDMTCRIWRDLSND 317

>Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement
          Length = 997

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 103/234 (44%), Gaps = 30/234 (12%)

Query: 105 GHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPS 164
           GHE  +  V  S +G Y+ +CS D+S+ +W   +SG   E +S    H+  +  + +  +
Sbjct: 179 GHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNL-KSG---ELLSTGWGHTARIWQLKFIDN 234

Query: 165 EALLASSSYDDTVRIW---KDYDD-----DWECVAVLNGHEGTVWSSDFDKTEGVFRLCS 216
           +  + S S D T R+W   K +DD      +E   + N     VW  D ++ E +  + S
Sbjct: 235 DTKVVSVSEDCTCRVWDIAKPHDDLVQSGIYEVHLIKN-----VWGVDVEEDE-MLAITS 288

Query: 217 GSDDS-TVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFN----GLIASVGADG 271
           G+D    +   K +    D+ + +  + I       +   +  GF     GL+A + + G
Sbjct: 289 GNDGRLKLTDLKPLSRKGDEVEVFSLQDISSGKINLEKNEIIKGFYWLSFGLVA-ITSVG 347

Query: 272 VLAVYEEVDGEWKV------FAKRALCHGVYEINVVKWLELNGKTILATGGDDG 319
            +  +++   +W V      F+  ++  G+ E+N V +       +L    +DG
Sbjct: 348 QIIKFDQKSSQWSVVMKDSRFSSYSVTSGIQELNTVIFSSNKCNLLLLKFTEDG 401

>Kwal_55.21144
          Length = 570

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 74/171 (43%), Gaps = 27/171 (15%)

Query: 104 EGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP 163
           EGH +E+  +A S DG Y+ T  RD+ + IW T ES    + I       + +  V    
Sbjct: 230 EGHYDEILTLAASPDGKYVITGGRDRKLIIWST-ESLAPVKVIPTKDRRGEVLSLVFRKN 288

Query: 164 SEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCS-GSDDST 222
           S+ L A+ + D  +R +    + +  + +L GH+  V         G+ R  + GS D T
Sbjct: 289 SDQLYAACA-DYKIRTYS--INQFSQLEILYGHQDLVVGIS---ALGMERCVTVGSRDRT 342

Query: 223 VRVWK--------YMGDDEDDQ--QEWV---------CEAILPDVHKRQVY 254
             +WK        + G D+ ++  + W+          E I PD  +R  +
Sbjct: 343 AMLWKIADETRLTFRGGDDPERLLKRWIKQNTTKSDTGEDITPDESERPFF 393

>CAGL0B03575g complement(357525..358784) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2, hypothetical
           start
          Length = 419

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 96/216 (44%), Gaps = 26/216 (12%)

Query: 73  LAAGSFDSTVSIWAKEESADRTFEMDLLAII---EGHENEVKGVAW-SNDGYYLATCSRD 128
           L +GS DS +++W         FE ++   I   + H + +  V W S++ +   + S D
Sbjct: 195 LLSGSDDSNIALWDIS-----NFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSED 249

Query: 129 KSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP-SEALLASSSYDDTVRIWKDYDDDW 187
            ++ +++   S +    I+  + ++     + + P S  L A++  D+ V ++ D  D  
Sbjct: 250 STMKLFDK-RSSQIIHNINTKKPYNT----LAFSPFSSNLFAAAGTDNLVYLY-DIRDVS 303

Query: 188 ECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPD 247
             +  + GHE  V + +FD         SGSD  T+ VW       +  Q+ + +   P+
Sbjct: 304 NPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI-VWDLQEIGAEQTQDEIEDG-PPE 361

Query: 248 V------HKRQVYNVA--WGFNGLIASVGADGVLAV 275
           V      HK  + ++A     N L+AS   D ++ +
Sbjct: 362 VLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQI 397

>Kwal_56.23895
          Length = 367

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 53/127 (41%), Gaps = 18/127 (14%)

Query: 26  ILATGSTDRKIKLVSVKY------DDFTLIDVLDETAHKKAIRSVAWRPHTS-LLAAGSF 78
           I+ATG  D  IK+  ++       +    + V +   H  AIR V+W PH S +L + S+
Sbjct: 236 IVATGGVDNMIKVWDLRMVRKAASNSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSY 295

Query: 79  DSTVSIWA-----KEESADRTFEMDLLA----IIEGHENEVKGVAWS--NDGYYLATCSR 127
           D T  +W            +T  +D       +   H   V G  WS      Y+A+ S 
Sbjct: 296 DMTCRVWQDLSDDGRRPTGKTNSVDPARGCRFVFPHHTEFVFGADWSLWGKPGYIASTSW 355

Query: 128 DKSVWIW 134
           D  V +W
Sbjct: 356 DGDVCVW 362

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 152 HSQDVKHVIWHPSEA-LLASSSYDDTVRIWKDYDDD 186
           H   ++ V W P  + +L S+SYD T R+W+D  DD
Sbjct: 273 HDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQDLSDD 308

>YER082C (UTP7) [1514] chr5 complement(324268..325932) Component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, has one WD (WD-40)
           domain [1665 bp, 554 aa]
          Length = 554

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 70/172 (40%), Gaps = 20/172 (11%)

Query: 41  VKYDDFTLIDVLDETAHKK-AIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDL 99
           +KY D +   ++ E   K     ++A  P  +++  G  + TVS+W+       +    L
Sbjct: 214 LKYHDVSTGQLVSELRTKAGPTMAMAQNPWNAVMHLGHSNGTVSLWSP------SMPEPL 267

Query: 100 LAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHV 159
           + ++      V  +A    GYY+AT   D+S+ IW+   + ++   +  L     +V   
Sbjct: 268 VKLLSA-RGPVNSIAIDRSGYYMATTGADRSMKIWDI-RNFKQLHSVESLPTPGTNVS-- 323

Query: 160 IWHPSEALLASSSYDDTVRIWKDY----DDDWECVAVLNG--HEGTVWSSDF 205
               S+  L + S    V +WKD      D   C   + G  H  T + S  
Sbjct: 324 ---ISDTGLLALSRGPHVTLWKDALKLSGDSKPCFGSMGGNPHRNTPYMSHL 372

>ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH]
           (567357..569840) [2484 bp, 827 aa]
          Length = 827

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 64/144 (44%), Gaps = 10/144 (6%)

Query: 31  STDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSV----AWRPHTSLLAAGSFDSTVSIWA 86
            +DRK   +  KY     +    E+  ++  RS+    A R   + L   + D    I  
Sbjct: 385 PSDRKRNFLPQKYGSLRKVPGYGESVRERFERSLDLYLAPRVRKNKL---NIDPESLIPE 441

Query: 87  KEESAD-RTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYEC 145
                D R F +    +  GH+ +++ ++    G +LAT S D +V +WE     E Y+ 
Sbjct: 442 LPSPKDLRPFPIRCSTVYAGHKGKIRTLSIDPSGLWLATGSDDGTVRVWEILTGREVYKA 501

Query: 146 ISVLQEHSQD--VKHVIWHPSEAL 167
             V  +++QD  ++ V W+P + +
Sbjct: 502 TIVDIKNNQDDHIETVEWNPDKTV 525

 Score = 35.8 bits (81), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 14/99 (14%)

Query: 189 CVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDV 248
           C  V  GH+G + +   D + G++ L +GSDD TVRVW+ +   E      V +A + D+
Sbjct: 455 CSTVYAGHKGKIRTLSIDPS-GLW-LATGSDDGTVRVWEILTGRE------VYKATIVDI 506

Query: 249 HKRQ---VYNVAWGFN---GLIASVGADGVLAVYEEVDG 281
              Q   +  V W  +   GL+A    + +  +   + G
Sbjct: 507 KNNQDDHIETVEWNPDKTVGLLAVAAGENIYLLVPPIFG 545

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 69/186 (37%), Gaps = 38/186 (20%)

Query: 19  SFDFSQGILATGSTDR-KIKLVSVKYDDFTLIDVLDETAHKKAIRSVAW------RPHTS 71
            F+ S+GI+        K +L         + D+  +   KK +    W       P   
Sbjct: 654 PFNKSKGIIMDAKFHPFKPQLFVCSQRYIRIYDLSQQVLVKKLLPGARWLSTIDIHPRGD 713

Query: 72  LLAAGSFDSTVSIWAKEESADRTFEMDLLAI----IEGHENEVKGVAWSNDGYYLATCSR 127
            L A SFD  V +W          ++DL A     +  HE  V+ V +        + + 
Sbjct: 714 NLIASSFDKRV-LW---------HDLDLAATPYKTLRYHEKAVRSVGFHKKLPLFCSAAD 763

Query: 128 DKSVWIWETDESGEEYE---------CISVLQEH----SQDVKHVIWHPSEALLASSSYD 174
           D ++ ++     G  Y+          +  L  H    S  V   +WHP EA L S+  D
Sbjct: 764 DGTIHVFH----GTVYDDMMKNPLLVPLKKLTGHKLVNSLGVLDTVWHPREAWLFSAGAD 819

Query: 175 DTVRIW 180
           +T R+W
Sbjct: 820 NTARLW 825

>Scas_469.3
          Length = 624

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 106 HENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP 163
           H+ E+ G+++ +DG  LA+   D +V IW+T  S  ++    + + H+  VK + W P
Sbjct: 392 HQGEICGLSYKSDGLQLASGGNDNTVMIWDTRTSMPQW----IKRNHNAAVKALSWCP 445

>AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH]
           (526057..527832) [1776 bp, 591 aa]
          Length = 591

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 56/124 (45%), Gaps = 6/124 (4%)

Query: 104 EGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP 163
           EGH +E+  VA S DG Y+ T  RDK + +W T ES    + I       + +       
Sbjct: 252 EGHYDEILTVAASPDGKYVVTGGRDKKLIVWST-ESLAPVKVIPTKDRRGEVLGLAFRRN 310

Query: 164 SEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTV 223
           ++ L A+ + D  +R +    + +  + VL GH+  V  +D         +  GS D T 
Sbjct: 311 TDQLYAACA-DYKIRTFA--INQFSQLEVLYGHQDIV--ADISALNMERCVTVGSRDRTC 365

Query: 224 RVWK 227
            +WK
Sbjct: 366 MLWK 369

>CAGL0B01529g 137174..138283 highly similar to sp|P39108
           Saccharomyces cerevisiae YDR142c PAS7 peroxisomal import
           protein - peroxin, start by similarity
          Length = 369

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 57/136 (41%), Gaps = 23/136 (16%)

Query: 22  FSQGILATGSTDRKIKLVSVK----------YDDFTLIDVLDETAHKKAIRSVAWRPHTS 71
           +   I+AT   D  I +  ++          +   TL++ +   AH  A++ V W PH S
Sbjct: 232 YRPNIIATSGVDNSIGIWDIRMLPNSSNQQGFQTGTLVNEI-VNAHDLAVKKVCWSPHHS 290

Query: 72  -LLAAGSFDSTVSIW---------AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY- 120
            +L + S+D +  IW            ++        LL+  + H   V G  WS  G  
Sbjct: 291 DILLSTSYDMSCKIWKDVSVQNNVPTGKTNGSLLSNGLLSNFKHHTEFVFGADWSLWGIP 350

Query: 121 -YLATCSRDKSVWIWE 135
            Y+AT   D +V+IW 
Sbjct: 351 GYVATAGWDSNVFIWN 366

 Score = 35.4 bits (80), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 10/71 (14%)

Query: 122 LATCSRDKSVWIWE-------TDESGEEYECI--SVLQEHSQDVKHVIWHPSEA-LLASS 171
           +AT   D S+ IW+       +++ G +   +   ++  H   VK V W P  + +L S+
Sbjct: 237 IATSGVDNSIGIWDIRMLPNSSNQQGFQTGTLVNEIVNAHDLAVKKVCWSPHHSDILLST 296

Query: 172 SYDDTVRIWKD 182
           SYD + +IWKD
Sbjct: 297 SYDMSCKIWKD 307

>YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component of
           U3 snoRNP (also called small subunit processome) which
           is required for 18S rRNA biogenesis, required for
           pre-rRNA processing [1722 bp, 573 aa]
          Length = 573

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 64/151 (42%), Gaps = 20/151 (13%)

Query: 104 EGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP 163
           EGH +E+  VA S DG Y+ T  RD+ + +W T ES    + I       + +       
Sbjct: 233 EGHYDEILTVAASPDGKYVVTGGRDRKLIVWST-ESLSPVKVIPTKDRRGEVLSLAFRKN 291

Query: 164 SEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLC--SGSDDS 221
           S+ L AS + D  +R +    + +  + +L GH   V     D +      C   G+ D 
Sbjct: 292 SDQLYASCA-DFKIRTYS--INQFSQLEILYGHHDIVE----DISALAMERCVTVGARDR 344

Query: 222 TVRVWK--------YMGDDEDDQ--QEWVCE 242
           T  +WK        + G DE  +  + W+ E
Sbjct: 345 TAMLWKIPDETRLTFRGGDEPQKLLRRWMKE 375

>ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH]
           complement(387122..388393) [1272 bp, 423 aa]
          Length = 423

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 77/175 (44%), Gaps = 25/175 (14%)

Query: 21  DFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHT-SLLAAGSFD 79
           +F   +  T S D+ +++    +D    ++ + +        ++++  H+ +LLAA   D
Sbjct: 240 EFESNVFGTVSEDKTLQV----HDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVD 295

Query: 80  STVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS--NDGYYLATCSRDKSVWIWETD 137
           S + ++   + +        L ++ GH++ V  V +S   DG   ++ S D+   IW+  
Sbjct: 296 SQIYLYDMRDMSSP------LHVMSGHQDSVTTVEFSPHTDGIICSSGS-DRRAIIWDLT 348

Query: 138 ESGEEY----------ECISVLQEHSQDVKHVIWHPSEA-LLASSSYDDTVRIWK 181
           + G E           E + +   H   V    ++P    LLAS+  D+ ++ WK
Sbjct: 349 QIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403

 Score = 28.5 bits (62), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 59/287 (20%), Positives = 109/287 (37%), Gaps = 76/287 (26%)

Query: 58  KKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMD--LLAIIEGHENEVKGVAW 115
           ++ IR+     +++++A  +   T+SI+      DRT E     ++ +  H+    G+A+
Sbjct: 141 EEVIRARYMPANSNIIATINGKGTISIF------DRTLEESKAQVSTLAFHKENGYGLAF 194

Query: 116 SND-GYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA-------- 166
           +      L + S D +V +W+ + + +     S+L  H   V  V WH  E+        
Sbjct: 195 NPHISGELLSGSDDTTVALWDIEAAKKPK---SILTSHDDIVNDVKWHEFESNVFGTVSE 251

Query: 167 ------------------------------------LLASSSYDDTVRIWKDYDDDWECV 190
                                               LLA++  D  + ++ D  D    +
Sbjct: 252 DKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLY-DMRDMSSPL 310

Query: 191 AVLNGHEGTVWSSDFDK-TEGVFRLCSGSDDSTVRVWKYMG----DDEDDQQEWVCEAIL 245
            V++GH+ +V + +F   T+G+  +CS   D    +W          +DD  +   E ++
Sbjct: 311 HVMSGHQDSVTTVEFSPHTDGI--ICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMM 368

Query: 246 PDVHKRQVYNVAWGFNG----LIASVGADGVLAVYEEVDGEWKVFAK 288
                R   N  + FN     L+AS   D V+         WKV  K
Sbjct: 369 MHAGHRSPVN-EFSFNPQIPWLLASTEEDNVIQA-------WKVSMK 407

>CAGL0F06853g 671942..673108 highly similar to sp|P20484
           Saccharomyces cerevisiae YKL021c MAK11 involved in cell
           growth and replication of M1 dsRNA virus, hypothetical
           start
          Length = 388

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 52/117 (44%), Gaps = 20/117 (17%)

Query: 73  LAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS---------NDGYYLA 123
           L +GS D  + I+  ++  +       L  +  H+  +  + +S           G +L 
Sbjct: 54  LVSGSNDEHIRIYDLQKRKE-------LGTLLAHQGSITNLKFSKVSDQEPKSTSGKWLL 106

Query: 124 TCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180
           + S D  + +W      +++E    L+ H+  +  +  HPS  ++AS S D ++R+W
Sbjct: 107 SASEDNKIIVWRV----KDWENFGTLKGHTARINDMDIHPSNRVVASVSEDHSIRLW 159

 Score = 28.9 bits (63), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 10/57 (17%)

Query: 105 GHENEVKGVAW--SNDGYYLATCSRDKSVWIWETDES--------GEEYECISVLQE 151
           GH N VK + +  +  G Y+ T   D  V +W+ D+         GE   C++V  E
Sbjct: 270 GHTNRVKDLKFYVNEFGTYMVTIGSDGKVIVWDMDKRDQVAVYDCGERLNCLAVCDE 326

>Scas_700.27*
          Length = 433

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 45/106 (42%), Gaps = 9/106 (8%)

Query: 122 LATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWK 181
           +AT  RD  V +W+          +  L  H   +  V   P +  + S S D T+R+W 
Sbjct: 221 IATAGRDSVVRLWDI----RARVAVMTLIGHKNPINKVHCLPVDPQIVSCSTDATIRLWD 276

Query: 182 DYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
                 + + V+  H+ +V +  F  TE     CS +D   +R WK
Sbjct: 277 IVAG--KSMKVITHHKKSVRNIAFHPTEFSMSSCSAND---IRSWK 317

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 48/235 (20%), Positives = 98/235 (41%), Gaps = 35/235 (14%)

Query: 9   SLKLYKEKIWS-FDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWR 67
           ++  Y E I   F     ++AT   D  ++L    +D    + V+    HK  I  V   
Sbjct: 202 TMATYHEYIQMIFILLLNLIATAGRDSVVRL----WDIRARVAVMTLIGHKNPINKVHCL 257

Query: 68  PHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSR 127
           P    + + S D+T+ +W  +  A ++     + +I  H+  V+ +A+    + +++CS 
Sbjct: 258 PVDPQIVSCSTDATIRLW--DIVAGKS-----MKVITHHKKSVRNIAFHPTEFSMSSCSA 310

Query: 128 DKSVWIWETDESGEEYECISVLQEHSQD----VKHVIWHPSEALLASSSYDDTVRIWKDY 183
           +  +  W+  E G       +L   + D    +  +  +  + L A S  D+ +  + DY
Sbjct: 311 N-DIRSWKLPEGG-------LLTNFNSDGLGIINTLSINQDDVLFAGS--DNGMLSFYDY 360

Query: 184 DDDWECVAVLNGH-------EGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGD 231
               +  +++          E  +  S FD+T    RL +G  D ++++W    D
Sbjct: 361 KSGHKYQSMMTKEIPGSLESERGILCSTFDRTG--LRLLTGETDKSIKIWSMDSD 413

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 68/157 (43%), Gaps = 11/157 (7%)

Query: 26  ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIW 85
           ++ +G  D  +KL    +D   L D +    H K I+++ +   +S   +GS+D  V IW
Sbjct: 163 LILSGGNDNTVKLWDFYHDRKCLRDFV---GHSKPIKTLDFTSDSSQFLSGSYDQQVKIW 219

Query: 86  AKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYEC 145
              E+   T  ++  +      N  +    S + + +   S    +  ++T  S E+   
Sbjct: 220 -DTETGKVTKRLNTYST----PNSAEFRPTSGNEFVVGLSS--SKIKHYDTRVS-EKDGL 271

Query: 146 ISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKD 182
           + V   H   +  + + P  +   SSS D T+RIW +
Sbjct: 272 VQVYDHHLSSILAIKYFPDGSKFISSSEDKTLRIWNN 308

 Score = 34.7 bits (78), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 167 LLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           L+ S   D+TV++W D+  D +C+    GH   + + DF  T    +  SGS D  V++W
Sbjct: 163 LILSGGNDNTVKLW-DFYHDRKCLRDFVGHSKPIKTLDF--TSDSSQFLSGSYDQQVKIW 219

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 70/174 (40%), Gaps = 16/174 (9%)

Query: 56  AHKKAIRSVAWRPHTS-LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA 114
            H     S+   P T  L+ +G  D+TV +W      D   +   L    GH   +K + 
Sbjct: 146 GHHNGTTSLRLLPGTGHLILSGGNDNTVKLW------DFYHDRKCLRDFVGHSKPIKTLD 199

Query: 115 WSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSS-- 172
           +++D     + S D+ V IW+T+         +    +S + +    +     L+SS   
Sbjct: 200 FTSDSSQFLSGSYDQQVKIWDTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSSKIK 259

Query: 173 YDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
           + DT    KD       V V + H  ++ +  +      F   S S+D T+R+W
Sbjct: 260 HYDTRVSEKD-----GLVQVYDHHLSSILAIKYFPDGSKF--ISSSEDKTLRIW 306

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 47/108 (43%), Gaps = 7/108 (6%)

Query: 104 EGHENEVKGVAW-SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWH 162
           +GH N    +      G+ + +   D +V +W+      + +C+     HS+ +K + + 
Sbjct: 145 KGHHNGTTSLRLLPGTGHLILSGGNDNTVKLWDF---YHDRKCLRDFVGHSKPIKTLDFT 201

Query: 163 PSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEG 210
              +   S SYD  V+IW    +  +    LN +  T  S++F  T G
Sbjct: 202 SDSSQFLSGSYDQQVKIWD--TETGKVTKRLNTYS-TPNSAEFRPTSG 246

>KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces
           cerevisiae YKL213c DOA1 involved in ubiquitin-dependent
           proteolysis, start by similarity
          Length = 706

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 4/78 (5%)

Query: 143 YECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWK-DYDDDWECVAVLNGHEGTVW 201
           Y+  + L+ H+QDV+ V+   S   +AS+S D TVRIW  D D +WE  ++    E  V 
Sbjct: 2   YQLSAQLRGHTQDVRSVV-SLSTTQVASASRDGTVRIWNLDADGNWEG-SIAFSSEKFVN 59

Query: 202 SSDFDKTEGVFRLCSGSD 219
           S  +D  + V   C G +
Sbjct: 60  SLTYDAKQCVL-FCGGQE 76

 Score = 35.8 bits (81), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 66/170 (38%), Gaps = 49/170 (28%)

Query: 99  LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESG----------EEY----- 143
           L A + GH  +V+ V  S     +A+ SRD +V IW  D  G          E++     
Sbjct: 4   LSAQLRGHTQDVRSVV-SLSTTQVASASRDGTVRIWNLDADGNWEGSIAFSSEKFVNSLT 62

Query: 144 ----ECI--------------SVLQEHSQDVKHVIWHPSEAL--------LASSSYDDTV 177
               +C+               +L    + V  ++ H             L SSS+D T 
Sbjct: 63  YDAKQCVLFCGGQEKIIYGVSPLLALGQEPVYTLVGHEGNICSLSGDFESLVSSSWDKTA 122

Query: 178 RIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK 227
           ++W +    WE    L GH  +VW +       V    + S D+TV++WK
Sbjct: 123 KVWTNGIVKWE----LKGHSASVWDAKLLNDGSVL---TASADTTVKLWK 165

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 70/156 (44%), Gaps = 21/156 (13%)

Query: 71  SLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKS 130
           S+L A S D+TV +W K  +  +TF+       + H + V+ +   +DG +  +CS D +
Sbjct: 151 SVLTA-SADTTVKLW-KNGTLAKTFD-------KLHSDVVRNICILDDGKHFVSCSNDGT 201

Query: 131 VWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECV 190
           + +    E G  +E I     H   V  V   PS  ++ S   D TVRIW   + D    
Sbjct: 202 LKLSNL-EGGILHEFIG----HESFVYAVKQLPSGDIV-SCGEDRTVRIW---NMDGTIK 252

Query: 191 AVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226
            V+     ++W+ D      +     GS D  +R++
Sbjct: 253 QVITLPAISIWTVDVLPNGDI---VVGSSDKIIRIF 285

>Kwal_23.5962
          Length = 552

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 42/96 (43%), Gaps = 8/96 (8%)

Query: 41  VKYDDFTLIDVLDETAHK-KAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDL 99
           +KY D +   +  E   K     ++A  P  +++  G  + TV++WA             
Sbjct: 213 LKYQDVSTGQLQAEIRTKLGPTTAMAQNPWNAVIHLGHSNGTVTLWAPNMPTP------- 265

Query: 100 LAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWE 135
           LA +      +  +A    GYY+AT   DKS+ IW+
Sbjct: 266 LARLLSARGPITSIALDRQGYYMATTGADKSLKIWD 301

>Kwal_26.7655
          Length = 743

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 73/184 (39%), Gaps = 17/184 (9%)

Query: 148 VLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDK 207
           + QEH+QD+  + W      + ++S D T R+W  + D  + + V   H   V  + F  
Sbjct: 267 IYQEHTQDILDLDWS-KNGFILTTSMDKTARLW--HCDRPKALKVFT-HPDFVTCAKFHP 322

Query: 208 TEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILP--DVHKRQ-VYNVAWGFNGLI 264
            +  F   SG  D T+R+W  +  D     ++ C  I+   D   R   Y  A  FNG I
Sbjct: 323 NDDRF-FISGCLDHTLRLWSIL--DNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHI 379

Query: 265 ASVGADGV-----LAVYEEVDGEWKVFAKRALCHGVYEINVVKWLELNGKTILATGGDDG 319
             +   G+       V E+ +G  K   +      +  I   K    N   I+ T  D  
Sbjct: 380 IILYTRGLEMVSTFHVLEKPNGTTKKVPESG--PKITGIEFFKSAPDNDLRIMVTSNDSR 437

Query: 320 IVNF 323
           I  F
Sbjct: 438 IRIF 441

>Sklu_2438.4 YER082C, Contig c2438 8089-9810 reverse complement
          Length = 573

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 8/96 (8%)

Query: 41  VKYDDFTLIDVLDETAHK-KAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDL 99
           +KY D +   ++ E   K     ++A  P  +++  G  + TV++WA            L
Sbjct: 234 LKYQDVSTGQLVAELRTKLGPTTAMAQNPWNAVMHLGHSNGTVTLWAP------NMPTPL 287

Query: 100 LAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWE 135
           + ++      +  VA    GYY+AT   DKS+ IW+
Sbjct: 288 VRLLSA-RGPITSVAIDRQGYYMATTGADKSMKIWD 322

>AGR067W [4377] [Homologous to ScYDR128W - SH]
           complement(842182..845559) [3378 bp, 1125 aa]
          Length = 1125

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 68/171 (39%), Gaps = 12/171 (7%)

Query: 61  IRSVAWRPHTSLL--AAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSN- 117
           +  V W PH         + +    +W    S+    E +L     GH   +  + +   
Sbjct: 70  VADVQWSPHAGKPYWVVSTSNQKAIVWNLARSSSNAVEHEL----HGHTRAITDINFHPI 125

Query: 118 DGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTV 177
               LATCS D  V  W+   S   +   S   + S     V W+  +A + +SS+  TV
Sbjct: 126 HPELLATCSIDTYVHAWDMRCSQRPFYGTS---DWSSGASQVKWNFKDANIIASSHASTV 182

Query: 178 RIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKY 228
            IW D       +  LNG   +V + DF++      + S  +D T++ W Y
Sbjct: 183 FIW-DIRKGSVPLYRLNGSGSSVNNIDFNRNNEC-EIMSSYNDGTIKFWDY 231

>Scas_512.3
          Length = 534

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 80/192 (41%), Gaps = 43/192 (22%)

Query: 27  LATGSTDRKIK---LVSVKYDDFTLIDVLD----ETAHKKAIRSVAWRPHTSLLAAGSFD 79
           L T   D KI+   L  VK  D   ID +D     T H++AI  V +    ++LA+   D
Sbjct: 31  LLTAGGDNKIRSWNLNLVK--DTNKIDTIDFLSSLTQHEQAINVVKFNSPGTILASAGDD 88

Query: 80  STVSIWAKEESADR------------------TFEMD------------LLAIIEGHENE 109
             + +W +++  ++                  TFE D             L     + +E
Sbjct: 89  GQILLWKQQDVNEQNGETAAPVDSSVPKPFGSTFEDDEENNKESWFVWKRLRAPGSNSSE 148

Query: 110 VKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLA 169
           +  + WS    Y+ + S D S+ +++  ESG   + +    +H+  V+ V W P    + 
Sbjct: 149 IYDLDWSPCDRYVVSGSMDNSIRVFDI-ESG---KLLGTYADHNHYVQGVTWDPLNEFIL 204

Query: 170 SSSYDDTVRIWK 181
           S S D +V I++
Sbjct: 205 SQSADRSVNIYQ 216

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/90 (21%), Positives = 44/90 (48%), Gaps = 7/90 (7%)

Query: 59  KAIRSVAWRPHTS----LLAAGSFDSTVSIWAKE--ESADRTFEMDLLAIIEGHENEVKG 112
           + + S+ ++P++     LL AG  D+ +  W     +  ++   +D L+ +  HE  +  
Sbjct: 14  QPVYSLCFQPNSPNKKKLLTAGG-DNKIRSWNLNLVKDTNKIDTIDFLSSLTQHEQAINV 72

Query: 113 VAWSNDGYYLATCSRDKSVWIWETDESGEE 142
           V +++ G  LA+   D  + +W+  +  E+
Sbjct: 73  VKFNSPGTILASAGDDGQILLWKQQDVNEQ 102

>KLLA0B11077g complement(970761..972464) similar to sgd|S0006341
           Saccharomyces cerevisiae YPR137w RRP9 protein associated
           with the U3 small nucleolar RNA, required for
           pre-ribosomal RNA processing, start by similarity
          Length = 567

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 56/126 (44%), Gaps = 6/126 (4%)

Query: 102 IIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIW 161
           + EGH +E+  VA S DG Y+ +  RD+ + +W T ES    + I       + +     
Sbjct: 227 VTEGHYDEILTVAASPDGKYVVSGGRDRKLIVWST-ESLAPVKIIPTKDRRGEVLGLAFK 285

Query: 162 HPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDS 221
             S+ L A+ + D  +R +    + +  + +L GH+  V   D         +  GS D 
Sbjct: 286 KNSDQLFAACA-DYKIRTYA--INQFSQLEILYGHQDLVI--DISALNMERCVTVGSRDR 340

Query: 222 TVRVWK 227
           T  +WK
Sbjct: 341 TAMLWK 346

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,079,333
Number of extensions: 543232
Number of successful extensions: 4317
Number of sequences better than 10.0: 425
Number of HSP's gapped: 2939
Number of HSP's successfully gapped: 1081
Length of query: 325
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 223
Effective length of database: 13,065,073
Effective search space: 2913511279
Effective search space used: 2913511279
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)