Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR266C63962129910.0
CAGL0M08668g65756714800.0
Scas_615.1267458414600.0
Sklu_1676.265060712711e-168
Scas_699.3861264512061e-158
Kwal_55.2000061760511851e-155
AER391C63256411211e-145
KLLA0E16698g65660110151e-129
Kwal_47.1771963558780.26
Scas_553.3*102567750.65
KLLA0C08756g42765731.0
CAGL0J03586g41164711.6
CAGL0B05049g147079702.3
YCR066W (RAD18)48749692.8
Scas_720.8946949692.9
KLLA0F01463g781145693.3
AGR233W28457648.2
KLLA0B03454g472140658.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR266C
         (628 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR266C (YDR266C) [1099] chr4 complement(1000096..1002015) Prote...  1156   0.0  
CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces c...   574   0.0  
Scas_615.12                                                           566   0.0  
Sklu_1676.2 YDR266C, Contig c1676 743-2695                            494   e-168
Scas_699.38                                                           469   e-158
Kwal_55.20000                                                         461   e-155
AER391C [2891] [Homologous to ScYDR266C - SH] (1371409..1373307)...   436   e-145
KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674 Sac...   395   e-129
Kwal_47.17719                                                          35   0.26 
Scas_553.3*                                                            33   0.65 
KLLA0C08756g complement(765847..767130) weakly similar to sp|P10...    33   1.0  
CAGL0J03586g complement(341290..342525) similar to sp|P10862 Sac...    32   1.6  
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    32   2.3  
YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA ...    31   2.8  
Scas_720.89                                                            31   2.9  
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    31   3.3  
AGR233W [4544] [Homologous to ScYGL221C (NIF3) - SH] complement(...    29   8.2  
KLLA0B03454g complement(314015..315433) some similarities with s...    30   8.4  

>YDR266C (YDR266C) [1099] chr4 complement(1000096..1002015) Protein
           of unknown function, contains a RING finger domain [1920
           bp, 639 aa]
          Length = 639

 Score = 1156 bits (2991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/621 (90%), Positives = 563/621 (90%)

Query: 1   MSESVKENVTPTRNFRRTQGPQNNTKPHXXXXXXXXXXXXXXLSAEPNLTTSSADDTDEE 60
           MSESVKENVTPTRNFRRTQGPQNNTKPH              LSAEPNLTTSSADDTDEE
Sbjct: 1   MSESVKENVTPTRNFRRTQGPQNNTKPHNDRKNFRRKQKKNNLSAEPNLTTSSADDTDEE 60

Query: 61  NELCVICARKLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICRTENEEVMFTDRIDGDI 120
           NELCVICARKLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICRTENEEVMFTDRIDGDI
Sbjct: 61  NELCVICARKLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICRTENEEVMFTDRIDGDI 120

Query: 121 SDKYNFCEKNEKYGINFTSEEVATETLNLLKFFCPLSKDEQVCDFGSFKKYNEHLKSEHN 180
           SDKYNFCEKNEKYGINFTSEEVATETLNLLKFFCPLSKDEQVCDFGSFKKYNEHLKSEHN
Sbjct: 121 SDKYNFCEKNEKYGINFTSEEVATETLNLLKFFCPLSKDEQVCDFGSFKKYNEHLKSEHN 180

Query: 181 RMICLICATHKHAFPCELEIFTQNQLRNHQTKGNSEGFKGHPMCAFCSGKRFYSDDELYI 240
           RMICLICATHKHAFPCELEIFTQNQLRNHQTKGNSEGFKGHPMCAFCSGKRFYSDDELYI
Sbjct: 181 RMICLICATHKHAFPCELEIFTQNQLRNHQTKGNSEGFKGHPMCAFCSGKRFYSDDELYI 240

Query: 241 HMRNQHEKCHICDKMNPASPQYFKDYNQLFDHFKHSHYVCTVQTCLDNKFVVFKDELELQ 300
           HMRNQHEKCHICDKMNPASPQYFKDYNQLFDHFKHSHYVCTVQTCLDNKFVVFKDELELQ
Sbjct: 241 HMRNQHEKCHICDKMNPASPQYFKDYNQLFDHFKHSHYVCTVQTCLDNKFVVFKDELELQ 300

Query: 301 AHILQEHGNILKGKPKFFQSELSTFISAPSRVIRERDDYDXXXXXXXXXXXXXXRTDVRS 360
           AHILQEHGNILKGKPKFFQSELSTFISAPSRVIRERDDYD              RTDVRS
Sbjct: 301 AHILQEHGNILKGKPKFFQSELSTFISAPSRVIRERDDYDLPSISSLPGSSSGSRTDVRS 360

Query: 361 ASSPEESRLRLAERAKYYLENSKEDFNKFSSYNEDYSKGRLSAEKLLESYKLLFTKPNAD 420
           ASSPEESRLRLAERAKYYLENSKEDFNKFSSYNEDYSKGRLSAEKLLESYKLLFTKPNAD
Sbjct: 361 ASSPEESRLRLAERAKYYLENSKEDFNKFSSYNEDYSKGRLSAEKLLESYKLLFTKPNAD 420

Query: 421 VYLLIHNLAETFPKNSSKYNNLNAIYEQREQTLARQTXXXXXXXXXXXXXXIGRGHWGGT 480
           VYLLIHNLAETFPKNSSKYNNLNAIYEQREQTLARQT              IGRGHWGGT
Sbjct: 421 VYLLIHNLAETFPKNSSKYNNLNAIYEQREQTLARQTSLPSLSSDSSLSMSIGRGHWGGT 480

Query: 481 NDGGSAGAALGVRNIKNLPTLKSPSASYDPFATTVKKNTLRPVQNIKRTTPQSVSYRTST 540
           NDGGSAGAALGVRNIKNLPTLKSPSASYDPFATTVKKNTLRPVQNIKRTTPQSVSYRTST
Sbjct: 481 NDGGSAGAALGVRNIKNLPTLKSPSASYDPFATTVKKNTLRPVQNIKRTTPQSVSYRTST 540

Query: 541 NTVAFSPTYLESKKGSSSTSLNNSKDXXXXXXXXXXXXXXXXVQIPGLNRPQIADPKQWG 600
           NTVAFSPTYLESKKGSSSTSLNNSKD                VQIPGLNRPQIADPKQWG
Sbjct: 541 NTVAFSPTYLESKKGSSSTSLNNSKDKLKSLNLPQLPPPKPKVQIPGLNRPQIADPKQWG 600

Query: 601 KKSSTQDTNVHDNLRELNTTS 621
           KKSSTQDTNVHDNLRELNTTS
Sbjct: 601 KKSSTQDTNVHDNLRELNTTS 621

>CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces
           cerevisiae YDR266c, start by similarity
          Length = 657

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/567 (50%), Positives = 388/567 (68%), Gaps = 34/567 (5%)

Query: 54  ADDTDEENELCVICARKLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICRTENEEVMFT 113
           A + D++ ELC+ICAR L Y SL+PC+H TCH+C FRQRALY KKSCLICRTEN+ + FT
Sbjct: 67  AREEDDDTELCIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKSCLICRTENDRLTFT 126

Query: 114 DRIDGDISDKYNFCEKNEKYGINFTSEEVATETLNLLKFFCPLSKDEQVCDFGSFKKYNE 173
           D ID   S+  +F   ++K+GI+FTS+EV   TL+LLK+ CPL  D +     ++KKYNE
Sbjct: 127 DNIDAQYSEITDFSGSDDKFGIDFTSDEVKNATLDLLKYACPLCPDNEQHVSTTYKKYNE 186

Query: 174 HLKSEHNRMICLICATHKHAFPCELEIFTQNQLRNHQTKGNSEGFKGHPMCAFCSGKRFY 233
           HLKS HNRMICLICA +KH+FP E++I+T NQL+NH ++G+SEGFKGHPMCAFC+GKRFY
Sbjct: 187 HLKSAHNRMICLICAGNKHSFPREMKIYTANQLKNHHSRGDSEGFKGHPMCAFCTGKRFY 246

Query: 234 SDDELYIHMRNQHEKCHICDKMNPASPQYFKDYNQLFDHFKHSHYVCTVQTCLDNKFVVF 293
           SDDELYIHMRN HEKCHICD+++   PQYFKDY QLF+HF+ SHYVCTVQ+CLD+KFVVF
Sbjct: 247 SDDELYIHMRNDHEKCHICDRIDHTQPQYFKDYEQLFEHFRTSHYVCTVQSCLDDKFVVF 306

Query: 294 KDELELQAHILQEHGNILKGKPKFFQSELSTFISAPSRVIRERDDYDXXXXXXXXXXXXX 353
           KD++ELQAHIL+EHG+IL+GKPKFFQSELSTFISAPS+VIRERD Y+             
Sbjct: 307 KDDMELQAHILKEHGDILRGKPKFFQSELSTFISAPSQVIRERDSYNYDMGSVGS----- 361

Query: 354 XRTDVRSASSPEESRLRLAERAKYYLENSKEDFNKFSSYNEDYSKGRLSAEKLLESYKLL 413
             +++  +S+PE +RLR+ ERAK+YL +S E F KF + NE+Y    L+A +L++ YK L
Sbjct: 362 --SNIEESSNPEVNRLRMNERAKHYLNSSLEGFQKFETLNENYDSSVLTASQLVQEYKKL 419

Query: 414 FTKPNADVYLLIHNLAETFPKNSSKYNNLNAIYEQREQTLARQTXXXXXXXXXXXXXXIG 473
           FT  +AD+YLL+HNL+  +PKNS K+ +L+ IY++ EQT  R+               + 
Sbjct: 420 FTDTHADIYLLVHNLSALYPKNSKKFKDLDVIYQEYEQTEKRKN--ALPSLLDDHIQTVP 477

Query: 474 RGHWGGTNDGGSAGAALGVRNIKNLPTLKSPSASYDPFATTVK-------KNTLRPVQN- 525
            G WG +   G + +   ++N+  LP+L   S+S+DPF    K       + + +PV + 
Sbjct: 478 GGAWGSST--GRSKSHSSIKNLNQLPSLGGVSSSFDPFKNPNKAPVYKGLRQSPKPVVSA 535

Query: 526 IKRTTPQSVSYR-TSTNTVAF---------SPTYLESKKGSSSTSLNNSKDXXXXXXXXX 575
            +R TP  +S R T++N V F         +P++     GS  +S ++SK+         
Sbjct: 536 TQRQTPMRISARPTASNRVEFNGGSTTKAATPSW-----GSQPSSNSSSKNKLADLNLPT 590

Query: 576 XXXXXXXVQIPGLNRPQIADPKQWGKK 602
                  V IP ++ P I DPK+WG+K
Sbjct: 591 LPAPKPKVYIPPVHEPVIPDPKKWGQK 617

>Scas_615.12
          Length = 674

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/584 (52%), Positives = 384/584 (65%), Gaps = 41/584 (7%)

Query: 63  LCVICARKLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICRTENEEVMFTDRIDGDISD 122
           LC+ICA KL Y SL+PC+H TCH C F+QR+LYNKK+CLICRTEN++++FT+ I+ + +D
Sbjct: 71  LCLICASKLVYASLSPCNHTTCHKCSFKQRSLYNKKACLICRTENDKLIFTENINANYTD 130

Query: 123 K----YNFCEKNEKYGINFTSEEVATETLNLLKF---FCPLSKDE-QVCDFGSFKKYNEH 174
                Y F   NEKYGI FTSEEVAT TLNLLK+    CP +KD  +  DFGS+KKYNEH
Sbjct: 131 SNLGHYQF---NEKYGIVFTSEEVATATLNLLKYTCSVCPANKDGIEREDFGSYKKYNEH 187

Query: 175 LKSEHNRMICLICATHKHAFPCELEIFTQNQLRNHQTKGNSEGFKGHPMCAFCSGKRFYS 234
           L+S+HN+ +C ICA + H FP EL ++TQNQLRNHQ+KGNSEGFKGHP+CAFCSG+RFY 
Sbjct: 188 LRSKHNKCLCTICAQNNHIFPSELPVYTQNQLRNHQSKGNSEGFKGHPLCAFCSGQRFYG 247

Query: 235 DDELYIHMRNQHEKCHICDKMNPASPQYFKDYNQLFDHFKHSHYVCTVQTCLDNKFVVFK 294
           DDELY+HMRN+HEKCHICDK++  SPQYFKDY+QLFDHFK+ HY+CTVQTCLDNKF+VFK
Sbjct: 248 DDELYVHMRNKHEKCHICDKIDHNSPQYFKDYDQLFDHFKNFHYICTVQTCLDNKFIVFK 307

Query: 295 DELELQAHILQEHGNILKGKPKFFQSELSTFISAPSRVIRERD--DYDX---------XX 343
           DELELQAHIL+EHG++++GKPK FQSELSTF+S PSRV+R+RD  +YD            
Sbjct: 308 DELELQAHILKEHGDLIRGKPKLFQSELSTFMSGPSRVVRDRDAMNYDMDSRPSLFSSSP 367

Query: 344 XXXXXXXXXXXRTDVRSASSPEESRLRLAERAKYYLENSKEDFNKFSSYNEDYSKGRLSA 403
                        D      PE  +LRL ERAKYYLENS+E ++KF   N++Y KG L+ 
Sbjct: 368 SSSATPLGTDGNDDNSDNDIPELRQLRLEERAKYYLENSQELYDKFIKCNDEYDKGYLTG 427

Query: 404 EKLLESYKLLFTKPNADVYLLIHNLAETFPKNSSKYNNLNAIYEQREQTLARQTXXXXXX 463
             LL+SYK +FT P ++VYLLI+N+A+ +PKNS K+  LNAIYE +EQ L  Q       
Sbjct: 428 LGLLDSYKEIFTTPQSNVYLLINNVAKLYPKNSPKFKELNAIYEAQEQKLYLQNGLPSLS 487

Query: 464 XXXXXXXXIGRGHWGGTNDGGSAGAALGVRNIKNLPTLKSPSASYDPFATTVKKN-TLRP 522
                        W   N+ GS       RNI++LPTL++ S S+DPFATTVKK   LR 
Sbjct: 488 GSSASISS-ATRSW---NNSGSVAMN---RNIRDLPTLEAKSKSFDPFATTVKKTPALRT 540

Query: 523 VQN--IKRTTPQSVSY-------RTSTNTVAFSPTYLESKKGSSSTSLNNSKDXXXXXXX 573
           ++   +K+ +P  ++Y        +S +TV   PT   S      +S N           
Sbjct: 541 MKKTVVKKVSPSPIAYTPLGGSSLSSLSTVPRLPTTNVSNTVRMGSSTNGKNKKLADLNL 600

Query: 574 XXXXXXXXXVQIPGLNRPQIADPKQWGKKSSTQDTNVHDNLREL 617
                    V IP L +  I DPKQWG     Q+    DNL  L
Sbjct: 601 PQLPTPKPKVYIPPLRKTTIPDPKQWG--GGGQNVPSTDNLPSL 642

>Sklu_1676.2 YDR266C, Contig c1676 743-2695
          Length = 650

 Score =  494 bits (1271), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 272/607 (44%), Positives = 370/607 (60%), Gaps = 20/607 (3%)

Query: 13  RNFRRTQGPQNNTKPHXXXXXXXXXXXXXXLSAEP----NLTTSSADDTDEEN-ELCVIC 67
           RNFRRTQ  Q   K                 + E     N T+S  D+ +E++ E+C+IC
Sbjct: 11  RNFRRTQDSQAPRKSDTNSSRSNGGKWKRAFADENLSSLNQTSSPGDNLEEDDGEICIIC 70

Query: 68  ARKLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICRTENEEVMFTDRIDGDISD--KYN 125
           A    Y++L+ C H TCH C FRQRALY KK CLICRTENE+++FTD+ D   +D    +
Sbjct: 71  ANPRKYIALSACSHTTCHKCTFRQRALYGKKGCLICRTENEQLIFTDKFDHQFADFTPRD 130

Query: 126 FCEKNEKYGINFTSEEVATETLNLLKFFCPLSKDEQVCDFGSFKKYNEHLKSEHNRMICL 185
           F + +E+YGI FTSE V T TL LLK+ CP   D    DF SFKKYNEHLK+ HN+ IC+
Sbjct: 131 FAKTSEEYGIAFTSEAVYTATLQLLKYNCPFG-DVADKDFESFKKYNEHLKTSHNKTICM 189

Query: 186 ICATHKHAFPCELEIFTQNQLRNHQTKGNSEGFKGHPMCAFCSGKRFYSDDELYIHMRNQ 245
           ICA +K AFP EL+IFT NQLRNHQ++G+S GFKGHPMC FC+G+RFYSDDELY+HMR++
Sbjct: 190 ICANNKKAFPSELKIFTPNQLRNHQSRGDSHGFKGHPMCGFCTGQRFYSDDELYVHMRDR 249

Query: 246 HEKCHICDKMNPASPQYFKDYNQLFDHFKHSHYVCTVQTCLDNKFVVFKDELELQAHILQ 305
           HE+CHICD+++  +PQYFK+Y+QLF+HF++SHYVCTVQTCL++KFVVF+D+++LQAHIL+
Sbjct: 250 HERCHICDQIDSTNPQYFKNYDQLFEHFRNSHYVCTVQTCLESKFVVFRDDIDLQAHILK 309

Query: 306 EHGNIL---KG----KPKFFQSELSTFISAPSRVIRERDDYDXXXXXXXXXXXXXXRTDV 358
           EH  IL   KG      + FQSELSTF + P+R + ERD +D               T+ 
Sbjct: 310 EHRTILANDKGNIPVAGRRFQSELSTFSATPARAVHERDTFDTPALRSSSAARSANTTN- 368

Query: 359 RSASSPEESRLRLAERAKYYLENSKEDFNKFSSYNEDYSKGRLSAEKLLESYKLLFTKPN 418
            S SSPE  R+R+ ERA++YL  S+ +F  F + NEDY K  LSAE +  +Y+ LF  P+
Sbjct: 369 -SNSSPEVKRMRMEERARHYLNYSQPEFEAFLAINEDYRKNTLSAEDVFTAYQKLFNSPS 427

Query: 419 ADVYLLIHNLAETFPKNSSKYNNLNAIYEQREQTLARQTXXXXXXXXXXXXXXIGRGHWG 478
           ADV LLI++ +  FP+NS+K+ +L AIYE  ++    Q                  G   
Sbjct: 428 ADVPLLIYDFSGMFPQNSAKHKDLFAIYEAEQKKNNHQINFPSLAPPSSVAAANVIGGSW 487

Query: 479 GTNDGGSAGAALGVRNIKNLPTLKSPSASYDPFATTVKKNTLRPVQNIKRTTPQSVSYRT 538
           G +   S+ ++       N P L  P  S   F  T KK + + +    RT P  V   +
Sbjct: 488 GRSSSPSSASSSKSSGRYNFPALSKPVNSQPLF--TPKKASFKSLNTNVRTAP-VVKKAS 544

Query: 539 STNTVAFSPTYLESKKGSSSTSLNNSKDXXXXXXXXXXXXXXXXVQIPGLNRPQIADPKQ 598
           + N   ++PTYL++K  SS +  ++S                   + P +N P I +P+Q
Sbjct: 545 ANNGTNYTPTYLQNKSTSSGSLSSSSASISEEKFPPLPKAQKKKFRAPLVNEPNIPNPQQ 604

Query: 599 WGKKSST 605
           WG  SS+
Sbjct: 605 WGVSSSS 611

>Scas_699.38
          Length = 612

 Score =  469 bits (1206), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 268/645 (41%), Positives = 365/645 (56%), Gaps = 72/645 (11%)

Query: 9   VTPTRNFRRTQGPQNNTKPHXXXXXXXXXXXXXXLSAEPNLTTSSADDTDEENELCVICA 68
           + P RNFRRTQG  N T                             +  D++  +CVICA
Sbjct: 4   IKPRRNFRRTQGGSNTTTTDNKKKQHSHRH---------------EEINDDDENVCVICA 48

Query: 69  RKLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICRTE--NEEVMFTDRIDGDISDKYNF 126
             + + + +PC+HKTCH C FRQ AL++KKSCLICRT+  N  ++FT++++    + +N 
Sbjct: 49  NPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTEKLNSQAYEDFNS 108

Query: 127 CEK-----NEKYGINFTSEEVATETLNLLKFFCPLSKDEQ------VCDFGSFKKYNEHL 175
                   N KYGI FTS++VA ETLNL KF C +   E         D+ SFKK NEHL
Sbjct: 109 NMWQTDLINTKYGIKFTSDDVAKETLNLSKFICSVCIIEDKENVMNATDYKSFKKLNEHL 168

Query: 176 KSEHN-RMICLICATHKHAFPCELEIFTQNQLRNHQTKGN-SEGFKGHPMCAFCSGKRFY 233
           K EHN + IC+ICA H  +FP EL+I+T NQL+NH  KG+ ++GFKGHPMC FCS KRFY
Sbjct: 169 KLEHNNKTICMICADHHFSFPSELKIYTTNQLKNHNNKGSETDGFKGHPMCKFCSNKRFY 228

Query: 234 SDDELYIHMRNQHEKCHICDKMNPASPQYFKDYNQLFDHFKHSHYVCTVQTCLDNKFVVF 293
           S DEL  HMR +HE+CHICDK++  +PQ+FK+Y+QLF HFK+SHY+CT QTCLD+KF+VF
Sbjct: 229 SQDELMSHMREKHERCHICDKIDHNNPQFFKNYDQLFHHFKNSHYICTFQTCLDDKFIVF 288

Query: 294 KDELELQAHILQEHGNILKGKPKFFQSELSTFISAPSRVIRERDDYDXXXXXXXXXXXXX 353
           KD++ELQAHILQEHG++++GKPKFFQSELSTFIS PSRVI + + +              
Sbjct: 289 KDDMELQAHILQEHGDLIRGKPKFFQSELSTFISTPSRVITDDNAFTSQHSFSDSSLPSL 348

Query: 354 XRTDVRSA--SSPEESRLRLAERAKYYLENSKEDFNKFSSYNEDYSKGRLSAEKLLESYK 411
              +  +A  SS E  +LRL ERAK+YL+NS EDF  F + N+ Y+  +L+A +LL SYK
Sbjct: 349 NSVNSTNANNSSQEVKQLRLDERAKHYLDNSHEDFQTFINLNKQYAANKLTAAQLLNSYK 408

Query: 412 LLFTKPNADVYLLIHNLAETFPKNSSKYNNLNAIYEQREQTLARQTXXXXXXXXXXXXXX 471
            LF  P +DV+LLIHNL+E +P NS KY  L++IY  +E+ L+++               
Sbjct: 409 NLFQTPQSDVHLLIHNLSELYPMNSLKYKELDSIYRAQEKKLSKKPQLPSLYNDPSSSSS 468

Query: 472 IGRGHWGGTNDGGSAGAALGVRNIKNLPTLKSPSASYDPFATTVKKNTLRPVQNIKRTTP 531
           +    WG +    +      +R   N P L  PS +  P              N+  T P
Sbjct: 469 MVNAVWGNS---NNNRNVSSLRTNTNRP-LNLPSLTSTP-------------SNLNGTRP 511

Query: 532 QSVSYRTSTNTVAFSPTYLESKKGSSSTSLNNSKDXXXXXXXXXXXXXXXXVQIPGLNRP 591
             VS+ TS+ T              S +  +N+                  V IP + + 
Sbjct: 512 LHVSHSTSSLT--------------SKSRNDNASSNSRISNLPSLPTPKPKVYIPPVRQT 557

Query: 592 QIADPKQWGKKSSTQ-DTNVHDNLRELN--------TTSGGNKKK 627
            I DP  WG++   Q + +V + +  LN        TT G  K+K
Sbjct: 558 VIPDPNSWGRRGPQQTNGDVLEGISNLNMNGNSSSQTTRGSGKRK 602

>Kwal_55.20000
          Length = 617

 Score =  461 bits (1185), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 261/605 (43%), Positives = 361/605 (59%), Gaps = 47/605 (7%)

Query: 13  RNFRRTQGPQNNTKPHXXXXXXXXXXXXXXLSAEPNLTTSSADDTDEENELCVICARKLT 72
           R+FRRTQG Q  ++P                    N  T   ++ DE+ ++C+ICA KLT
Sbjct: 9   RSFRRTQGTQ--SRPRKESGKNTESSWKRTF----NQGTEGENELDED-DICIICAEKLT 61

Query: 73  YVSLTPCHHKTCHICGFRQRALYNKKSCLICRTENEEVMFTDRIDG--DISDKYNFCEKN 130
           YV+L+PC+H TC+ C FRQRALYNKKSCL+CRTE++ V+F+   +   D  D+ N  E N
Sbjct: 62  YVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTESDLVIFSADRNAVFDDFDEKNLVETN 121

Query: 131 EKYGINFTSEEVATETLNLLKFFCPLSKDEQVCDFGSFKKYNEHLKSEHNRMICLICATH 190
              G++FTS++VA++TL LL + CP   D    +  +FKKYN HLK+EHN+ +C+ICA+H
Sbjct: 122 VDLGVSFTSQDVASKTLGLLIYSCPFG-DTGGTNHENFKKYNAHLKNEHNKTLCMICASH 180

Query: 191 KHAFPCELEIFTQNQLRNHQTKGNSEGFKGHPMCAFCSGKRFYSDDELYIHMRNQHEKCH 250
           K AFP EL I+T +QLR HQ+KG+SEGFKGHPMC FCSG+RFYSDDEL +HMR++HEKCH
Sbjct: 181 KKAFPSELRIYTPSQLRIHQSKGDSEGFKGHPMCGFCSGQRFYSDDELNVHMRDRHEKCH 240

Query: 251 ICDKMNPASPQYFKDYNQLFDHFKHSHYVCTVQTCLDNKFVVFKDELELQAHILQEHGNI 310
           ICD+ N  SPQYFKDY+QLF+HFK  HYVC VQ+CLD+KFVVF+D+L+LQAHIL+EHG I
Sbjct: 241 ICDQTNINSPQYFKDYDQLFEHFKFDHYVCGVQSCLDSKFVVFRDDLDLQAHILKEHGGI 300

Query: 311 L---------KGKPKFFQSELSTFISAPSRVIRERDDYDXXXXXXXXXXXXXXRTDVRSA 361
           L         KG  K +QS+LSTF   PSR    +D  D                   S 
Sbjct: 301 LRNGNNNLSMKGGRK-YQSQLSTFSRPPSRSSSTQDVRDNTAKNNS------------SE 347

Query: 362 SSPEESRLRLAERAKYYLENSKEDFNKFSSYNEDYSKGRLSAEKLLESYKLLFTKPNADV 421
           +S E  RLR+ ERA++YL+ S  DF +F + N  Y  G ++A+ +L +Y+ LF  P A V
Sbjct: 348 NSLEVKRLRMEERARHYLKYSHTDFEQFLAINSSYQNGLITAQDVLSAYEGLFKSPEAQV 407

Query: 422 YLLIHNLAETFPKNSSKYNNLNAIYEQREQTLARQTX--XXXXXXXXXXXXXIGRGHWGG 479
            LL+++ +E FP++S  + +L  IY+  ++   R T                +  G W  
Sbjct: 408 GLLLYDFSELFPQSSKLHQDLRVIYDTVQKKENRHTNFPSLSALNPTLLPGSVASGSW-- 465

Query: 480 TNDGGSAGAALGVRNIKNLPTLKSPSASYDPFATTVKKNTLRPVQNIK-RTTPQSVSYRT 538
              G S G+    R   N P+LK P++   P  T  KK +   V N++ +     V+ + 
Sbjct: 466 ---GRSTGSNKAARQY-NFPSLKKPASPQPPIIT--KKPSSTKVNNVQPKAKAVPVTRKP 519

Query: 539 STNTVAFSPTYLESKKGSSSTSLNNSKDXXXXXXXXXXXXXXXXVQIPGLNRPQIADPKQ 598
           S+N  +F PTYL+ K+ S+S+S    ++                 + P +N   I +P Q
Sbjct: 520 SSNESSFKPTYLDGKQKSASSSPALDRE----KFPPLPKSQARKFRAPLVNEASIPNPSQ 575

Query: 599 WGKKS 603
           WGK S
Sbjct: 576 WGKSS 580

>AER391C [2891] [Homologous to ScYDR266C - SH] (1371409..1373307)
           [1899 bp, 632 aa]
          Length = 632

 Score =  436 bits (1121), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 239/564 (42%), Positives = 329/564 (58%), Gaps = 40/564 (7%)

Query: 52  SSADDTDEEN--ELCVICARKLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICRTENEE 109
           S   DT+E+N    C+ICA  L YV+L+PC+H TCH C FRQRALY KK+CL+CRTE+E 
Sbjct: 53  SPCGDTEEDNGEMTCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTEHEY 112

Query: 110 VMFTDRIDGDIS--DKYNFCEKNEKYGINFTSEEVATETLNLLKFFCPLSKDEQVCDFGS 167
           ++FTD+I  + +     +    +++YGI FTS    + TL+LLK+ CP   D    D  S
Sbjct: 113 LIFTDQIKAEHARFGPRDIVAVDDRYGIQFTSLNAESVTLSLLKYNCPYG-DVPEFDLDS 171

Query: 168 FKKYNEHLKSEHNRMICLICATHKHAFPCELEIFTQNQLRNHQTKGNSEGFKGHPMCAFC 227
           FK YNEHLK+EH R IC ICA H+  FP E++  T NQL+ H T G+S+GF GHP+C FC
Sbjct: 172 FKNYNEHLKNEHKRSICTICARHRKQFPAEMKTLTPNQLKIHNTIGDSKGFTGHPLCGFC 231

Query: 228 SGKRFYSDDELYIHMRNQHEKCHICDKMNPASPQYFKDYNQLFDHFKHSHYVCTVQTCLD 287
           SGKRFYSDDELYIHMR +HEKCHICD+++   PQYFKDY+QLF+HFKHSHY+C V++CLD
Sbjct: 232 SGKRFYSDDELYIHMRERHEKCHICDQVDSTQPQYFKDYDQLFEHFKHSHYICAVRSCLD 291

Query: 288 NKFVVFKDELELQAHILQEHGNILKGKPKF-------FQSELST-FISAPSRVIRERDDY 339
           +KFVVF D+L+LQAH+L+EH NI+  K          ++SELS+ F    SR + E    
Sbjct: 292 SKFVVFADDLDLQAHMLKEHPNIMGNKSTISLTAGRRYRSELSSGFTPNVSRAVHETSSS 351

Query: 340 DXXXXXXXXXXXXXXRTDVRSASSPEESRLRLAERAKYYLENSKEDFNKFSSYNEDYSKG 399
           +               + V +A SPE  R RL ERA++YL  S+ +   F   N DY+  
Sbjct: 352 NALALGPSV-------SPVATAESPEMKRKRLEERARHYLNYSQSEMKLFEQINNDYNNN 404

Query: 400 RLSAEKLLESYKLLFTKPNADVYLLIHNLAETFPKNSSKYNNLNAIYEQREQTLARQTXX 459
            +SA  +   Y  LF  P AD +LL+ N A+TFP+ S KY  LNAIY+  ++   RQ   
Sbjct: 405 VISATSVQRRYDQLFRNPEADTHLLLRNFADTFPEGSLKYKELNAIYQAEQEKRERQAKF 464

Query: 460 XXXXXXXXXXXXIGRGHWGGTNDGGSAGAALGVRNIKNLPTLKSP-SASYDPFATTVKKN 518
                       +    WG   +GG + ++      +N P+L S  + SY       KK 
Sbjct: 465 PSLSTNPWYSAPVVGAAWG--KNGGKSSSS------RNFPSLSSALTDSYQNVTPQPKKP 516

Query: 519 T-LRPVQNIKRTTPQSVSYRTSTNTVAFSPTYLESKKGSSSTSLNNSKDXXXXXXXXXXX 577
              RP   +  ++ Q  + + ++N   ++PTYL+SK    S + +N+             
Sbjct: 517 VPYRPTSPVASSSTQVQNTKRNSN---YTPTYLKSKTKGESRAQSNA-----ALFPPLSS 568

Query: 578 XXXXXVQIPGLNRPQIADPKQWGK 601
                 + P +N  ++ DPKQWGK
Sbjct: 569 PDTKKFRAPPVN--ELPDPKQWGK 590

>KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674
           Saccharomyces cerevisiae YDR266c, start by similarity
          Length = 656

 Score =  395 bits (1015), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 229/601 (38%), Positives = 335/601 (55%), Gaps = 55/601 (9%)

Query: 46  EPNLTTSSADDTDEENELCVICARKLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICRT 105
           E ++ T +  D D+ + +C+ICA KL  ++L+PC+H TCH C  RQRALY KK CL CR+
Sbjct: 71  EKSMGTGNGTDDDDSSNVCLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCRS 130

Query: 106 ENEEVMFTDRIDG-----DISDKYNFCEKNEKYGINFTSEEVATETLNLLKFFCPLSKDE 160
           E E+++FTD+I       D   K  F  KNEK GI FTS+ V  + +NLLK+  P     
Sbjct: 131 EVEDIIFTDKIKETYEHLDKKAKLEF--KNEKLGIRFTSKNVMNDAMNLLKYVSPFGDAN 188

Query: 161 QVCDFGSFKKYNEHLKSEHNRMICLICATHKHAFPCELEIFTQNQLRNHQTKGN-SEGFK 219
           +  DFGSFKK NE L+ EHN+ IC+ICA HK AFP EL++ T  QL+ H+++G+  +GFK
Sbjct: 189 K--DFGSFKKLNEFLRQEHNKTICMICAGHKKAFPGELKVMTVKQLKIHESRGDPKDGFK 246

Query: 220 GHPMCAFCSGKRFYSDDELYIHMRNQHEKCHICDKMNPASPQYFKDYNQLFDHFKHSHYV 279
           GHPMC FCSGKRFYSDDELY HM+  HE+CHICD+++P+ PQYFK+Y  LF+HFK +HYV
Sbjct: 247 GHPMCGFCSGKRFYSDDELYKHMKLSHERCHICDQLDPSQPQYFKNYEDLFEHFKSAHYV 306

Query: 280 CTVQTCLDNKFVVFKDELELQAHILQEHGN----------ILKGKPKFFQSELSTFISAP 329
           CTV +CLD KFVVF DEL+L+AHI++EH +          ++    K F+S+++TF S P
Sbjct: 307 CTVPSCLDAKFVVFSDELDLRAHIIKEHPHLAGDSRRAMTLIDNTSKKFRSQITTF-SNP 365

Query: 330 SRVIRERDDYDXXXXXXXXXXXXXXRTDVRSASSPEESRLRLAERAKYYLENSKEDFNKF 389
           +R+I  +++                  +  SA+S +  R R+ +RA++YL NS+ DF  F
Sbjct: 366 TRIIDAQNE------------------ESNSANSRDVKRRRMEQRARHYLGNSEPDFQSF 407

Query: 390 SSYNEDYSKGRLSAEKLLESYKLLFTKPNADVYLLIHNLAETFPKNSSKYNNLNAIYEQR 449
              N+ ++K  +SA++L   Y+ LF +   D+ LLI++L+E +   S K+  L AIYE  
Sbjct: 408 LIINDLFNKNEISAQELQSKYEDLFKQHADDIQLLIYDLSELYHSTSDKHKRLRAIYEGI 467

Query: 450 EQTLARQTXXXXXXXXXXXXXXIGRGHWGGTNDGGSAGAALGVRNIK--NLPTLKSPSAS 507
            +                    +  G WG  +  G  G+     N+K  +LP +  P  S
Sbjct: 468 MKKKENAGKFKPLVADSSSSVNVVYGKWGKKSSSGVGGS-----NVKFTSLPAVSEPIFS 522

Query: 508 YDPFATTVKKN-TLRPVQNIKRTTPQSVSYRTSTNTVAFSPTYLESKKGSSSTSLNNSKD 566
                T ++KN +  P   + R+   S S  +++   A      +S  GSS+  +N+  +
Sbjct: 523 SKASYTNLRKNGSSSPSSPVIRSGLTSNSSSSTSLNYA---KKNQSPPGSSTVVVNSQPN 579

Query: 567 XXXXXXXXXXX-----XXXXXVQIPGLNRPQIADPKQWGKKSSTQDTNVHDNLRELNTTS 621
                                   P + +  I +P  WGK  +  D+   D+L      S
Sbjct: 580 VTAIKSPNPTSFPKLQATKKKFVAPPVKQTTIPNPSTWGKPQNDNDSINLDSLDNALPAS 639

Query: 622 G 622
           G
Sbjct: 640 G 640

>Kwal_47.17719
          Length = 635

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 50  TTSSADDTDEENELCVICARKLTYVSLTPCH-HKTCHICGFRQRALYNKKSCLICRTE 106
           T+S+A D  + +  CV+C   +  + L PC     C  C     AL   K+C+ CR+E
Sbjct: 569 TSSNATDKSDRDLACVVCKSNIRNIVLWPCKCFAVCEDCRV-SLALRGFKTCICCRSE 625

>Scas_553.3*
          Length = 1025

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 7/67 (10%)

Query: 249 CHICDKMNPASPQYFKDYNQLFDHFKHSHYVCTV--QTCLDNKFVVFKDELELQAHILQE 306
           CH+CDK  P    Y+  +   +D     H+ CT+  + C   K  +F+D+L  + H L+ 
Sbjct: 99  CHVCDK--PLRGLYYTAFGNRYD---EEHFACTICKEPCGVKKCFMFEDQLYCKYHFLKY 153

Query: 307 HGNILKG 313
                KG
Sbjct: 154 FSKRCKG 160

>KLLA0C08756g complement(765847..767130) weakly similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein singleton, start by similarity
          Length = 427

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 31/65 (47%), Gaps = 3/65 (4%)

Query: 49  LTTSSADDTDEENEL-CVICARKLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICRTEN 107
           L TS    TD ++ L C IC   L    LTPC H  C IC   ++ L  +  C +C ++ 
Sbjct: 16  LHTSVPQLTDLDSLLRCHICKDFLKASVLTPCGHSFCSICI--RKYLQKESKCPLCLSDL 73

Query: 108 EEVMF 112
            E M 
Sbjct: 74  TESML 78

>CAGL0J03586g complement(341290..342525) similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein, hypothetical start
          Length = 411

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 7/64 (10%)

Query: 64  CVICARKLTYVSLTPCHHKTCHIC--GFRQRALYNKKSCLICRTENEEVMF-TDRIDGDI 120
           C IC   L    LTPC H  C +C  G+    L N+  C +C  E  E M  ++ +  +I
Sbjct: 27  CHICKDFLKNPVLTPCGHTFCSLCIRGY----LSNEPKCPLCLHELRESMLRSEYLVNEI 82

Query: 121 SDKY 124
           ++ Y
Sbjct: 83  TETY 86

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 5/79 (6%)

Query: 48   NLTTSSADDTDEENELCVICARKLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICR--T 105
            NL+T + +        C IC + +T  ++  C H  C  C F    L N+K+C +C+  T
Sbjct: 1148 NLSTLTYEAQKNTTMECSICLQPITNGAMVNCGHLFCTSCIFSW--LKNRKTCPLCKHPT 1205

Query: 106  ENEEVM-FTDRIDGDISDK 123
             N EV  FT +++   S K
Sbjct: 1206 SNCEVYNFTFKLESGSSRK 1224

>YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA
           repair protein, required for post-replication repair
           [1464 bp, 487 aa]
          Length = 487

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 64  CVICARKLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICRTENEEVMF 112
           C IC   L    LTPC H  C +C   +  L N+ +C +C  E  E + 
Sbjct: 28  CHICKDFLKVPVLTPCGHTFCSLCI--RTHLNNQPNCPLCLFEFRESLL 74

>Scas_720.89
          Length = 469

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 2/49 (4%)

Query: 64  CVICARKLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICRTENEEVMF 112
           C IC   L    LTPC H  C +C   +  L +   C +C  E  E M 
Sbjct: 28  CHICKDFLKVPVLTPCSHTFCSLCI--REYLKDNSKCPLCLNELRESML 74

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 64/145 (44%), Gaps = 32/145 (22%)

Query: 130 NEKYGINFTSEEVATETL-NLLKFFCPLSKDEQVC---------DFGSFKKYNEHLKSEH 179
           N K+GINF  + +  +T+   +     L ++ Q C         +F S K  NEH+++ H
Sbjct: 595 NGKHGINFDVKVLDNKTMAKQVTAHKQLHEEPQSCICKWAGCNKEFDSAKSLNEHIENFH 654

Query: 180 NRMICLICATHKHAFPCELE----IFTQNQ--LRNHQTKGNSEGFKGHPMCAFCSGKRFY 233
                    +   ++ CE E    +F Q Q  +R+ +     + F+    CA C GK F 
Sbjct: 655 -------VPSGLSSYKCEWEGCNKVFVQKQKLIRHLKVHSKYKPFR----CAEC-GKCFN 702

Query: 234 SDDELYIHMRNQHE----KCHICDK 254
           + D L  H+R        KCH+C K
Sbjct: 703 TQDILTQHLRVHSGERPFKCHLCPK 727

>AGR233W [4544] [Homologous to ScYGL221C (NIF3) - SH]
           complement(1185515..1186369) [855 bp, 284 aa]
          Length = 284

 Score = 29.3 bits (64), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 13/57 (22%), Positives = 29/57 (50%)

Query: 195 PCELEIFTQNQLRNHQTKGNSEGFKGHPMCAFCSGKRFYSDDELYIHMRNQHEKCHI 251
           P +++++   +L +H+     E  K   +C   + +R Y  D +Y H++    +CH+
Sbjct: 217 PGDVDLYYTGELSHHEILRYREAGKAVIVCNHSNTERGYLRDVMYKHIQELGVECHV 273

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 56/140 (40%), Gaps = 28/140 (20%)

Query: 196 CELEIFTQNQLRNHQ---TKGNSEGFKGHPMCAFCSGKRFYSDDELYIHMRNQHEKCHIC 252
           C   + T+ QL+ H+   TK     ++G         + FY   +L  H+ + HEK   C
Sbjct: 170 CGKGVTTRQQLKRHEITHTKSFHCSYEG-------CNESFYKHPQLRSHILSVHEKKLTC 222

Query: 253 DKMNPASPQYFKDYNQLFDHFKHSH-------YVCTVQTCLDNKFVVFKDELELQAHILQ 305
               P   + F+   +L +H    H       Y C   +C D    VF     LQ HI Q
Sbjct: 223 ----PHCNKTFQRPYRLKNHIDKHHNPESTGMYQCDFLSCTD----VFSTWSSLQQHIKQ 274

Query: 306 EHGNI---LKGKPKFFQSEL 322
            H  +   + GKP   +S L
Sbjct: 275 CHPKLPCPICGKPCVAESGL 294

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.130    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,629,695
Number of extensions: 892046
Number of successful extensions: 3040
Number of sequences better than 10.0: 39
Number of HSP's gapped: 3101
Number of HSP's successfully gapped: 39
Length of query: 628
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 520
Effective length of database: 12,857,365
Effective search space: 6685829800
Effective search space used: 6685829800
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)