Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR264C (AKR1)76475039480.0
CAGL0M08712g76374621020.0
Scas_538.875257317150.0
KLLA0E16764g75275416490.0
AER388C72472416350.0
YOR034C (AKR2)74969013361e-174
Kwal_55.199873432918611e-109
Scas_699.365112734065e-42
Scas_595.82352171633e-12
KLLA0F03619g9602721687e-12
CAGL0C01309g11101041687e-12
YIL112W (HOS4)10831041633e-11
Scas_671.3010541031553e-10
Kwal_23.491410431091526e-10
KLLA0E15796g2301971288e-08
Scas_595.911481181312e-07
ADL142C2291571252e-07
CAGL0L06622g11372041302e-07
Kwal_27.127502331951226e-07
ADL244W10891091267e-07
YGR232W (NAS6)2282061208e-07
CAGL0L06600g2311591172e-06
KLLA0E18029g11511461195e-06
CAGL0F06831g1092971161e-05
YLR246W (ERF2)3591151104e-05
YKL020C (SPT23)1082701106e-05
YDL019C (OSH2)12831931071e-04
Sklu_1541.2379711051e-04
YIR033W (MGA2)1113951071e-04
YOL003C378661042e-04
Scas_679.7374991032e-04
Scas_628.41057941043e-04
AGL125C3671541023e-04
Sklu_2319.5333801014e-04
AFR600C8151441024e-04
YGR233C (PHO81)11781851026e-04
CAGL0D02508g33271997e-04
YNL326C33669997e-04
ADL143W11021431017e-04
Scas_392.237655980.001
CAGL0H00935g193112950.001
Sklu_2436.4364153980.001
KLLA0D18370g355136980.001
ACR165W113956990.001
CAGL0E02497g37656960.002
Sklu_2202.81367178970.002
Sklu_2237.5198119930.002
Kwal_23.3302353115950.002
CAGL0J07040g1245178960.002
Kwal_55.2212636065950.003
KLLA0E02068g32596940.003
Scas_700.13113366960.003
KLLA0C06204g37750940.003
CAGL0F06655g408161940.003
YDR126W (SWF1)33662930.004
CAGL0B01991g330176930.004
CAGL0K06347g35238930.004
Kwal_14.889109470940.005
CAGL0G08217g32697910.006
KLLA0E15774g1148222930.006
ADL197C390210910.007
ACL003C37560910.007
Scas_415.1452131900.010
Kwal_47.18366356135900.010
Scas_683.37820158910.011
ADR151W420123900.011
YDR459C374126880.016
Kwal_56.2245938352870.020
CAGL0D01012g802159870.027
Scas_716.48327151850.038
AGR223W1321171860.039
KLLA0F26004g336129830.059
AAR063C22085810.070
YPL110C1223151830.079
ABR203W359116820.082
Kwal_27.127511093113830.095
YMR068W (AVO2)426161820.11
KLLA0E05357g754143820.12
Scas_649.837385810.12
CAGL0B01166g80845810.15
KLLA0C01826g74148810.16
Scas_693.32329123790.19
Scas_587.475143800.19
KLLA0C09108g20852770.22
AGR065W32650780.23
Scas_713.9120840790.28
Scas_685.12113188780.34
KLLA0D06149g34937760.48
YLR182W (SWI6)80333760.51
KLLA0F19690g32443750.56
Kwal_33.1325966433750.66
Sklu_2055.374346750.76
KLLA0F00660g1374178741.1
YER111C (SWI4)109342741.1
YDL056W (MBP1)833156731.1
AGL297C97053731.2
YPL239W (YAR1)20077711.2
Scas_717.6237451711.7
KLLA0E20867g93340721.7
Scas_458.3198147701.7
Sklu_2439.8481163711.8
Scas_510.2104351721.9
YAR042W (SWH1)1188288721.9
CAGL0C03003g20667692.0
CAGL0J09306g40241712.0
AFR690C70034703.1
Kwal_14.982416131693.6
CAGL0A04565g104140693.8
Kwal_56.23638492261693.9
KLLA0D08910g20658674.1
AER188C217463669.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR264C
         (750 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR264C (AKR1) [1097] chr4 complement(996021..998315) Protein wi...  1525   0.0  
CAGL0M08712g 866454..868745 similar to sp|P39010 Saccharomyces c...   814   0.0  
Scas_538.8                                                            665   0.0  
KLLA0E16764g 1484752..1487010 gi|28565052|gb|AAO32609.1 Kluyvero...   639   0.0  
AER388C [2888] [Homologous to ScYDR264C (AKR1) - SH; ScYOR034C (...   634   0.0  
YOR034C (AKR2) [4846] chr15 complement(394836..397085) Protein i...   519   e-174
Kwal_55.19987                                                         336   e-109
Scas_699.36                                                           160   5e-42
Scas_595.8                                                             67   3e-12
KLLA0F03619g 342770..345652 weakly similar to sp|P40480 Saccharo...    69   7e-12
CAGL0C01309g 136270..139602 similar to sp|P40480 Saccharomyces c...    69   7e-12
YIL112W (HOS4) [2564] chr9 (151592..154843) Component of Set3p c...    67   3e-11
Scas_671.30                                                            64   3e-10
Kwal_23.4914                                                           63   6e-10
KLLA0E15796g complement(1406502..1407194) similar to sp|P50086 S...    54   8e-08
Scas_595.9                                                             55   2e-07
ADL142C [1599] [Homologous to ScYGR232W (NAS6) - SH] (443625..44...    53   2e-07
CAGL0L06622g complement(743602..747015) similar to sp|P17442 Sac...    55   2e-07
Kwal_27.12750                                                          52   6e-07
ADL244W [1497] [Homologous to ScYIL112W - SH] complement(273379....    53   7e-07
YGR232W (NAS6) [2180] chr7 (953961..954647) Protein interacting ...    51   8e-07
CAGL0L06600g 742803..743498 similar to sp|P50086 Saccharomyces c...    50   2e-06
KLLA0E18029g complement(1600015..1603470) weakly similar to sp|P...    50   5e-06
CAGL0F06831g 668173..671451 similar to sp|P40578 Saccharomyces c...    49   1e-05
YLR246W (ERF2) [3642] chr12 (627120..628199) Protein that, in a ...    47   4e-05
YKL020C (SPT23) [3235] chr11 complement(398475..401723) Transcri...    47   6e-05
YDL019C (OSH2) [841] chr4 complement(417660..421511) Member of t...    46   1e-04
Sklu_1541.2 YOL003C, Contig c1541 950-2089 reverse complement          45   1e-04
YIR033W (MGA2) [2697] chr9 (416121..419462) Transcription factor...    46   1e-04
YOL003C (YOL003C) [4813] chr15 complement(321858..322994) Nuclea...    45   2e-04
Scas_679.7                                                             44   2e-04
Scas_628.4                                                             45   3e-04
AGL125C [4187] [Homologous to ScYLR246W (ERF2) - SH] (473496..47...    44   3e-04
Sklu_2319.5 YNL326C, Contig c2319 9193-10194                           44   4e-04
AFR600C [3792] [Homologous to ScYDL056W (MBP1) - SH] (1517341..1...    44   4e-04
YGR233C (PHO81) [2181] chr7 complement(954675..958211) Cyclin-de...    44   6e-04
CAGL0D02508g 256760..257758 similar to sp|P42836 Saccharomyces c...    43   7e-04
YNL326C (YNL326C) [4289] chr14 complement(27336..28346) Protein ...    43   7e-04
ADL143W [1598] [Homologous to ScYGR233C (PHO81) - SH] complement...    44   7e-04
Scas_392.2                                                             42   0.001
CAGL0H00935g 91979..92560 highly similar to sp|P46683 Saccharomy...    41   0.001
Sklu_2436.4 YDR459C, Contig c2436 10516-11610 reverse complement       42   0.001
KLLA0D18370g complement(1549382..1550449) similar to sgd|S000423...    42   0.001
ACR165W [1212] [Homologous to ScYKL020C (SPT23) - SH; ScYIR033W ...    43   0.001
CAGL0E02497g complement(241118..242248) similar to tr|Q12006 Sac...    42   0.002
Sklu_2202.8 YPL110C, Contig c2202 8829-12932                           42   0.002
Sklu_2237.5 YPL239W, Contig c2237 9761-10357                           40   0.002
Kwal_23.3302                                                           41   0.002
CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces c...    42   0.002
Kwal_55.22126                                                          41   0.003
KLLA0E02068g complement(195185..196162) weakly similar to sp|P42...    41   0.003
Scas_700.13                                                            42   0.003
KLLA0C06204g complement(548912..550045) similar to sgd|S0005363 ...    41   0.003
CAGL0F06655g 654908..656134 similar to sp|Q04749 Saccharomyces c...    41   0.003
YDR126W (SWF1) [973] chr4 (703228..704238) Protein involved in v...    40   0.004
CAGL0B01991g 182894..183886 similar to sp|Q04629 Saccharomyces c...    40   0.004
CAGL0K06347g complement(623217..624275) similar to tr|Q03289 Sac...    40   0.004
Kwal_14.889                                                            41   0.005
CAGL0G08217g complement(778823..779803) similar to tr|Q06551 Sac...    40   0.006
KLLA0E15774g 1402940..1406386 similar to sp|P17442 Saccharomyces...    40   0.006
ADL197C [1544] [Homologous to ScYNL326C - SH] (350993..352165) [...    40   0.007
ACL003C [1046] [Homologous to ScYOL003C - SH] (352024..353151) [...    40   0.007
Scas_415.1                                                             39   0.010
Kwal_47.18366                                                          39   0.010
Scas_683.37                                                            40   0.011
ADR151W [1892] [Homologous to ScYMR068W - SH] complement(971060....    39   0.011
YDR459C (YDR459C) [1277] chr4 complement(1382307..1383431) Prote...    39   0.016
Kwal_56.22459                                                          38   0.020
CAGL0D01012g 118878..121286 similar to sp|P39678 Saccharomyces c...    38   0.027
Scas_716.48                                                            37   0.038
AGR223W [4534] [Homologous to ScYPL110C - SH] complement(1167870...    38   0.039
KLLA0F26004g complement(2411261..2412271) some similarities with...    37   0.059
AAR063C [249] [Homologous to ScYCR051W - SH] (453099..453761) [6...    36   0.070
YPL110C (YPL110C) [5334] chr16 complement(341067..344738) Member...    37   0.079
ABR203W [797] [Homologous to ScYDR459C - SH] complement(782702.....    36   0.082
Kwal_27.12751                                                          37   0.095
YMR068W (AVO2) [4027] chr13 (406303..407583) Component of the TO...    36   0.11 
KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA Kluyv...    36   0.12 
Scas_649.8                                                             36   0.12 
CAGL0B01166g 103561..105987 similar to sp|P09959 Saccharomyces c...    36   0.15 
KLLA0C01826g 144307..146532 gi|730856|sp|P40418|SWI6_KLULA Kluyv...    36   0.16 
Scas_693.32                                                            35   0.19 
Scas_587.4                                                             35   0.19 
KLLA0C09108g complement(795433..796059) similar to sp|P25631 Sac...    34   0.22 
AGR065W [4375] [Homologous to ScYDR126W (PSL10) - SH] complement...    35   0.23 
Scas_713.9                                                             35   0.28 
Scas_685.12                                                            35   0.34 
KLLA0D06149g 527705..528754 similar to sgd|S0002867 Saccharomyce...    34   0.48 
YLR182W (SWI6) [3586] chr12 (517942..520353) Transcription facto...    34   0.51 
KLLA0F19690g 1820355..1821329 weakly similar to sp|Q04629 Saccha...    33   0.56 
Kwal_33.13259                                                          33   0.66 
Sklu_2055.3 YDL056W, Contig c2055 5141-7372                            33   0.76 
KLLA0F00660g 54232..58356 similar to sgd|S0006031 Saccharomyces ...    33   1.1  
YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcript...    33   1.1  
YDL056W (MBP1) [809] chr4 (352877..355378) Transcription factor ...    33   1.1  
AGL297C [4015] [Homologous to ScYER111C (SWI4) - SH] (147990..15...    33   1.2  
YPL239W (YAR1) [5211] chr16 (99484..100086) Protein with 2 ankyr...    32   1.2  
Scas_717.62                                                            32   1.7  
KLLA0E20867g complement(1852522..1855323) weakly similar to sp|P...    32   1.7  
Scas_458.3                                                             32   1.7  
Sklu_2439.8 YMR068W, Contig c2439 8208-9653 reverse complement         32   1.8  
Scas_510.2                                                             32   1.9  
YAR042W (SWH1) [83] chr1 (192615..196181) Protein implicated in ...    32   1.9  
CAGL0C03003g 297244..297864 similar to sp|P25631 Saccharomyces c...    31   2.0  
CAGL0J09306g 915641..916849 highly similar to tr|Q99385 Saccharo...    32   2.0  
AFR690C [3883] [Homologous to ScYLR182W (SWI6) - SH] (1712445..1...    32   3.1  
Kwal_14.982                                                            31   3.6  
CAGL0A04565g 445883..449008 similar to sp|P25302 Saccharomyces c...    31   3.8  
Kwal_56.23638                                                          31   3.9  
KLLA0D08910g 750828..751448 similar to sp|P46683 Saccharomyces c...    30   4.1  
AER188C [2690] [Homologous to ScYFR019W (FAB1) - SH] (986526..99...    30   9.3  

>YDR264C (AKR1) [1097] chr4 complement(996021..998315) Protein with
           palmitoyl transferase activity, has an inhibitory effect
           on signaling in the pheromone pathway, contains ankyrin
           repeats [2295 bp, 764 aa]
          Length = 764

 Score = 1525 bits (3948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 737/750 (98%), Positives = 737/750 (98%)

Query: 1   MVNELENVPRASTLTNEEQTVDPSNNDSQEDISLGDSNEITSLASLKAIRSGNEEESGNE 60
           MVNELENVPRASTLTNEEQTVDPSNNDSQEDISLGDSNEITSLASLKAIRSGNEEESGNE
Sbjct: 1   MVNELENVPRASTLTNEEQTVDPSNNDSQEDISLGDSNEITSLASLKAIRSGNEEESGNE 60

Query: 61  QVNHNDEAEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINN 120
           QVNHNDEAEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINN
Sbjct: 61  QVNHNDEAEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINN 120

Query: 121 RLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLL 180
           RLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLL
Sbjct: 121 RLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLL 180

Query: 181 HLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASI 240
           HLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASI
Sbjct: 181 HLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASI 240

Query: 241 KIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLREAL 300
           KIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLREAL
Sbjct: 241 KIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLREAL 300

Query: 301 THSGFDYHGYPIKKWFKKSQHAKLVTFITPFLFLGIAFALFSHINPXXXXXXXXXXXXXT 360
           THSGFDYHGYPIKKWFKKSQHAKLVTFITPFLFLGIAFALFSHINP             T
Sbjct: 301 THSGFDYHGYPIKKWFKKSQHAKLVTFITPFLFLGIAFALFSHINPLFVIIVLFLLAIAT 360

Query: 361 NKGLNKFVLPSYGRMGVHNVTLLRSPLLSGVFFGTLLWVTIVWFFKVMPRTFSDEQYTNI 420
           NKGLNKFVLPSYGRMGVHNVTLLRSPLLSGVFFGTLLWVTIVWFFKVMPRTFSDEQYTNI
Sbjct: 361 NKGLNKFVLPSYGRMGVHNVTLLRSPLLSGVFFGTLLWVTIVWFFKVMPRTFSDEQYTNI 420

Query: 421 LMLVILVSVFYLFGQLVIMDPGCLPEETDHENVRQTISNLLEIGKFDTKNFCIETWIRKP 480
           LMLVILVSVFYLFGQLVIMDPGCLPEETDHENVRQTISNLLEIGKFDTKNFCIETWIRKP
Sbjct: 421 LMLVILVSVFYLFGQLVIMDPGCLPEETDHENVRQTISNLLEIGKFDTKNFCIETWIRKP 480

Query: 481 LRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITLMESGIFTFLALCLEYFDEL 540
           LRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITLMESGIFTFLALCLEYFDEL
Sbjct: 481 LRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITLMESGIFTFLALCLEYFDEL 540

Query: 541 EDAHEDTSQKNGKCFILGASDLCSGLIYDRFVFLILLWALLQSIWVASLIFVQAFQICKG 600
           EDAHEDTSQKNGKCFILGASDLCSGLIYDRFVFLILLWALLQSIWVASLIFVQAFQICKG
Sbjct: 541 EDAHEDTSQKNGKCFILGASDLCSGLIYDRFVFLILLWALLQSIWVASLIFVQAFQICKG 600

Query: 601 MTNTEFNVLMKESKSIGPDGLSFNENFNTTPEGFAPSIDPGEESNDTVLAPVPGSTIRKP 660
           MTNTEFNVLMKESKSIGPDGLSFNENFNTTPEGFAPSIDPGEESNDTVLAPVPGSTIRKP
Sbjct: 601 MTNTEFNVLMKESKSIGPDGLSFNENFNTTPEGFAPSIDPGEESNDTVLAPVPGSTIRKP 660

Query: 661 RTCFGVCYAVTGMDQWLAVIKETIGIKDSTGHNVYSITSRIPTNYGWKRNVKDFWLTSDI 720
           RTCFGVCYAVTGMDQWLAVIKETIGIKDSTGHNVYSITSRIPTNYGWKRNVKDFWLTSDI
Sbjct: 661 RTCFGVCYAVTGMDQWLAVIKETIGIKDSTGHNVYSITSRIPTNYGWKRNVKDFWLTSDI 720

Query: 721 NAPLWRRILYPPSGSKALLNGIEVDYFKLY 750
           NAPLWRRILYPPSGSKALLNGIEVDYFKLY
Sbjct: 721 NAPLWRRILYPPSGSKALLNGIEVDYFKLY 750

>CAGL0M08712g 866454..868745 similar to sp|P39010 Saccharomyces
           cerevisiae YDR264c ankyrin repeat-containing protein,
           hypothetical start
          Length = 763

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/746 (54%), Positives = 524/746 (70%), Gaps = 39/746 (5%)

Query: 34  LGDSNEITSLASLKAIR-----SGNEEESGNEQVN-------------HNDEAEEDPLLT 75
           + D++E  S++S  ++R     +G+ E     +VN              N   ++DP+L+
Sbjct: 1   MEDNSEQASVSSQASMRPLVSDNGDREAGAGVEVNIANDNDTSVGVDGENGNEDDDPILS 60

Query: 76  RYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADV 135
           +YH ACQRGDL  V+EMIHG  + V++D D  E +TGLHWA+INNRL+VVDFLV +GA+V
Sbjct: 61  KYHNACQRGDLEVVREMIHGGQVNVSSDADR-EGVTGLHWAAINNRLNVVDFLVREGANV 119

Query: 136 NARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYV 195
            ++AGAL ATPLHWAARYG+VY+VD+LL+HGA  T TD QGFNLLHLSVNSSNIMLV+YV
Sbjct: 120 ESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVNSSNIMLVVYV 179

Query: 196 LFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGT 255
           LF VVSKG++DID  DPKGRT+LLWAAYQGDSLTVA L+KF AS+KIAD  GFTPLHWGT
Sbjct: 180 LFFVVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGT 239

Query: 256 VKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLREALTHSGFDYHGYPIKKW 315
           VKGQPHVLKYLIQDGADFFQKT+  KDCF IA+EM+  +S +EAL H+ FD +GYPI K 
Sbjct: 240 VKGQPHVLKYLIQDGADFFQKTNDNKDCFVIAEEMSNTHSFQEALRHNNFDKNGYPINKL 299

Query: 316 FKKSQHAKLVTFITPFLFLGIAFALFSHINPXXXXXXXXXXXXXTNKGLNKFVLPSYGRM 375
            K+  HAK++TF+ P L LG AF  FSH++              +NK +  F+LPSY   
Sbjct: 300 VKRDDHAKIITFLIPLLVLGFAFFGFSHLHILFALPVIILLLLASNKFIKSFLLPSYETK 359

Query: 376 GVHNVTLLRSPLLSGVFFGTLLWVTIVWFFKVMPRTFSDEQYTNILMLVILVSVFYLFGQ 435
           G ++ +LL+SPL++G+ FG++ W+  VW  +++P TF+     N+    IL  V Y    
Sbjct: 360 GTNSASLLKSPLIAGILFGSIFWLAFVWILRILPYTFTKRPLGNLTFCAILCFVCYSLFL 419

Query: 436 LVIMDPGCLPEETDHENVRQTISNLLEIGKFDTKNFCIETWIRKPLRSKFSPLNNAVVAR 495
           L   DPG +  E DHE +R+TISNLL+ GKFDT++FC+ETW+RKPLRSK+S LN+A++ R
Sbjct: 420 LAFSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLRSKYSYLNDALILR 479

Query: 496 FDHYCPWIFNDVGLKNHKAFIFFITLMESGIFTFLALCLEYFDELEDAHEDTSQKNGKCF 555
           FDHYCPWI+NDVGLKNHK FIFFI  +E GIF+F+ +CL+YFDEL+         +G CF
Sbjct: 480 FDHYCPWIYNDVGLKNHKLFIFFILALELGIFSFVKVCLKYFDELD--------MDGDCF 531

Query: 556 ILGASDLCSGLIYDRFVFLILLWALLQSIWVASLIFVQAFQICKGMTNTEFNVLMKESKS 615
           ILG  DLCSGLI DRF FLI+ WA +Q++W+ SL+ VQ FQI KG+TN+E N L++E + 
Sbjct: 532 ILGDDDLCSGLIGDRFTFLIMTWACIQAVWIFSLVIVQLFQITKGLTNSELNALIREGRR 591

Query: 616 IGPDGLSFNENFNTTPEGFAPSIDPGEES--------NDTVLAPVPGSTIRKPRTCFGVC 667
           +  D  + NE FNT PEGF  + D  EE+        N+ +     G+ + KPRTC G+ 
Sbjct: 592 VDIDSQTHNEFFNTVPEGFINNKDTEEEAAPPVRNNTNERISTTFSGN-LPKPRTCMGMI 650

Query: 668 YAVTGMDQWLAVIKETIGIK---DSTGHNVYSITSRIPTNYGWKRNVKDFWLTSDINAPL 724
            AVTG+ Q +A+IK+T GI     S   N  S+ S I T+YGW+RN  DFWL SD N PL
Sbjct: 651 CAVTGLHQCVAIIKDTFGIARHGSSRSTNTRSLLSSISTDYGWRRNWCDFWLLSDTNTPL 710

Query: 725 WRRILYPPSGSKALLNGIEVDYFKLY 750
           W+RI + P  +KALLNG E DY  LY
Sbjct: 711 WKRIFFSPPSTKALLNGKEADYATLY 736

>Scas_538.8
          Length = 752

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/573 (56%), Positives = 407/573 (71%), Gaps = 21/573 (3%)

Query: 192 VLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPL 251
           +L VLF VV+KG++DIDC+DPKGRT LLWAAYQGDSL+V  LLKFGAS KI D  GFTPL
Sbjct: 1   LLPVLFFVVAKGIIDIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPL 60

Query: 252 HWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLREALTHSGFDYHGYP 311
           HW TVKGQP+VL +LI+DGADFF KT+ GKDCF IAQEMNT +S ++AL+  GF+  GYP
Sbjct: 61  HWATVKGQPYVLTHLIRDGADFFLKTNDGKDCFTIAQEMNTSHSFKDALSICGFNQDGYP 120

Query: 312 IKKWFKKSQHAKLVTFITPFLFLGIAFALFSHINPXXXXXXXXXXXXXTNKGLNKFVLPS 371
            +K FKKS HAK++TF  P + L I F LF+H++P              NK L + +LPS
Sbjct: 121 KRKLFKKSDHAKVITFFVPLVALSIIFILFTHLHPLFALLISLIFGLAVNKALKELILPS 180

Query: 372 YGRMGVHNVTLLRSPLLSGVFFGTLLWVTIVWFFKVMPRT-FSDEQYTNILMLVILVSVF 430
           Y   G+H+ +LL+SP LSG FFG+LL +TIVW FK+ P T F     TN  M +IL+ ++
Sbjct: 181 YSNYGLHSTSLLKSPFLSGTFFGSLLLLTIVWIFKIAPFTIFKSRLLTNFFMFLILMQIY 240

Query: 431 YLFGQLVIMDPGCLPEETDHENVRQTISNLLEIGKFDTKNFCIETWIRKPLRSKFSPLNN 490
           YLF +L+  DPGC+P ETDHENVR TI  LL+ GKFD KNFC+ETWIRKPLRS FS LN 
Sbjct: 241 YLFIKLIFSDPGCVPIETDHENVRGTIKELLDTGKFDIKNFCLETWIRKPLRSHFSTLNT 300

Query: 491 AVVARFDHYCPWIFNDVGLKNHKAFIFFITLMESGIFTFLALCLEYFDELEDAHEDTSQK 550
             VARFDH+CPWI+ND+GLKNHK F++FI L E GI+ F++L ++YFD LED +ED +  
Sbjct: 301 HNVARFDHFCPWIYNDIGLKNHKNFMWFILLTEVGIWFFISLTMKYFDILEDTNEDVA-- 358

Query: 551 NGKCFILGASDLCSGLIYDRFVFLILLWALLQSIWVASLIFVQAFQICKGMTNTEFNVLM 610
              CF+LG  +LC+G +YDRF FLI LWAL+QS+WV  LI VQ FQ   G+TN EFN  +
Sbjct: 359 ---CFLLGDDELCAGFVYDRFTFLIALWALIQSVWVGFLIVVQVFQTFTGVTNKEFNKYV 415

Query: 611 KESKSIGP-DGLSFNENFNTTPEGFAPSID----------PGEESNDTVLAPVPGSTI-- 657
           KE K+    D + FN+ FNTTPE      D          P   +  T+  P  GS I  
Sbjct: 416 KEKKNQHAFDPIFFNDTFNTTPEELRNDDDDTAASRTGNNPNHSNGTTI--PSEGSRINT 473

Query: 658 RKPRTCFGVCYAVTGMDQWLAVIKETIGIKDSTGHNVYSITSRIPTNYGWKRNVKDFWLT 717
           RKPRTCF +C+A+TG+DQ   +++ET+GI  +   +   + S IPTNYGWKRN+ DFWLT
Sbjct: 474 RKPRTCFNLCFAITGLDQVRTIVRETLGIGGANEMSRMQLLSSIPTNYGWKRNLADFWLT 533

Query: 718 SDINAPLWRRILYPPSGSKALLNGIEVDYFKLY 750
           SD+ AP+WRR+ Y P  S+ALLNG+EVDYFKLY
Sbjct: 534 SDVMAPIWRRLFYSPVESRALLNGVEVDYFKLY 566

 Score =  152 bits (385), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 84/157 (53%), Positives = 106/157 (67%), Gaps = 13/157 (8%)

Query: 15  TNEEQTVDPSNNDSQEDISLGDSNEITSLASLKAIRSGNEEESGNEQVNHNDEAEEDPLL 74
           T+   + DP  +D   D+   D+ E  S++SL+ I S N      E +N        P+L
Sbjct: 608 TSLPNSTDPPLSDVNIDVEDDDTAE--SISSLQPIVS-NTTNPPEEPIN--------PVL 656

Query: 75  TRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGAD 134
            +YH ACQ+GDLATVK+++   +L++N D   T  ITGLHWASINNRLSVV +L+SQG D
Sbjct: 657 GQYHQACQKGDLATVKQLLDSGVLDLNTD--LTGDITGLHWASINNRLSVVKYLISQGID 714

Query: 135 VNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTM 171
           VNA+AG L ATPLHWAARYGYV+IVD LL  GADPTM
Sbjct: 715 VNAKAGDLEATPLHWAARYGYVHIVDCLLNKGADPTM 751

 Score = 37.4 bits (85), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 3/77 (3%)

Query: 198 NVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASI--KIADTEGFTPLHWGT 255
            ++  G+LD++       T L WA+       V  L+  G  +  K  D E  TPLHW  
Sbjct: 673 QLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKAGDLEA-TPLHWAA 731

Query: 256 VKGQPHVLKYLIQDGAD 272
             G  H++  L+  GAD
Sbjct: 732 RYGYVHIVDCLLNKGAD 748

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 221 AAYQGDSLTVAELLKFGASIKIADTEG-FTPLHWGTVKGQPHVLKYLIQDGAD 272
           A  +GD  TV +LL  G      D  G  T LHW ++  +  V+KYLI  G D
Sbjct: 662 ACQKGDLATVKQLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGID 714

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 3/67 (4%)

Query: 111 TGLHWASINNRLSVVDFLVSQGADVN-ARAGALHATPLHWAARYGYVYIVDFLLKHGADP 169
           T L WA+       V  L+  GA       G    TPLHWA   G  Y++  L++ GAD 
Sbjct: 25  TPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGF--TPLHWATVKGQPYVLTHLIRDGADF 82

Query: 170 TMTDDQG 176
            +  + G
Sbjct: 83  FLKTNDG 89

>KLLA0E16764g 1484752..1487010 gi|28565052|gb|AAO32609.1
           Kluyveromyces lactis AKR1, hypothetical start
          Length = 752

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/754 (45%), Positives = 475/754 (62%), Gaps = 29/754 (3%)

Query: 14  LTNEE--QTVDPSNNDSQED---ISLGDSNE----ITSLASLKAI--RSGNEEESGNEQV 62
           +T EE  +  DP+  D + D   I LG+ NE    + SL S+KA+  R+ +E +  N+Q 
Sbjct: 1   MTAEEVDKESDPAIEDVKSDYDAIELGNENENENEVVSLDSMKAVISRASSELKHENDQG 60

Query: 63  NHND--EAEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINN 120
              D    E+DP+L RYH AC++GD+ T++EM+  K+++++ND D  E ++GLHWA INN
Sbjct: 61  EERDLGSVEKDPILERYHAACKQGDMKTLREMVESKVIDLSNDYDPKERVSGLHWACINN 120

Query: 121 RLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLL 180
           RLS V +L   GA+VN + G L ATPLHWA++ G VYIVD LLK GADP +TD QG+NLL
Sbjct: 121 RLSAVKYLAGAGAEVNFKGGELDATPLHWASKSGLVYIVDELLKAGADPNITDSQGYNLL 180

Query: 181 HLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASI 240
           H SV SSNIMLV+YVLF VV  G  D+D  DP  RT+L WA YQ D+LTV  LLKF A +
Sbjct: 181 HTSVFSSNIMLVIYVLFFVVD-GKEDVDQPDPHQRTALQWATYQADALTVENLLKFNADV 239

Query: 241 KIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLREAL 300
           K AD  GFT LHWGTVKG   V+  LI+ G+DFFQ T+ GK+CF I +E+ ++ SL  +L
Sbjct: 240 KNADDAGFTALHWGTVKGSIPVMDLLIKHGSDFFQTTNDGKNCFTIGKELYSIGSLEASL 299

Query: 301 THSGFDYHGYPIKKWFKKSQHAKLVTFITPFLFLGIAFALFSHINPXXXXXXXXXXXXXT 360
             +GFD +G+P+ ++F  S   K++TF  P++ + + F +FS I               +
Sbjct: 300 YKNGFDKNGFPLPQYFSAST-GKMLTFFLPWVLIPLVFYIFSKITFFIALLINTIVLVIS 358

Query: 361 NKGLNKFVLPSYGRMGVHNVTLLRSPLLSGVFFGTLLWVTIVWFFKVMPRTFSDEQYTNI 420
              L++ V+PSY     H +  L SPLL+G+  GT+     +WF K+   TF+++   NI
Sbjct: 359 GLVLSRLVVPSYLLSKRHPI--LNSPLLAGILSGTIAIAFFIWFTKISILTFTEKPVGNI 416

Query: 421 LMLVILVSVFYLFGQLVIMDPGCLPEETDHENVRQTISNLLEIGKFDTKNFCIETWIRKP 480
           +ML   + +  LF  L+  DPG +P   DH+ VR+TI  LL +GKFD K+FC+ TWIR P
Sbjct: 417 IMLGFFIGLITLFIGLMKSDPGYIPGTVDHDKVRETIKELLSLGKFDAKHFCVHTWIRIP 476

Query: 481 LRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITLMESGIFTFLALCLEYFDEL 540
           LRSK+   +  +++ FDH+CPW++N +GL NHK F  F+ L+E  ++ FL L +EYFDEL
Sbjct: 477 LRSKYDRDSACLISAFDHFCPWVYNQIGLLNHKLFYMFVVLLEISVWWFLPLMMEYFDEL 536

Query: 541 EDAHEDTSQKN-GKCFILGASDLCSGLIYDRFVFLILLWALLQSIWVASLIFVQAFQICK 599
           ED  E+   K+ G C  LG  DLC GL +D F FL+L W + Q+ WV  LI VQ  Q+ K
Sbjct: 537 EDYLENRKGKHFGDCHFLGDEDLCFGLHHDTFNFLLLCWVIFQAFWVLCLIAVQTVQMLK 596

Query: 600 GMTNTEFNVLMKESKSIGPDGLSFNENFNTTPEGFAPSIDPGEESNDTVLAPVPGSTIRK 659
           G+T+ EF  + K+ KS   +G +  + F++TP          EE    + AP        
Sbjct: 597 GVTDYEFVQINKKLKS---NGTTTEDIFSSTPPELM-----SEELIAELDAPALDPRQVP 648

Query: 660 PRTCFGVCYAVTGMDQWLAVIKETIGIKD---STGHNVYSITSRIPTNYGWKRNVKDFWL 716
            RTCF VC  + G+D+ + +IK  + +K    S+  +  S  +RIPT+YGWK+N+KDFWL
Sbjct: 649 QRTCFTVCCTLLGLDKLVTMIKSVLRLKSDEPSSRSSHLSALARIPTDYGWKQNLKDFWL 708

Query: 717 TSDINAPLWRRILYPPSGSKALLNGIEVDYFKLY 750
             D ++PLWRRIL PP  S ALLNG+EVDY+ LY
Sbjct: 709 LPDTSSPLWRRILLPPKDSHALLNGMEVDYYTLY 742

>AER388C [2888] [Homologous to ScYDR264C (AKR1) - SH; ScYOR034C
           (AKR2) - SH] (1365604..1367778) [2175 bp, 724 aa]
          Length = 724

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/724 (45%), Positives = 448/724 (61%), Gaps = 24/724 (3%)

Query: 30  EDISLGDSNEITSLASLKAIRSGNEEESGNEQVNHNDEAE---EDPLLTRYHTACQRGDL 86
           ED  L D   I+S+  + +     E+    + ++    AE   +DP L +YH ACQRGDL
Sbjct: 9   EDSVLLDDISISSIQPIVSDVPAAEDVGDEDHISGASIAENRPKDPTLVKYHAACQRGDL 68

Query: 87  ATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATP 146
            TVK+MI   +++V  D D  E ++GLHWAS NNRL++V +L++QGADVN + G L ATP
Sbjct: 69  KTVKDMIEAGVIDVKADWDEEEQVSGLHWASANNRLNLVRYLIAQGADVNIKGGDLEATP 128

Query: 147 LHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLD 206
           LHWA++ GYVYIV  LL+HGADP +TD QG+NLLH S  SS +ML+ YVLF     G + 
Sbjct: 129 LHWASKSGYVYIVHCLLEHGADPLITDRQGYNLLHTSTFSSEVMLITYVLFT----GQIP 184

Query: 207 IDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYL 266
           +D  DP G+T+L WAAYQGD  TV  LLKF A +++ DT GFTPLHW TVKG PHVLK L
Sbjct: 185 VDSPDPTGKTALHWAAYQGDPNTVEALLKFDADVRVVDTGGFTPLHWATVKGHPHVLKAL 244

Query: 267 IQDGADFFQKTDTGKDCFAIAQEMNTVYSLREALTHSGFDYHGYPIKKWFKKSQHAKLVT 326
           I+ G+D F K + GK+   IAQEMNT  +L+ AL   GF+  G+ I+K+FK   HAK+VT
Sbjct: 245 IEHGSDVFLKNNDGKNALMIAQEMNTQKALQNALYECGFNKDGFAIRKYFKNPMHAKMVT 304

Query: 327 FITPFLFLGIAFALFSHINPXXXXXXXXXXXXXTNKGLNKFVLPSYGRMGVHNVTLLRSP 386
           F TP+L LG+  + F++ +                 GL  FV PS+  M    + + ++P
Sbjct: 305 FFTPWLILGLILSFFAYFSILLAILGCLLTVLAAGYGLYNFVFPSFILM--KRIVIFKTP 362

Query: 387 LLSGVFFGTLLWVTIVWFFKVMPRTFSDEQYTNILMLVILVSVFYLFGQLVIMDPGCLPE 446
           LL+G+  GT+ W+  VW FK++P TF DE   N+ +  +   V +L  +L+  DPG +  
Sbjct: 363 LLAGILSGTIFWLLYVWLFKMLPATFDDEPILNLTVFALFAGVVFLLTKLLQSDPGYIVP 422

Query: 447 ETDHENVRQTISNLLEIGKFDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFND 506
            TDH  +R TI  LL +GK+D+K+FCI +WIR PLR+K+    ++V+ R+DHYCPWI+N 
Sbjct: 423 ATDHNQIRATIIELLRVGKYDSKHFCIHSWIRLPLRAKYKRFVHSVILRYDHYCPWIYNY 482

Query: 507 VGLKNHKAFIFFITLMESGIFTFLALCLEYFDELEDAHEDTSQKNGKCFILGASDLCSGL 566
           +G +NHK FI+FI L++ GI     LCLEYFDEL+D  ++      KC IL + DLC+G 
Sbjct: 483 IGFRNHKIFIYFILLLDLGILALAKLCLEYFDELKDHAKNKDAL--KCSIL-SKDLCAGF 539

Query: 567 IYDRFVFLILLWALLQSIWVASLIFVQAFQICKGMTNTEFNVLMKESKSIGPDGLSFNEN 626
            YD F   +L W  +Q +W+ +L FVQ F+  KG+T  EF    + ++ +    +     
Sbjct: 540 TYDPFTLFLLEWVCVQGMWILALSFVQFFECLKGVTEHEFAHWQRRNRGV----VGREHV 595

Query: 627 FNTTPEGFAPSIDPGEESNDTVLAPVPGSTIRKPRTCFGVCYAVTGMDQWLAVIKETIGI 686
           FNT PE         E +    L           R C       TG D++L+VI  ++G 
Sbjct: 596 FNTAPEELMEEDPEEERNKLRSLGAA------GQRHCCSTLTTATGFDRFLSVIGSSLGR 649

Query: 687 KDSTGHNVYSITSRIPTNYGWKRNVKDFWLTSDINAPLWRRILYPPSGSKALLNGIEVDY 746
           +  T HN   I   I T+YGWK+N+KDFWLTSDI+AP+WRRIL PP G++ LLNG EVDY
Sbjct: 650 QPRTTHN--PINYPIETDYGWKQNLKDFWLTSDISAPMWRRILLPPVGTRGLLNGQEVDY 707

Query: 747 FKLY 750
            KLY
Sbjct: 708 QKLY 711

>YOR034C (AKR2) [4846] chr15 complement(394836..397085) Protein
           involved in constitutive endocytosis of Ste3p [2250 bp,
           749 aa]
          Length = 749

 Score =  519 bits (1336), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 285/690 (41%), Positives = 399/690 (57%), Gaps = 29/690 (4%)

Query: 80  ACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARA 139
           A + GDL  VK+++    +++NND    + ++GLHWA INNR SV  FL+ +GA+ N  A
Sbjct: 57  AAKDGDLKVVKDVVESGAVDINND--RIDELSGLHWACINNRFSVAKFLLLRGANPNQAA 114

Query: 140 GALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNV 199
           G   AT LHWAARYG +YIVD LLKHGADPT+ D+QG N++H SV SSNI+LV+YVL+ V
Sbjct: 115 GPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFV 174

Query: 200 VSKG-LLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKG 258
           V+    +DID +D   RT LLWAAYQGD LTV  LLKFG+++   D  GF  LH   V G
Sbjct: 175 VNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGG 234

Query: 259 QPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLREALTHSGFDYHGYPIKKWFKK 318
              V+  LI  GA+F+++ +  +DCF +A+ M T     +AL H G+D  G    K FKK
Sbjct: 235 DQRVICDLILSGANFYERNNQKQDCFDLAEGMGTKSLFEQALQHHGYDRLGNQKDKLFKK 294

Query: 319 SQHAKLVTFITPFLFLGIAFALFSHINPXXXXXXXXXXXXXTNKGLNKFVLPSYGRMGVH 378
           S HA+   F++PFL +   + +   ++P                 L KFVLP   R   +
Sbjct: 295 SSHAQFTIFLSPFLLMVYIYLISLVLSPVLAIMLSLLVTVVMVNTLKKFVLPCLPRKNTY 354

Query: 379 NVTLLRSPLLSGVFFGTLLWVTIVWFFKVMPRTFSDEQYTNILMLVILVSVFYLFGQLVI 438
            V+L R+P  SG+F  T  ++  +W  K+ P + SD    N+  LV       LF +LV 
Sbjct: 355 KVSLTRTPFFSGLFLSTFCFLIYIWTKKLYPYSVSDYTMKNVQFLVTSFLTVVLFLRLVR 414

Query: 439 MDPGCLPEETDHENVRQTISNLLEIGKFDTKNFCIETWIRKPLRSKFSPLNNAVVARFDH 498
            DPGCL  +    ++++TI  L+++GKFD +NFC+ET  RKPLRSK+S  + A+VAR+DH
Sbjct: 415 SDPGCLKTDDSLTSIQETIKQLIDLGKFDRENFCVETLERKPLRSKYSFFSGALVARYDH 474

Query: 499 YCPWIFNDVGLKNHKAFIFFITLMESGIFTFLALCLEYFDELEDAHEDTSQKNGKCFILG 558
           YCPWI+NDVGLKNHK F+FF   ++  +F F+ LCL YF +    +E   ++  +C +L 
Sbjct: 475 YCPWIYNDVGLKNHKLFVFFAVTVQYHMFLFMWLCLAYFKKTNYIYEQV-EEYARCALLK 533

Query: 559 ASDLCSGLIYDRFVFLILLWALLQSIWVASLIFVQAFQICKGMTNTEFNVLMKESKSIGP 618
              LC G  YD   F + +W  +  IW+ +++ VQ FQI KG+T  E  +L+KE      
Sbjct: 534 NETLCKGSNYDPSTFFLFIWISVNFIWLGAMLIVQFFQILKGITTPELFILIKEEHKAKF 593

Query: 619 DGLSFNENFNTTPEGFAPSIDPGEESNDTVLAPVPGSTI------------RKPRTCFGV 666
             L   EN   T E        G E +D +      +TI             + R     
Sbjct: 594 INLIPFENSIYTSES------KGVEDSDMIPEGPSATTITHTISIDGLEPRNRRRAILSA 647

Query: 667 CYAVTGMDQWLAVIKETIGI------KDSTGHNVYSITSRIPTNYGWKRNVKDFWLTSDI 720
           C+++ G++QWL  IKE +GI      +    H+   + S + TN+ WK N+ DFWL SD+
Sbjct: 648 CFSMMGINQWLVTIKEIVGITHILHGQVPQQHHSSLLRSFLVTNH-WKTNLTDFWLNSDV 706

Query: 721 NAPLWRRILYPPSGSKALLNGIEVDYFKLY 750
            APLW+R  Y    SKA+L G EVDY++LY
Sbjct: 707 TAPLWQRFFYSSDTSKAMLGGTEVDYYELY 736

>Kwal_55.19987
          Length = 343

 Score =  336 bits (861), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 168/291 (57%), Positives = 213/291 (73%), Gaps = 3/291 (1%)

Query: 42  SLASLKAIRSGNEEESGN-EQVNHNDEAEE-DPLLTRYHTACQRGDLATVKEMIHGKLLE 99
           S+AS++ I S  E  + + E ++  +E+   DP+L  Y  ACQ GDL  VKE+I    ++
Sbjct: 53  SIASIEPIASEIEASAPSAEDISLGNESYHIDPVLQEYREACQTGDLTKVKELIESGRID 112

Query: 100 VNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIV 159
           +++D D  E I+GLHWASINNRL +V +L+ +GA+V+ + G L+ATPLHWAARYGYVYIV
Sbjct: 113 ISHDYDEKERISGLHWASINNRLGIVRYLIGKGANVDFQGGDLNATPLHWAARYGYVYIV 172

Query: 160 DFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLL 219
           D LL+ GAD ++TD QGFNLLHLS+NSSNIMLVLYVL+ VV    L +DC DP  RT LL
Sbjct: 173 DSLLESGADASLTDHQGFNLLHLSINSSNIMLVLYVLYFVVGDK-LSVDCLDPNNRTPLL 231

Query: 220 WAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDT 279
           WAAYQGDSL+V  LL+F A++ IAD+ GF P HW TVKGQP VLKYL++ G+DFFQKT  
Sbjct: 232 WAAYQGDSLSVKALLEFNANLNIADSGGFLPPHWATVKGQPTVLKYLLEGGSDFFQKTAD 291

Query: 280 GKDCFAIAQEMNTVYSLREALTHSGFDYHGYPIKKWFKKSQHAKLVTFITP 330
            KDCF I+QEM+T  SL  +L  SGF   G PI K F+  +HAKL+TFI P
Sbjct: 292 NKDCFVISQEMHTQESLTNSLQESGFKKDGTPIMKLFRNPRHAKLITFIIP 342

>Scas_699.36
          Length = 511

 Score =  160 bits (406), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 96/273 (35%), Positives = 154/273 (56%), Gaps = 13/273 (4%)

Query: 70  EDPLLTRYHTACQRGDLATVKEMIHGKLLE---VNNDGDSTEHITGLHWASINNRLSVVD 126
           E  ++  +  +C+ G++ TVK+++   ++E   +N   D+ + +  L WA IN+R+ V++
Sbjct: 3   ERNVVDNFLLSCELGNIDTVKQLVSSNVIEGNYINEIRDNCQGLNALQWACINDRIEVIE 62

Query: 127 FLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNS 186
           +L+SQGAD N + G LH TPL  A ++G++Y +D LLK+ A     D +   LL  +V +
Sbjct: 63  YLISQGADTNIQCG-LH-TPLQLAVQFGHIYTIDLLLKNDAKWKHYDRES--LLIAAVKN 118

Query: 187 SNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTE 246
           S+ +LVLY+L  VVS  L DI+  D  GR+ L+ A+  GD L +  LLKFG+++ + D +
Sbjct: 119 SSPLLVLYILLFVVSLELEDINMCDENGRSPLMLASAHGDLLIIKLLLKFGSNVNLVDND 178

Query: 247 GFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLR-----EALT 301
           G+   H+  + G+  +   LI++G D   KT  GK C  +A EMNTV  L+       L 
Sbjct: 179 GYNAAHFAIIGGEFRIFDILIENGTDVLSKTKNGKSCLQLATEMNTVTRLQNIFRNHCLN 238

Query: 302 HSGF-DYHGYPIKKWFKKSQHAKLVTFITPFLF 333
             G  DY  Y I + F  S  + L+      +F
Sbjct: 239 DDGVKDYKIYLINRKFWVSLTSMLIPLCCVMIF 271

>Scas_595.8
          Length = 235

 Score = 67.4 bits (163), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 102/217 (47%), Gaps = 13/217 (5%)

Query: 78  HTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVS--QGADV 135
           H AC  G+LA V+E++       +     +++ T LHWA    R  +V +L+S  +  D+
Sbjct: 11  HQACMDGNLAKVQELVEELATPDDIVALDSDNRTPLHWAVSFQREEIVTYLLSFMKEIDL 70

Query: 136 NARAGALHATPLHWAARYGYVYIVDFLLKHGADP--TMTDDQGFNLLHLSVNSSNIMLVL 193
           +        TP+H AA  G ++I+  L      P   +   QG   LHLSV   ++ +  
Sbjct: 71  DKLKDDSEWTPVHIAASVGNLFILTQLYDREIKPDLNLQTKQGTTALHLSVAKKHLSVCK 130

Query: 194 YVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELL--KFGASIKIADTEGFTPL 251
           +++ N  S     +  +D KG+  L  AA  G S+T+ ELL  +  + + + D +G+TPL
Sbjct: 131 FLIDNGAS-----VRLKDQKGQLPLHRAASIG-SMTLVELLCTQGKSPVNVRDKQGWTPL 184

Query: 252 HWGTVKGQPHVLKYLIQD-GADFFQKTDTGKDCFAIA 287
                +G   +   L+    AD   + + GK    +A
Sbjct: 185 FHALAEGHGDIALLLVNKYDADVQLEDNAGKKPADVA 221

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 68/179 (37%), Gaps = 41/179 (22%)

Query: 108 EHITGLHWASINNRLSVVDFLVSQGA--DVNARAGALHATPLHWAARYGYVYIVDFLLKH 165
           E +  LH A ++  L+ V  LV + A  D      + + TPLHWA  +    IV +LL  
Sbjct: 5   EKLYPLHQACMDGNLAKVQELVEELATPDDIVALDSDNRTPLHWAVSFQREEIVTYLLSF 64

Query: 166 GAD---PTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAA 222
             +     + DD  +  +H++ +  N + +L  L++   K  L++  +            
Sbjct: 65  MKEIDLDKLKDDSEWTPVHIAASVGN-LFILTQLYDREIKPDLNLQTK------------ 111

Query: 223 YQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGK 281
                                  +G T LH    K    V K+LI +GA    K   G+
Sbjct: 112 -----------------------QGTTALHLSVAKKHLSVCKFLIDNGASVRLKDQKGQ 147

>KLLA0F03619g 342770..345652 weakly similar to sp|P40480
           Saccharomyces cerevisiae YIL112w singleton, start by
           similarity
          Length = 960

 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 116/272 (42%), Gaps = 68/272 (25%)

Query: 75  TRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGAD 134
           T+   AC +G     K++I     +VN+  ++    T LH A++N   ++V+ LV  GA+
Sbjct: 261 TKLQIACDKGKYDLAKKLIEEDGYDVNDQDNAGN--TPLHEAALNGHSAIVELLVRNGAN 318

Query: 135 VNARAGALH-ATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNI---- 189
           VN ++  +   TPL  A+  G++ +V +LL HGADPTM + +G + +      S++    
Sbjct: 319 VNIQSYDMFLDTPLIDASANGHINVVKYLLDHGADPTMVNAKGLSAIESIEEESDMDNDD 378

Query: 190 MLVLYVLFNVVSKGLL--------------------DIDCR-------------DPKGRT 216
             +++ + +++ +                       DID +                G+ 
Sbjct: 379 RRIVHDMKDMLKRATRKYIKHSHRTLQSSSMSRHSDDIDKQLNHDDDFYWTDISSKLGKN 438

Query: 217 SLLWAAYQGDSLTVAELLKFG---------------------------ASIKIADTEGFT 249
            LL A+ +G    V   L+ G                           A + +++ EG T
Sbjct: 439 KLLKASKEGKLAYVGSYLENGGRPDFRCFLESCIYGHDDVVSLFLAFGAQVNMSNKEGQT 498

Query: 250 PLHWGTVKGQPHVLKYLIQDGADFFQKTDTGK 281
           PL     +G  +V+K L++ GAD  QKTD  K
Sbjct: 499 PLMLSVGRGHVNVVKLLLEAGAD-PQKTDKRK 529

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 52/116 (44%), Gaps = 2/116 (1%)

Query: 206 DIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGF--TPLHWGTVKGQPHVL 263
           D++ +D  G T L  AA  G S  V  L++ GA++ I   + F  TPL   +  G  +V+
Sbjct: 285 DVNDQDNAGNTPLHEAALNGHSAIVELLVRNGANVNIQSYDMFLDTPLIDASANGHINVV 344

Query: 264 KYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLREALTHSGFDYHGYPIKKWFKKS 319
           KYL+  GAD       G       +E + + +    + H   D      +K+ K S
Sbjct: 345 KYLLDHGADPTMVNAKGLSAIESIEEESDMDNDDRRIVHDMKDMLKRATRKYIKHS 400

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 124 VVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLS 183
           VV   ++ GA VN  +     TPL  +   G+V +V  LL+ GADP  TD +    LH +
Sbjct: 478 VVSLFLAFGAQVNM-SNKEGQTPLMLSVGRGHVNVVKLLLEAGADPQKTDKRKKTALHYA 536

Query: 184 VNSS 187
            +SS
Sbjct: 537 NHSS 540

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 210 RDPKGRTSLLWAAYQGDSLTVAELLKF-GASIKIADTEGFTPLHWGTVKGQPHVLKYLIQ 268
           RD  GRT L  A  +G      +L++  G  +   D  G TPLH   + G   +++ L++
Sbjct: 255 RDAGGRTKLQIACDKGKYDLAKKLIEEDGYDVNDQDNAGNTPLHEAALNGHSAIVELLVR 314

Query: 269 DGAD 272
           +GA+
Sbjct: 315 NGAN 318

>CAGL0C01309g 136270..139602 similar to sp|P40480 Saccharomyces
           cerevisiae YIL112w, hypothetical start
          Length = 1110

 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 62/104 (59%), Gaps = 3/104 (2%)

Query: 75  TRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGAD 134
           TR   AC +G     K +I  +  +VN+  ++    + LH A++N  LS+V  L+S GA+
Sbjct: 363 TRLQIACDKGKYDVAKRLIEEEDYDVNDQDNAGN--SALHEAALNGHLSIVKLLISHGAN 420

Query: 135 VNARAGAL-HATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGF 177
           VN ++  +   TPL  A+  G++ IV +LL+HGADPT+ + +G 
Sbjct: 421 VNIQSYEMFKDTPLVDASANGHLDIVRYLLRHGADPTIPNAKGL 464

 Score = 36.6 bits (83), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 2/80 (2%)

Query: 195 VLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGF--TPLH 252
           V   ++ +   D++ +D  G ++L  AA  G    V  L+  GA++ I   E F  TPL 
Sbjct: 376 VAKRLIEEEDYDVNDQDNAGNSALHEAALNGHLSIVKLLISHGANVNIQSYEMFKDTPLV 435

Query: 253 WGTVKGQPHVLKYLIQDGAD 272
             +  G   +++YL++ GAD
Sbjct: 436 DASANGHLDIVRYLLRHGAD 455

>YIL112W (HOS4) [2564] chr9 (151592..154843) Component of Set3p
           complex that has histone deacetylase activity and a role
           in repression of meiotic-specific sporulation gene
           expression, contains ankyrin repeats [3252 bp, 1083 aa]
          Length = 1083

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 61/104 (58%), Gaps = 3/104 (2%)

Query: 75  TRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGAD 134
           TR   AC +G    VK+MI     ++N+  ++    T LH A++   + +V+ L+  GAD
Sbjct: 332 TRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGN--TALHEAALQGHIEIVELLIENGAD 389

Query: 135 VNARAGALHA-TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGF 177
           VN ++  +   TPL  A+  G++ +V +LLK+GADPT+ + +G 
Sbjct: 390 VNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGL 433

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 45/80 (56%), Gaps = 2/80 (2%)

Query: 195 VLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTE--GFTPLH 252
           V+  ++ +G  DI+ +D  G T+L  AA QG    V  L++ GA + I   E  G TPL 
Sbjct: 345 VVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLI 404

Query: 253 WGTVKGQPHVLKYLIQDGAD 272
             +  G   V+KYL+++GAD
Sbjct: 405 DASANGHLDVVKYLLKNGAD 424

 Score = 37.0 bits (84), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 56/111 (50%), Gaps = 11/111 (9%)

Query: 111 TGLHWASINNRLSVVDFLVSQGA-DVNARAGALHATPLHWAARYGYVYIVDFLLKHGADP 169
           T L  A    +  VV  ++ +G  D+N +  A + T LH AA  G++ IV+ L+++GAD 
Sbjct: 332 TRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGN-TALHEAALQGHIEIVELLIENGADV 390

Query: 170 TMTDDQGFN---LLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTS 217
            +   + F    L+  S N  ++ +V Y+L N       D   R+ KG T+
Sbjct: 391 NIKSIEMFGDTPLIDASAN-GHLDVVKYLLKNGA-----DPTIRNAKGLTA 435

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 34/78 (43%), Gaps = 7/78 (8%)

Query: 132 GADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLS-------V 184
           G  VN  +     + L  A   G++  V  LL+ GADPT  D +G   L+ +        
Sbjct: 583 GFPVNQTSRDNKTSALMVAVGRGHLGTVKLLLEAGADPTKRDKKGRTALYYAKNSIMGIT 642

Query: 185 NSSNIMLVLYVLFNVVSK 202
           NS  I L+   + N + K
Sbjct: 643 NSEEIQLIENAINNYLKK 660

>Scas_671.30
          Length = 1054

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 60/103 (58%), Gaps = 3/103 (2%)

Query: 76  RYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADV 135
           R   AC +G     K +I  +  +VN+  ++    + LH A++N  +S+V  L+  GA+V
Sbjct: 307 RLQIACDKGKYDVAKRLIEEEGYDVNDQDNAGN--SALHEAALNGHISIVKLLIDNGANV 364

Query: 136 NARAGAL-HATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGF 177
           N ++  +   TPL  A+  G++ +V  LL++GADPT+T+ +G 
Sbjct: 365 NIQSYEMFQDTPLVDASANGHLDVVQLLLENGADPTITNAKGI 407

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 2/69 (2%)

Query: 206 DIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGF--TPLHWGTVKGQPHVL 263
           D++ +D  G ++L  AA  G    V  L+  GA++ I   E F  TPL   +  G   V+
Sbjct: 330 DVNDQDNAGNSALHEAALNGHISIVKLLIDNGANVNIQSYEMFQDTPLVDASANGHLDVV 389

Query: 264 KYLIQDGAD 272
           + L+++GAD
Sbjct: 390 QLLLENGAD 398

>Kwal_23.4914
          Length = 1043

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 61/109 (55%), Gaps = 8/109 (7%)

Query: 75  TRYHTACQRGDLATVKEMIHG--KLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQG 132
           T+   AC +G+    K +I     + + +N G+S+     LH A++N  L +V+ L+  G
Sbjct: 324 TKLQIACDKGNYEVAKRLIQEGYNVDDQDNAGNSS-----LHEAALNGHLDIVELLLESG 378

Query: 133 ADVNARA-GALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLL 180
           A VN ++   +  TPL  AA  G++ +V  LL+H ADPT+T+ +G   +
Sbjct: 379 ASVNVQSHEPIRDTPLIDAAANGHLDVVKVLLRHRADPTITNSKGLTAI 427

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 30/72 (41%)

Query: 217 SLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQK 276
           S L A   G     +  L FGA   +   EG TPL     +G    +K L++ GAD   K
Sbjct: 530 SFLEAVKYGHEDITSLFLAFGAQPNMTSREGQTPLMVSVGRGHTGTVKLLLEAGADPLVK 589

Query: 277 TDTGKDCFAIAQ 288
              G+     A+
Sbjct: 590 DKQGRSVLNYAK 601

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%)

Query: 210 RDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQD 269
           RD  GRT L  A  +G+      L++ G ++   D  G + LH   + G   +++ L++ 
Sbjct: 318 RDAGGRTKLQIACDKGNYEVAKRLIQEGYNVDDQDNAGNSSLHEAALNGHLDIVELLLES 377

Query: 270 GA 271
           GA
Sbjct: 378 GA 379

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 14/78 (17%)

Query: 132 GADVN--ARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNI 189
           GA  N  +R G    TPL  +   G+   V  LL+ GADP + D QG ++L+ +  S   
Sbjct: 550 GAQPNMTSREGQ---TPLMVSVGRGHTGTVKLLLEAGADPLVKDKQGRSVLNYAKRSE-- 604

Query: 190 MLVLYVLFNVVSKGLLDI 207
                    +VSK  +D+
Sbjct: 605 -------LGLVSKQEIDL 615

>KLLA0E15796g complement(1406502..1407194) similar to sp|P50086
           Saccharomyces cerevisiae YGR232w NAS6 possible homolog
           of human 26S proteasome regulatory subunit p28
           singleton, start by similarity
          Length = 230

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 90/197 (45%), Gaps = 17/197 (8%)

Query: 78  HTACQRGDLATVKEMIH---GKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVS--QG 132
           H AC  GD   V++++    G +   ++DG        LHWA    + +++D L+S  + 
Sbjct: 8   HAACMNGDTEKVQQILSEFPGAVKVKDDDGRYP-----LHWAVSFQQDNIIDILLSYMKK 62

Query: 133 ADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPT--MTDDQGFNLLHLSVNSSNIM 190
            D++        +P+H A+  G V I++ LL H  +P   +  + G   LHL+ +  ++ 
Sbjct: 63  IDLDTILDESGWSPVHIASSIGSVTILEKLLNHTVEPNLDLQANNGITALHLACSKKHLN 122

Query: 191 LVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTP 250
           +V      +V +G   +  +D  G+  L  AA  G    V+ L    + + I D  G++P
Sbjct: 123 VVQL----LVERG-ASVRIKDGLGQLPLHRAAASGSVGIVSILCDKNSPVNIKDKNGWSP 177

Query: 251 LHWGTVKGQPHVLKYLI 267
           L     +G   V   L+
Sbjct: 178 LFHALAEGHGDVAVTLV 194

 Score = 35.8 bits (81), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 43/91 (47%), Gaps = 12/91 (13%)

Query: 221 AAYQGDSLTVAELL-KFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTD- 278
           A   GD+  V ++L +F  ++K+ D +G  PLHW     Q +++  L+     + +K D 
Sbjct: 10  ACMNGDTEKVQQILSEFPGAVKVKDDDGRYPLHWAVSFQQDNIIDILLS----YMKKIDL 65

Query: 279 ------TGKDCFAIAQEMNTVYSLREALTHS 303
                 +G     IA  + +V  L + L H+
Sbjct: 66  DTILDESGWSPVHIASSIGSVTILEKLLNHT 96

>Scas_595.9
          Length = 1148

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 62/118 (52%), Gaps = 3/118 (2%)

Query: 78  HTACQRGDLATVKEMIHG--KLLEVNN-DGDSTEHITGLHWASINNRLSVVDFLVSQGAD 134
           + ACQ  +    + ++     LL V++  G +  HI   +  +  N   +V  L+ +GA+
Sbjct: 488 NVACQYNNFEAAELLLAADINLLNVSDTKGLTPLHIVAKNGTNETNSRKLVQLLIQKGAN 547

Query: 135 VNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLV 192
            NA       TP+ +A + G   IVD LLK+GAD  + DD+  + LHL++  SNI ++
Sbjct: 548 PNALDTFNKWTPIFYAIQRGQREIVDELLKNGADLAIKDDENRSPLHLTIWESNIQVL 605

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 88/209 (42%), Gaps = 26/209 (12%)

Query: 78  HTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNA 137
           H AC+ G L  V+ ++  KL+   N  D+    T L  A INN L ++  L+ +      
Sbjct: 408 HYACEGGKLDFVQLLLQTKLMNSVNTPDNVMQ-TPLLLALINNHLEIMKLLLQEEQLTLE 466

Query: 138 RAGALHATPL-----------HWAARYGYVYIVDFLLKHGADPTM---TDDQGFNLLHL- 182
              +  ++             + A +Y      + LL   AD  +   +D +G   LH+ 
Sbjct: 467 SLPSSSSSSSSSSSLKYLSPLNVACQYNNFEAAELLL--AADINLLNVSDTKGLTPLHIV 524

Query: 183 ---SVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGR-TSLLWAAYQGDSLTVAELLKFGA 238
                N +N   ++ +L   + KG  + +  D   + T + +A  +G    V ELLK GA
Sbjct: 525 AKNGTNETNSRKLVQLL---IQKGA-NPNALDTFNKWTPIFYAIQRGQREIVDELLKNGA 580

Query: 239 SIKIADTEGFTPLHWGTVKGQPHVLKYLI 267
            + I D E  +PLH    +    VL  L+
Sbjct: 581 DLAIKDDENRSPLHLTIWESNIQVLNTLL 609

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 6/81 (7%)

Query: 207 IDCRDPKGRTSLLWAAYQGDSLT-----VAELLKFGASIKIADT-EGFTPLHWGTVKGQP 260
           ++  D KG T L   A  G + T     V  L++ GA+    DT   +TP+ +   +GQ 
Sbjct: 510 LNVSDTKGLTPLHIVAKNGTNETNSRKLVQLLIQKGANPNALDTFNKWTPIFYAIQRGQR 569

Query: 261 HVLKYLIQDGADFFQKTDTGK 281
            ++  L+++GAD   K D  +
Sbjct: 570 EIVDELLKNGADLAIKDDENR 590

>ADL142C [1599] [Homologous to ScYGR232W (NAS6) - SH]
           (443625..444314) [690 bp, 229 aa]
          Length = 229

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 69/157 (43%), Gaps = 6/157 (3%)

Query: 113 LHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGAD---P 169
           LH A +N   +    L+S    +     A    PLHWA  Y +V IV+ LL +       
Sbjct: 6   LHEACMNGDYARAVALLSDNPGLVRSKDADSRYPLHWAVSYQHVKIVELLLSYMLQVDLD 65

Query: 170 TMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLT 229
           T+ DD  ++ +H++    N  L   +L + V   L   D    +G T+L  A  +     
Sbjct: 66  TLVDDALWSPVHVAAVVGNRELFGKLLAHAVQPSL---DAATSQGTTALHLACSKQHYAV 122

Query: 230 VAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYL 266
           V +L+  GAS++  D +   PLH     G   ++K L
Sbjct: 123 VEDLITHGASVRKKDKKQQLPLHRACAIGSARLVKLL 159

>CAGL0L06622g complement(743602..747015) similar to sp|P17442
           Saccharomyces cerevisiae YGR233c PHO81 cyclin-dependent
           kinase inhibitor, start by similarity
          Length = 1137

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 91/204 (44%), Gaps = 13/204 (6%)

Query: 78  HTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNA 137
           H A ++G    V+ ++   L+++ +  D  +  T L  A  +N +  V  L+  G++   
Sbjct: 417 HHAAEQGKTEFVELILESNLVDMLDIPDQ-DRKTPLILALESNDIKAVKLLLQHGSNAYP 475

Query: 138 RAGALHATPLHWAARYG----YVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVL 193
            A      PL  A + G       I+DFL      P++       LLH+   +SN   + 
Sbjct: 476 NAQDKVLDPLSVACKKGNFEAVKLILDFLGDKIEGPSL---DKMELLHIVSKNSNSSALA 532

Query: 194 YVLFNVVSKGLLDIDCRDP-KGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLH 252
            +L   +SKG  +++  D   GRT L +A   G    V+ LL+  ASI + D EG+TPL 
Sbjct: 533 ELL---ISKGA-NVNYGDKFLGRTPLFYAVMNGKDNIVSLLLRCNASIDVMDDEGYTPLF 588

Query: 253 WGTVKGQPHVLKYLIQDGADFFQK 276
           +   +    VL  ++       QK
Sbjct: 589 YTIWESDVKVLNAMLPSIKSIKQK 612

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 70/135 (51%), Gaps = 7/135 (5%)

Query: 70  EDPLLTRYHTACQRGDLATVKEMIH--GKLLEVNNDGDSTEHITGLHWASIN-NRLSVVD 126
           +D +L     AC++G+   VK ++   G  +E    G S + +  LH  S N N  ++ +
Sbjct: 478 QDKVLDPLSVACKKGNFEAVKLILDFLGDKIE----GPSLDKMELLHIVSKNSNSSALAE 533

Query: 127 FLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNS 186
            L+S+GA+VN     L  TPL +A   G   IV  LL+  A   + DD+G+  L  ++  
Sbjct: 534 LLISKGANVNYGDKFLGRTPLFYAVMNGKDNIVSLLLRCNASIDVMDDEGYTPLFYTIWE 593

Query: 187 SNIMLVLYVLFNVVS 201
           S++ ++  +L ++ S
Sbjct: 594 SDVKVLNAMLPSIKS 608

>Kwal_27.12750
          Length = 233

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 86/195 (44%), Gaps = 13/195 (6%)

Query: 78  HTACQRGDLATVKEMIHGKL-LEVNNDGDSTEHITGLHWASINNRLSVVDFLVS--QGAD 134
           H AC+ G    V+E+++    L ++ D DS   I   HWA       VVD L+S  +  D
Sbjct: 11  HEACREGQEGKVRELLNEDPGLCLSKDLDSRYPI---HWAVSYQHEKVVDLLLSHMRNVD 67

Query: 135 VNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTM--TDDQGFNLLHLSVNSSNIMLV 192
           ++        +PLH A+  G + IV  LL     P +     QG   LHL+ +  ++ + 
Sbjct: 68  LDDLVDESGWSPLHIASSVGNLNIVKSLLSLSIKPDLDLATSQGVTALHLACSKQHLPVA 127

Query: 193 LYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLH 252
             ++    S     +  +D + + +L  AA  G+   V  L    + +   DT+G+TPL 
Sbjct: 128 SLLIEEGAS-----VRKKDTRNQLALHRAASVGNIPLVKLLCDQKSPVNSKDTQGWTPLF 182

Query: 253 WGTVKGQPHVLKYLI 267
               +G   V   L+
Sbjct: 183 HALSEGHGDVAVLLV 197

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 63/138 (45%), Gaps = 6/138 (4%)

Query: 146 PLHWAARYGYVYIVDFLLKHGAD---PTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSK 202
           P+HWA  Y +  +VD LL H  +     + D+ G++ LH++ +  N+ +V  +L   +  
Sbjct: 43  PIHWAVSYQHEKVVDLLLSHMRNVDLDDLVDESGWSPLHIASSVGNLNIVKSLLSLSIKP 102

Query: 203 GLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHV 262
              D+D    +G T+L  A  +      + L++ GAS++  DT     LH     G   +
Sbjct: 103 ---DLDLATSQGVTALHLACSKQHLPVASLLIEEGASVRKKDTRNQLALHRAASVGNIPL 159

Query: 263 LKYLIQDGADFFQKTDTG 280
           +K L    +    K   G
Sbjct: 160 VKLLCDQKSPVNSKDTQG 177

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 65/145 (44%), Gaps = 13/145 (8%)

Query: 78  HTACQRGDLATVKEMIHGKLLEVNNDGD--STEHITGLHWASINNRLSVVDFLVSQGADV 135
           H A   G+L  VK ++    L +  D D  +++ +T LH A     L V   L+ +GA V
Sbjct: 81  HIASSVGNLNIVKSLLS---LSIKPDLDLATSQGVTALHLACSKQHLPVASLLIEEGASV 137

Query: 136 NARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFN-LLH-LSVNSSNIMLVL 193
             +    +   LH AA  G + +V  L    +     D QG+  L H LS    ++ ++L
Sbjct: 138 R-KKDTRNQLALHRAASVGNIPLVKLLCDQKSPVNSKDTQGWTPLFHALSEGHGDVAVLL 196

Query: 194 YVLFNVVSKGLLDIDCRDPKGRTSL 218
            + +N   +     D RD   +T++
Sbjct: 197 VLEYNAEYR-----DLRDNNDKTAM 216

>ADL244W [1497] [Homologous to ScYIL112W - SH]
           complement(273379..276648) [3270 bp, 1089 aa]
          Length = 1089

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 8/109 (7%)

Query: 75  TRYHTACQRGDLATVKEMIHG--KLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQG 132
           TR   AC +G     +++I     + + +N G+S      LH A++N  L VV  L+  G
Sbjct: 343 TRLQVACDKGKYDLARKLIEEGYDVNDQDNAGNSP-----LHEAALNGHLEVVKLLIRHG 397

Query: 133 ADVNARAGAL-HATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLL 180
           A+VN ++  +   TPL  A+  G++ I+  LL++GADPT+ + +G   +
Sbjct: 398 ANVNIQSYEMFKDTPLIDASANGHLDILRELLQNGADPTIVNAKGLTAI 446

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 43/98 (43%), Gaps = 1/98 (1%)

Query: 210 RDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQD 269
           RD  GRT L  A  +G      +L++ G  +   D  G +PLH   + G   V+K LI+ 
Sbjct: 337 RDAGGRTRLQVACDKGKYDLARKLIEEGYDVNDQDNAGNSPLHEAALNGHLEVVKLLIRH 396

Query: 270 GADF-FQKTDTGKDCFAIAQEMNTVYSLREALTHSGFD 306
           GA+   Q  +  KD   I    N    +   L  +G D
Sbjct: 397 GANVNIQSYEMFKDTPLIDASANGHLDILRELLQNGAD 434

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 132 GADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNS 186
           GA VNA  G    T L  A   G++  V  LL+ GADPT  D  G ++L+ + +S
Sbjct: 574 GAQVNA-VGRDGQTALMAAVGRGHLNTVKLLLEAGADPTKRDKDGHSVLYYARHS 627

>YGR232W (NAS6) [2180] chr7 (953961..954647) Protein interacting
           with regulatory particle of the 26S proteasome [687 bp,
           228 aa]
          Length = 228

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 89/206 (43%), Gaps = 21/206 (10%)

Query: 78  HTACQRGDLATVKEMIHGK---LLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGAD 134
           H AC   +   V+E++H K   LL+ + DG        LHW+       +  FL+S+  +
Sbjct: 7   HQACMENEFFKVQELLHSKPSLLLQKDQDGR-----IPLHWSVSFQAHEITSFLLSKMEN 61

Query: 135 VNARAGALHA--TPLHWAARYGYVYIVDFLLKHGADPTMTD--DQGFNLLHLSVNSSNIM 190
           VN       +  TP H A   G + +V  L      P +    +QG   LHL+V      
Sbjct: 62  VNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFE 121

Query: 191 LVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELL-KFGAS-IKIADTEGF 248
           +  +++ N  S     +  +D   +  L  AA  G SL + ELL   G S +   D +G+
Sbjct: 122 VSQFLIENGAS-----VRIKDKFNQIPLHRAASVG-SLKLIELLCGLGKSAVNWQDKQGW 175

Query: 249 TPLHWGTVKGQPHVLKYLIQD-GADF 273
           TPL     +G       L++  GA++
Sbjct: 176 TPLFHALAEGHGDAAVLLVEKYGAEY 201

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 66  DEAEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVV 125
           D+  +D   T +H AC  G+L  VK + + + L+ + +  + + +T LH A       V 
Sbjct: 65  DDYPDDSGWTPFHIACSVGNLEVVKSL-YDRPLKPDLNKITNQGVTCLHLAVGKKWFEVS 123

Query: 126 DFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPT-MTDDQGFNLL 180
            FL+  GA V  +    +  PLH AA  G + +++ L   G       D QG+  L
Sbjct: 124 QFLIENGASVRIK-DKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPL 178

>CAGL0L06600g 742803..743498 similar to sp|P50086 Saccharomyces
           cerevisiae YGR232w, start by similarity
          Length = 231

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 70/159 (44%), Gaps = 6/159 (3%)

Query: 113 LHWASINNRLSVVDFLVSQGADVNA--RAGALHATPLHWAARYGYVYIVDFLLKHGAD-- 168
           LH A +NN    V  L+       A  +       PLHWA       I+  LL +     
Sbjct: 5   LHKACLNNEPRKVQELLESSDPFKAVVQRDDDGRVPLHWAVSIQSDAIIKLLLPYMKSVD 64

Query: 169 -PTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDS 227
             T+TD+ G+   H+S +  ++ +V   L+N       ++D +  +G T+L  A  +   
Sbjct: 65  IDTLTDEAGWTPFHISCSIGHLDIVDQ-LYNNNPDARPNLDLQTSQGVTALHLAVAKKHL 123

Query: 228 LTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYL 266
                L+K GAS++I D +G   LH     G   V+++L
Sbjct: 124 EVCKYLIKLGASVRIKDKKGQIALHRAAAVGSIGVVEFL 162

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 68/180 (37%), Gaps = 42/180 (23%)

Query: 75  TRYHTACQRGDLATVKEMIHGKL-LEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGA 133
           T +H +C  G L  V ++ +       N D  +++ +T LH A     L V  +L+  GA
Sbjct: 75  TPFHISCSIGHLDIVDQLYNNNPDARPNLDLQTSQGVTALHLAVAKKHLEVCKYLIKLGA 134

Query: 134 DVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVL 193
            V  +        LH AA  G + +V+FL      P                        
Sbjct: 135 SVRIKDKKGQIA-LHRAAAVGSIGVVEFLCSTAKSP------------------------ 169

Query: 194 YVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELL--KFGASIKIADTEGFTPL 251
                        ++ +D  G T L  A  +G +  +A LL  KF A  ++ D++G  P+
Sbjct: 170 -------------VNWKDASGWTPLFHAIAEGHA-DIAVLLVNKFSADYEVEDSDGKKPI 215

>KLLA0E18029g complement(1600015..1603470) weakly similar to
           sp|P40578 Saccharomyces cerevisiae YIR033w MGA2 may be
           involved in the remodeling chromatin structure, start by
           similarity
          Length = 1151

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 67/146 (45%), Gaps = 22/146 (15%)

Query: 177 FNLLHLSVNSSNI------MLVLYV--LFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSL 228
           +N    + NSSN       ML+L V  L N  S    ++   +  G+T L  A  +G   
Sbjct: 728 YNADSYATNSSNQVYYSDEMLILKVVKLLNPGS----NLSMCNSDGQTMLHLACLKGYFH 783

Query: 229 TVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAI-- 286
            V+ L+K GA + + D+ GFTPLH+  + G    ++ L++  A+   + D G D   +  
Sbjct: 784 LVSALVKKGARVDVTDSFGFTPLHFACINGDVKAIQLLVECKANVTARADNGVDALDLYK 843

Query: 287 -----AQEMNTVY---SLREALTHSG 304
                A E N  Y   +LR   TH G
Sbjct: 844 SQHVSAAEKNNSYIEDALRLLATHDG 869

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 46/98 (46%), Gaps = 7/98 (7%)

Query: 86  LATVKEMIHGKLLEV-NNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHA 144
           L  VK +  G  L + N+DG      T LH A +     +V  LV +GA V+    +   
Sbjct: 750 LKVVKLLNPGSNLSMCNSDGQ-----TMLHLACLKGYFHLVSALVKKGARVDV-TDSFGF 803

Query: 145 TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHL 182
           TPLH+A   G V  +  L++  A+ T   D G + L L
Sbjct: 804 TPLHFACINGDVKAIQLLVECKANVTARADNGVDALDL 841

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 145 TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSV---NSSNIMLVLYVLFNVVS 201
           T LH A   GY ++V  L+K GA   +TD  GF  LH +    +   I L++    NV +
Sbjct: 771 TMLHLACLKGYFHLVSALVKKGARVDVTDSFGFTPLHFACINGDVKAIQLLVECKANVTA 830

Query: 202 KGLLDIDCRD 211
           +    +D  D
Sbjct: 831 RADNGVDALD 840

>CAGL0F06831g 668173..671451 similar to sp|P40578 Saccharomyces
           cerevisiae YIR033w MGA2 or sp|P35210 Saccharomyces
           cerevisiae YKL020c SPT23, hypothetical start
          Length = 1092

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 53/97 (54%), Gaps = 2/97 (2%)

Query: 184 VNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIA 243
           V  S+ +L+  V+ N+ +   L + C D  GRT L  A+ +G    V+ L+K GA I   
Sbjct: 703 VKYSDEILITKVVKNLNTTSNLSM-C-DNLGRTLLHLASLKGYFKLVSTLIKKGARIDDK 760

Query: 244 DTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTG 280
           D+  FTPLH+  V G   +++ L+  GAD  +KT  G
Sbjct: 761 DSFDFTPLHFACVSGDVKIIRILLDCGADKNRKTKHG 797

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 111 TGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPT 170
           T LH AS+     +V  L+ +GA ++ +  +   TPLH+A   G V I+  LL  GAD  
Sbjct: 733 TLLHLASLKGYFKLVSTLIKKGARIDDK-DSFDFTPLHFACVSGDVKIIRILLDCGADKN 791

Query: 171 MTDDQGFNLLHL 182
                G   L L
Sbjct: 792 RKTKHGLLPLEL 803

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%)

Query: 142 LHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVL 196
           L  T LH A+  GY  +V  L+K GA     D   F  LH +  S ++ ++  +L
Sbjct: 730 LGRTLLHLASLKGYFKLVSTLIKKGARIDDKDSFDFTPLHFACVSGDVKIIRILL 784

>YLR246W (ERF2) [3642] chr12 (627120..628199) Protein that, in a
           complex with Shr5p, acts as a palmitoyltransferase for
           Ras2p [1080 bp, 359 aa]
          Length = 359

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 48/115 (41%), Gaps = 20/115 (17%)

Query: 425 ILVSVFYLFGQLVIM--------DPGCLPEETDHENVR------QTISNLL------EIG 464
           +LV  FY F  + +         DPG LP       +R      Q   NL+       I 
Sbjct: 108 VLVIFFYYFWVITLASFIRTATSDPGVLPRNIHLSQLRNNYQIPQEYYNLITLPTHSSIS 167

Query: 465 KFDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519
           K  T  +C    I +P RS      N  V   DH+C W+ N +G +N++ F+ F+
Sbjct: 168 KDITIKYCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFL 222

>YKL020C (SPT23) [3235] chr11 complement(398475..401723)
           Transcription factor required for transcription of a
           subset of genes; functionally redundant with Mga2p [3249
           bp, 1082 aa]
          Length = 1082

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 38/70 (54%)

Query: 211 DPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDG 270
           D +GRT L  AA+      V+ L+K+G+ +   D  GFTPLH   + G   +++ L++  
Sbjct: 707 DVRGRTLLHLAAFNNWYSLVSLLIKYGSHLNDQDLFGFTPLHMACINGDLRIIRLLLECN 766

Query: 271 ADFFQKTDTG 280
            +  +KT  G
Sbjct: 767 VNIMKKTRNG 776

>YDL019C (OSH2) [841] chr4 complement(417660..421511) Member of the
           yeast OSBP family of putative oxysterol-binding proteins
           that are involved in sterol homeostasis [3852 bp, 1283
           aa]
          Length = 1283

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 80/193 (41%), Gaps = 28/193 (14%)

Query: 78  HTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITG---------------LHWASINNRL 122
           H A Q   +  +KE++   + +V ++  S++   G               LH A+  +R 
Sbjct: 61  HYAVQVAPILLIKEIVAHWVDQVGDEKSSSKSDDGIHLDLNYQDENGNTPLHLAAAQSRS 120

Query: 123 SVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDD---QGFNL 179
            V+ FL+SQ +  +      H  PL          ++             DD   +  + 
Sbjct: 121 DVISFLLSQKSINDCVKNKAHQQPLDMCKDLNVAQMIQL---------KRDDYFLETVHS 171

Query: 180 LHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAE-LLKFGA 238
           L  ++N  +   +  +  N  +  LLDI+  DP+  T+LL+   Q   + + + LLK GA
Sbjct: 172 LRAAMNKRDFSKLDSIWKNPRNLNLLDINGIDPETGTTLLYEYSQKKDIEMCQWLLKHGA 231

Query: 239 SIKIADTEGFTPL 251
              + D +G +PL
Sbjct: 232 EATVKDGKGRSPL 244

>Sklu_1541.2 YOL003C, Contig c1541 950-2089 reverse complement
          Length = 379

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 464 GKFDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFI---FFIT 520
            KF+ +NFC +    KP R+      N  V   DH+CPW  N VG +N   FI   F++ 
Sbjct: 72  SKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVI 131

Query: 521 LMESGIFTFLA 531
              S + T+L 
Sbjct: 132 ETTSFLLTYLV 142

>YIR033W (MGA2) [2697] chr9 (416121..419462) Transcription factor
           involved in the response to hypoxia and biosynthesis of
           unsaturated fatty acids, may be involved in the
           remodeling of chromatin structure [3342 bp, 1113 aa]
          Length = 1113

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 46/95 (48%), Gaps = 6/95 (6%)

Query: 192 VLY---VLFNVVSKGL---LDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADT 245
           VLY   VL   V K L    +I   D  GRT L  A  +  S  V  L+K GA +   D+
Sbjct: 692 VLYSDEVLIQKVIKSLNINSNISICDSLGRTLLHLACLKNYSSLVYTLIKKGARVNDIDS 751

Query: 246 EGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTG 280
            G TPLH+  + G P ++K L+    ++  ++  G
Sbjct: 752 FGLTPLHFACISGDPKIIKMLLNCKVNYSLRSHNG 786

>YOL003C (YOL003C) [4813] chr15 complement(321858..322994) Nuclear
           protein of unknown function [1137 bp, 378 aa]
          Length = 378

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 469 KNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHK---AFIFFITLMESG 525
           +NFC +    KP RS      N  V   DH+CPW  N VG  N+     F+F+I +  S 
Sbjct: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSV 136

Query: 526 IFTFLA 531
           +F   A
Sbjct: 137 LFCIQA 142

>Scas_679.7
          Length = 374

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 43/99 (43%), Gaps = 11/99 (11%)

Query: 433 FGQLVIMDPGCLPEETDHENVR------QTISNLLEIGKFDTK-----NFCIETWIRKPL 481
           F +    DPG LP      +V+      Q   N + +  F T       +C    I +P 
Sbjct: 134 FIKTATSDPGVLPRNVHLGSVQRNFQIPQEYYNQITLPTFHTDCNIVLKYCKTCRIWRPP 193

Query: 482 RSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFIT 520
           RS    +    V   DH+C W+ N VG +N++ F+ F+T
Sbjct: 194 RSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFLT 232

>Scas_628.4
          Length = 1057

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 48/94 (51%), Gaps = 2/94 (2%)

Query: 176 GFNLLHLSVNSSNIMLVLYVLFNVVS--KGLLDIDCRDPKGRTSLLWAAYQGDSLTVAEL 233
           G +  + + N +N +    +L  V+   K   +I   D  GRT L  A  +G S   ++L
Sbjct: 681 GSHQYNTNANDNNTLSDEVLLTKVIKTLKSSSNISMCDNLGRTLLHLAVLKGYSHLTSQL 740

Query: 234 LKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLI 267
           ++ GA I + D  G+TPLH+  V G   ++K L+
Sbjct: 741 IQSGARIAVKDIFGYTPLHFACVNGSIEMIKLLL 774

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 230 VAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGA 271
           V + LK  ++I + D  G T LH   +KG  H+   LIQ GA
Sbjct: 704 VIKTLKSSSNISMCDNLGRTLLHLAVLKGYSHLTSQLIQSGA 745

>AGL125C [4187] [Homologous to ScYLR246W (ERF2) - SH]
           (473496..474599) [1104 bp, 367 aa]
          Length = 367

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/154 (21%), Positives = 59/154 (38%), Gaps = 44/154 (28%)

Query: 410 RTFSDEQYTNILMLVILVSVFYLFG---------------QLVIM--------------- 439
           RT +  +Y ++L+LV+L++   LF                  V++               
Sbjct: 81  RTVAKTKYLSVLVLVMLIAPIVLFSVFETGYLWKHVAGAKPCVVLCYYFWTLCFASFIST 140

Query: 440 ---DPGCLPEETDHENVRQTISNLLEIGKFDTK-----------NFCIETWIRKPLRSKF 485
              DPG LP       ++      LE     T             +C    I +P R+  
Sbjct: 141 GATDPGTLPRNIHLAQLQDDYKLPLEYYSIITLPSPVANAPVRLKYCTTCRIWRPPRASH 200

Query: 486 SPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519
             + ++ +  FDH+C W+ N +G +NH+ F+ F+
Sbjct: 201 CAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFL 234

>Sklu_2319.5 YNL326C, Contig c2319 9193-10194
          Length = 333

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 4/80 (5%)

Query: 464 GKFDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFI-FFITLM 522
           G+F     C    + KP RS      N    + DH+CPW  + +G KN K FI F +   
Sbjct: 100 GRF---RICRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLYTT 156

Query: 523 ESGIFTFLALCLEYFDELED 542
              +F F+   L+ +  L++
Sbjct: 157 WYAVFVFMTTGLQLWKWLDN 176

>AFR600C [3792] [Homologous to ScYDL056W (MBP1) - SH]
           (1517341..1519788) [2448 bp, 815 aa]
          Length = 815

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 62/144 (43%), Gaps = 16/144 (11%)

Query: 143 HATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLS--VNSSNIMLVLYVLFNVV 200
           H T  HWA   G + IV+ LL+ GA P   +  G   L  +  V++S        +F ++
Sbjct: 364 HHTAFHWACAMGTLPIVEALLQAGASPRALNQAGETPLMRASLVHNSYTKRTYPRIFQLL 423

Query: 201 SKGLLDIDCRDP-------KGRTSLLWAAYQGDSLTVAELLKFGASIKI------ADTEG 247
              + D+D R         K +++   A Y  D L +++L  F    +I       D +G
Sbjct: 424 QDTVFDVDSRSQTVVHHIVKRKSNTPSALYYLDVL-LSKLKDFSPQYRIETLINAQDCKG 482

Query: 248 FTPLHWGTVKGQPHVLKYLIQDGA 271
            TPLH   +       + L+ +GA
Sbjct: 483 STPLHIAAMNRDKKFFQTLVGNGA 506

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 66/163 (40%), Gaps = 27/163 (16%)

Query: 107 TEHITGLHWASINNRLSVVDFLVSQGADVNA--RAGALHATPLHWAA-------RYGYVY 157
           +EH T  HWA     L +V+ L+  GA   A  +AG    TPL  A+       +  Y  
Sbjct: 362 SEHHTAFHWACAMGTLPIVEALLQAGASPRALNQAG---ETPLMRASLVHNSYTKRTYPR 418

Query: 158 IVDFLLKHGADPTMTDDQGFNLLHLSVN-SSNIMLVLYVLFNVVSKGLLD---------- 206
           I   L     D    D +   ++H  V   SN    LY L  ++SK L D          
Sbjct: 419 IFQLLQDTVFD---VDSRSQTVVHHIVKRKSNTPSALYYLDVLLSK-LKDFSPQYRIETL 474

Query: 207 IDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFT 249
           I+ +D KG T L  AA   D      L+  GA   I + +G T
Sbjct: 475 INAQDCKGSTPLHIAAMNRDKKFFQTLVGNGALSTIKNHDGVT 517

>YGR233C (PHO81) [2181] chr7 complement(954675..958211)
           Cyclin-dependent kinase (CDK) inhibitor for
           Pho80p-Pho85p cyclin-dependent protein kinase complex,
           positive regulator of phosphate pathway [3537 bp, 1178
           aa]
          Length = 1178

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 79/185 (42%), Gaps = 26/185 (14%)

Query: 14  LTNEEQTVDPSNNDSQEDISLG-DSNEITSLASLKAIRSGNEEE------SGNEQVNHND 66
           +TN  + VDP ++DS+  + L   +N I  +  L  I   N           ++ V  + 
Sbjct: 445 ITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLLTIGGANASPIEKPILDYSKNVISST 504

Query: 67  EAEEDPLLTRYHTACQ--RGDLATVKEMIHGKLLEVNNDGDSTEHI---------TGL-- 113
           + + DPL    + AC+    D A +   I  K    N    S++H+         TGL  
Sbjct: 505 KVQFDPL----NVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHLCQPLFKKNSTGLCT 560

Query: 114 -HW-ASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTM 171
            H  A I     ++  L+  GAD N   G    TP+ +A R G+  ++  LLKH A   +
Sbjct: 561 LHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDI 620

Query: 172 TDDQG 176
            DD G
Sbjct: 621 EDDNG 625

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 53/148 (35%), Gaps = 38/148 (25%)

Query: 147 LHWAARYG-YVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLL 205
           LH  A+ G    ++  L+++GADP   D  GFN                           
Sbjct: 561 LHIVAKIGGDPQLIQLLIRYGADPNEID--GFN--------------------------- 591

Query: 206 DIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKY 265
                     T + +A   G S  + ELLK  A + I D  G +PL +   +    VL  
Sbjct: 592 --------KWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNA 643

Query: 266 LIQDGADFFQKTDTGKDCFAIAQEMNTV 293
           L+Q   +         +  +  Q +NT+
Sbjct: 644 LLQRPLNLPSAPLNEINSQSSTQRLNTI 671

>CAGL0D02508g 256760..257758 similar to sp|P42836 Saccharomyces
           cerevisiae YNL326c, start by similarity
          Length = 332

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 5/71 (7%)

Query: 464 GKFDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITLME 523
           G+F     C  +W  KP R       N  V + DH+CPW    VG +N K FI F  L+ 
Sbjct: 101 GRFRVCKSC-SSW--KPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQF--LIY 155

Query: 524 SGIFTFLALCL 534
             +++ L L L
Sbjct: 156 CTVYSILVLIL 166

>YNL326C (YNL326C) [4289] chr14 complement(27336..28346) Protein
           with similarity to Akr1p and Swf1p [1011 bp, 336 aa]
          Length = 336

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 5/69 (7%)

Query: 464 GKFDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITLME 523
           G+F     C   W  KP R       +  + + DH+CPW     G +N K FI F  LM 
Sbjct: 101 GRFRVCQVC-HVW--KPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQF--LMY 155

Query: 524 SGIFTFLAL 532
           + ++ FL L
Sbjct: 156 TTLYAFLVL 164

>ADL143W [1598] [Homologous to ScYGR233C (PHO81) - SH]
           complement(440265..443573) [3309 bp, 1102 aa]
          Length = 1102

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 68/143 (47%), Gaps = 13/143 (9%)

Query: 59  NEQVNHNDEAEED--PLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWA 116
           + QVN + + +E   P  +    AC   +L   + ++    + +N+  DS + +  LH  
Sbjct: 459 DAQVNPDPQIDESGKPQFSPLSVACANKNLTAARMILEIGNINLNDVCDS-QGLQPLHIV 517

Query: 117 SINN-RLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQ 175
           + N   + +++ LVS GA+ NA  G    TP+ +A + GY   V  LL +GA   + D  
Sbjct: 518 AKNGGDVELIELLVSHGANPNAVDGFNKWTPIFYAVQEGYGSTVQNLLSNGAKLDVVDGD 577

Query: 176 GFNLL-------HLSVNSSNIML 191
             + L       HLSV   NI+L
Sbjct: 578 NLSPLFYALWEGHLSV--LNILL 598

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 2/66 (3%)

Query: 207 IDCRDPKGRTSLLWAAYQGDSLTVAELLKFGA--SIKIADTEGFTPLHWGTVKGQPHVLK 264
           ++ RD  GRT L +A   G +  V  L+K     ++ I DT+  TPL    +K    + +
Sbjct: 395 LNARDTHGRTPLHYACDLGKTDFVRLLIKSSLLDTVNIPDTDSKTPLVLAIIKAHAEITR 454

Query: 265 YLIQDG 270
            L+ D 
Sbjct: 455 LLLVDA 460

>Scas_392.2
          Length = 376

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%)

Query: 465 KFDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519
           K +  +FC +  + KP R+      N  V   DH+CPW  N VG KN   F+ F+
Sbjct: 73  KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFL 127

>CAGL0H00935g 91979..92560 highly similar to sp|P46683 Saccharomyces
           cerevisiae YPL239w YAR1 ankyrin repeat-containing
           protein, start by similarity
          Length = 193

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 56/112 (50%), Gaps = 22/112 (19%)

Query: 84  GDLATVKE----MIHGKLLE--VNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNA 137
           GDL +++E    +IH KLL   V++D  ST     LH A+ N  L VV +++ Q    +A
Sbjct: 23  GDLESLQEIFTTLIHPKLLATCVSSDNGST----ALHMAAANGHLEVVKYIMEQ-VKQSA 77

Query: 138 RAGALHA----------TPLHWAARYGYVYIVDFLLKH-GADPTMTDDQGFN 178
            AGA+            T LHWA   G + +V +L     ADP + ++ G +
Sbjct: 78  DAGAVGRYVNLQNKTGNTALHWATLNGKLDVVQYLCDECDADPFVKNEFGHD 129

 Score = 33.1 bits (74), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 53/125 (42%), Gaps = 13/125 (10%)

Query: 169 PTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSL 228
           P   +DQ  + + L   + ++  +  +   ++   LL        G T+L  AA  G   
Sbjct: 7   PLEQEDQ--DAVILDARAGDLESLQEIFTTLIHPKLLATCVSSDNGSTALHMAAANGHLE 64

Query: 229 TVAELLK----------FGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQD-GADFFQKT 277
            V  +++           G  + + +  G T LHW T+ G+  V++YL  +  AD F K 
Sbjct: 65  VVKYIMEQVKQSADAGAVGRYVNLQNKTGNTALHWATLNGKLDVVQYLCDECDADPFVKN 124

Query: 278 DTGKD 282
           + G D
Sbjct: 125 EFGHD 129

>Sklu_2436.4 YDR459C, Contig c2436 10516-11610 reverse complement
          Length = 364

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 67/153 (43%), Gaps = 25/153 (16%)

Query: 391 VFFGTLLWVTIVWFFKV----MPRTFSDEQYTNILM---LVILVSVFYLFGQLVIMDPGC 443
           + FG L + T V+  K+    + + F  +     LM   +++++ +F  + Q++I+ PG 
Sbjct: 21  ILFGLLCYATWVYCHKLCYDEIYKRFGHKSIAIGLMCPEIILVIVIFVTWAQMLILGPGV 80

Query: 444 LPEETDHENVRQTISN---------------LLEIGKFDTKNFCIETWIRKPL---RSKF 485
            P+      V    +N                 +I + D + + I   + + L   R+  
Sbjct: 81  QPKVPPFRIVADRDNNGSGTSVDEKDQLSIFPPDIYQCDPQGYPIWCSMCQSLKMERTHH 140

Query: 486 SPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFF 518
           S      V RFDHYC WI   VG KN++ FI F
Sbjct: 141 SATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQF 173

>KLLA0D18370g complement(1549382..1550449) similar to sgd|S0004236
           Saccharomyces cerevisiae YLR246w ERF2 protein involved
           in palmitoylation and localization of RAS2P,
           hypothetical start
          Length = 355

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 58/136 (42%), Gaps = 18/136 (13%)

Query: 418 TNILMLVILVSVFYL-----FGQLVIMDPGCLPEETDHENVRQTISNLLEIGKF---DTK 469
           TN    ++++  FYL     F +    DPG +P      ++  +     E   +    TK
Sbjct: 104 TNWKPAIVILYYFYLLTICSFLRAACSDPGIVPRNVHIPDLNASYKIPQEYYNYAILPTK 163

Query: 470 N--------FCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITL 521
           N        +C    I +P RS    + +  V   DH+C W+ N +G +N++ F+ F  L
Sbjct: 164 NPNASVSMKYCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEF--L 221

Query: 522 MESGIFTFLALCLEYF 537
           M S I   L + L  F
Sbjct: 222 MASTISCILLILLSSF 237

>ACR165W [1212] [Homologous to ScYKL020C (SPT23) - SH; ScYIR033W
           (MGA2) - SH] complement(644229..647648) [3420 bp, 1139
           aa]
          Length = 1139

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 213 KGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQ 268
           +G T L  A  +G    V+ L+K GA +++ D  GFTPLH+  V G   + + LIQ
Sbjct: 750 EGHTLLHLACLKGYYQLVSLLVKKGAHVEVTDRFGFTPLHFACVNGDTRITRLLIQ 805

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 21/39 (53%)

Query: 145 TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLS 183
           T LH A   GY  +V  L+K GA   +TD  GF  LH +
Sbjct: 753 TLLHLACLKGYYQLVSLLVKKGAHVEVTDRFGFTPLHFA 791

>CAGL0E02497g complement(241118..242248) similar to tr|Q12006
           Saccharomyces cerevisiae YOL003c, start by similarity
          Length = 376

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 26/56 (46%)

Query: 464 GKFDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519
            K + K +C +    KP RS      N  V   DH+CPW  N VG  N   FI F+
Sbjct: 72  SKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFL 127

>Sklu_2202.8 YPL110C, Contig c2202 8829-12932
          Length = 1367

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 83/178 (46%), Gaps = 42/178 (23%)

Query: 145 TPLHWAARYGYV----YIVDFLLKHGA-DPTMT--------DDQGFNLLHLSVNSSNIML 191
           TPLH++A+YG V     IV+ L + GA +P +T        D +G   LHL+V  ++ M 
Sbjct: 462 TPLHYSAQYGLVEVTKIIVESLREWGAWNPDITIDDIKAWGDSEGLTPLHLAVIGTHPMT 521

Query: 192 V------------------LYVLFNVVSKGLLD---------IDCRDPKGRTSLLWAAYQ 224
           V                  L++   + S  L+D         ID +D + R + L+ A +
Sbjct: 522 VKVLNSFINPNKALHSSHLLHLATRLNSPELIDALLSVNGFEIDYQDEETRETALYIASK 581

Query: 225 GDSLTVAE-LLKFGASIKIADT-EGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTG 280
            + +     LL+ GAS ++ +   G+TP+     +G   +++ L++ GA +    ++G
Sbjct: 582 LNLVEATTFLLEKGASTELGEKFFGWTPMFAAATEGYADIVRLLLKYGAKYDISDESG 639

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 34/72 (47%)

Query: 105 DSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLK 164
           D     T L+ AS  N +    FL+ +GA           TP+  AA  GY  IV  LLK
Sbjct: 568 DEETRETALYIASKLNLVEATTFLLEKGASTELGEKFFGWTPMFAAATEGYADIVRLLLK 627

Query: 165 HGADPTMTDDQG 176
           +GA   ++D+ G
Sbjct: 628 YGAKYDISDESG 639

>Sklu_2237.5 YPL239W, Contig c2237 9761-10357
          Length = 198

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 55/119 (46%), Gaps = 18/119 (15%)

Query: 71  DPLLTRYHTA----CQRGDLATVKE----MIHGKLLEVNNDGDSTEHITGLHWASINNRL 122
           DPL      A     + GDL ++K+    ++H KLL      DS    T LH A+ N  L
Sbjct: 6   DPLNQEDQDAIILDSRAGDLDSLKDIFTNLVHPKLLTTC--YDSVSKSTPLHMAAANGHL 63

Query: 123 SVVDFLVSQGAD------VNARAGALHATPLHWAARYGYVYIVDFLL-KHGADPTMTDD 174
            V+ +L+S          VN R      T LHWA+  G + IV  L  ++ ADP + +D
Sbjct: 64  EVIKYLLSIAEPSEVKQWVNTR-NETGNTALHWASLNGNLEIVKLLCEEYDADPFIRND 121

 Score = 29.6 bits (65), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 56/129 (43%), Gaps = 11/129 (8%)

Query: 168 DPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGR-TSLLWAAYQGD 226
           DP   +DQ  + + L   + ++  +  +  N+V   LL   C D   + T L  AA  G 
Sbjct: 6   DPLNQEDQ--DAIILDSRAGDLDSLKDIFTNLVHPKLLTT-CYDSVSKSTPLHMAAANGH 62

Query: 227 S------LTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQD-GADFFQKTDT 279
                  L++AE  +    +   +  G T LHW ++ G   ++K L ++  AD F + D 
Sbjct: 63  LEVIKYLLSIAEPSEVKQWVNTRNETGNTALHWASLNGNLEIVKLLCEEYDADPFIRNDF 122

Query: 280 GKDCFAIAQ 288
             D    A+
Sbjct: 123 DHDAIFEAE 131

>Kwal_23.3302
          Length = 353

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 49/115 (42%), Gaps = 20/115 (17%)

Query: 425 ILVSVFYLFGQLVIM--------DPGCLPEE------TDHENVRQTISNLLEIGKFDTK- 469
           +LV +FY F    +         DPG LP        +    + Q   N++ +   ++  
Sbjct: 106 VLVVLFYYFWTTCLAAFFRTATSDPGVLPRNVHVPIVSSEFELPQGYYNIISLPSANSNG 165

Query: 470 -----NFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519
                 +C    I +P R+    +  A +   DH+C W+ N +G +N++ F+ F+
Sbjct: 166 LTVDVKYCPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFL 220

>CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces
           cerevisiae YPL110c, start by similarity
          Length = 1245

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 79/178 (44%), Gaps = 42/178 (23%)

Query: 145 TPLHWAARYGY----VYIVDFLLKHG--ADPTMTDD-------QGFNLLHLSV---NSSN 188
           TPLH+AA++G+      I++ L   G   D    DD       +G + +HL+V   N+  
Sbjct: 443 TPLHYAAKFGFTGIAAEIIEMLKAWGYWKDDISLDDKDFWGDSEGLSPVHLAVLGRNTDT 502

Query: 189 IMLVLYVLFN------------------------VVSKGLLDIDCRDPKGRTSLLWAAYQ 224
           + ++L  + N                        ++S   +DI+ +D + + + L+ A  
Sbjct: 503 LKMLLDSMNNNLLLTSPTLLFLAIQTNEFDLINTILSSSRIDINFQDEQTKETALYQAVA 562

Query: 225 GDSL-TVAELLKFGASIKIADTE-GFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTG 280
            +     A LL  GAS +I +   G+TPL  G  +G   +++ L+ +GA+     D G
Sbjct: 563 ANLFEATACLLINGASTEIKEKLFGWTPLFIGAAEGYSDIVRLLVNNGANINILDDGG 620

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 45/105 (42%), Gaps = 1/105 (0%)

Query: 80  ACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARA 139
           A Q  +   +  ++    +++N   + T+  T L+ A   N       L+  GA    + 
Sbjct: 525 AIQTNEFDLINTILSSSRIDINFQDEQTKE-TALYQAVAANLFEATACLLINGASTEIKE 583

Query: 140 GALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSV 184
                TPL   A  GY  IV  L+ +GA+  + DD G+  +  +V
Sbjct: 584 KLFGWTPLFIGAAEGYSDIVRLLVNNGANINILDDGGWTPMEHAV 628

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%)

Query: 214 GRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLK 264
           G T L   A +G S  V  L+  GA+I I D  G+TP+    ++G   V K
Sbjct: 587 GWTPLFIGAAEGYSDIVRLLVNNGANINILDDGGWTPMEHAVLRGHLEVAK 637

>Kwal_55.22126
          Length = 360

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 3/65 (4%)

Query: 455 QTISNLLEIGKFDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKA 514
           Q    L   G+F    FC    + KP R       N    + DH+CPW  + VG +N K 
Sbjct: 119 QRCVTLKRNGRF---RFCRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKY 175

Query: 515 FIFFI 519
           FI F+
Sbjct: 176 FIHFL 180

>KLLA0E02068g complement(195185..196162) weakly similar to sp|P42836
           Saccharomyces cerevisiae YNL326c, hypothetical start
          Length = 325

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 39/96 (40%), Gaps = 10/96 (10%)

Query: 459 NLLEIGKFDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFI-- 516
           N + + +  +  FC    I KP R       N    + DH+CPW  + VG +N K F+  
Sbjct: 92  NCIFVKRDGSFRFCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQF 151

Query: 517 --------FFITLMESGIFTFLALCLEYFDELEDAH 544
                    ++ LM S         ++Y  EL D H
Sbjct: 152 LAYTTVYSLYVLLMTSAQLYSWFRQMKYKSELLDLH 187

>Scas_700.13
          Length = 1133

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%)

Query: 111 TGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPT 170
           T LH A   N   +V  L++ GA+       L  TPL  AA  GY  ++  LL++G D  
Sbjct: 487 TALHIACKYNSPEIVACLLAHGANSEVVENKLGWTPLFIAAAKGYNEVLQILLQYGCDVN 546

Query: 171 MTDDQG 176
           + D+ G
Sbjct: 547 LKDNAG 552

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query: 214 GRTSLLWAAYQGDSLTVAELLKFGASIKIADTE-GFTPLHWGTVKGQPHVLKYLIQDGAD 272
           G T+L  A        VA LL  GA+ ++ + + G+TPL     KG   VL+ L+Q G D
Sbjct: 485 GETALHIACKYNSPEIVACLLAHGANSEVVENKLGWTPLFIAAAKGYNEVLQILLQYGCD 544

Query: 273 FFQKTDTG 280
              K + G
Sbjct: 545 VNLKDNAG 552

>KLLA0C06204g complement(548912..550045) similar to sgd|S0005363
           Saccharomyces cerevisiae YOL003c, start by similarity
          Length = 377

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%)

Query: 470 NFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519
           N+C +  + KP R+      N  V   DH+CPW  N VG  N   F+ F+
Sbjct: 78  NYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFL 127

>CAGL0F06655g 654908..656134 similar to sp|Q04749 Saccharomyces
           cerevisiae YMR068w, start by similarity
          Length = 408

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 63/161 (39%), Gaps = 39/161 (24%)

Query: 70  EDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLV 129
           EDP L R   A + G+L  VK ++  +  ++  + D     + LH+AS + R  +   L+
Sbjct: 3   EDPSL-RLRKAIKEGNLLIVKRLLR-RFPDLLTNIDPCNGWSSLHYASYHGRYLICVLLI 60

Query: 130 SQGADVNA-----------------------------------RAGALHATPLHWAARYG 154
             G D                                      +AG L  TP H A  + 
Sbjct: 61  QLGHDKTEVLKTFKGNTCVHLALMNGHEQTTHLLLQHFPRFINKAGELGRTPTHIACIHD 120

Query: 155 YVYIVDFLLKHGADPTMTDDQGFNLLHLSVN--SSNIMLVL 193
           Y   +  L+  GA+  M DD+G   LHL +   S+N M +L
Sbjct: 121 YYQCLSLLIGVGANLMMKDDKGNTPLHLCLEFGSTNCMKML 161

 Score = 33.9 bits (76), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 60/130 (46%), Gaps = 16/130 (12%)

Query: 147 LHWAARYGYVYIVDFLLKHGADPT--MTDDQGFNLLHLSV-----NSSNIMLVLYVLFNV 199
           LH+A+ +G   I   L++ G D T  +   +G   +HL++      +++++L  +  F +
Sbjct: 44  LHYASYHGRYLICVLLIQLGHDKTEVLKTFKGNTCVHLALMNGHEQTTHLLLQHFPRF-I 102

Query: 200 VSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQ 259
              G L        GRT    A        ++ L+  GA++ + D +G TPLH     G 
Sbjct: 103 NKAGEL--------GRTPTHIACIHDYYQCLSLLIGVGANLMMKDDKGNTPLHLCLEFGS 154

Query: 260 PHVLKYLIQD 269
            + +K L+ +
Sbjct: 155 TNCMKMLVNE 164

>YDR126W (SWF1) [973] chr4 (703228..704238) Protein involved in
           vacuolar trafficking and secretion, required to maintain
           wild-type abundance of polarized actin cables, possibly
           required for full induction of IME1 during early meiosis
           [1011 bp, 336 aa]
          Length = 336

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 472 CIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAF-IFFITLMESGIFTFL 530
           C    I KP RSK   + N  V   DH+C WI N +G  N+  F +F I+ + S  + FL
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195

Query: 531 AL 532
            L
Sbjct: 196 RL 197

>CAGL0B01991g 182894..183886 similar to sp|Q04629 Saccharomyces
           cerevisiae YDR126w, hypothetical start
          Length = 330

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 76/176 (43%), Gaps = 22/176 (12%)

Query: 407 VMPRTFSDEQYTNILMLVILVSVFYLFGQL-VIMDPGCLPEETDHENVRQTISNLLEIGK 465
           + P   S E Y  I +++IL      FG + +I+ P            R    NLL   +
Sbjct: 77  ISPMLTSIETYVVIPLMLILPL---FFGSMSMIIKPDSSNAHQIGSEKRYPYDNLLYFPQ 133

Query: 466 FDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFIT---LM 522
            + +  C +    KP RSK   + N+ +   DH+C WI N VG+ N+  F  F+    L+
Sbjct: 134 HECRT-CKQV---KPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFLCSNLLL 189

Query: 523 ESGIFTFLALCLEYFDELEDAHEDTSQKNGKCFILGASDLCSGL-----IYDRFVF 573
            S  ++F+ L    F++       T +K+    +L  S LC        +Y  FVF
Sbjct: 190 LS--YSFIRLIFIQFNKSAYNTTPTGEKS----LLILSILCGSFTVILAVYCYFVF 239

>CAGL0K06347g complement(623217..624275) similar to tr|Q03289
           Saccharomyces cerevisiae YDR459c, hypothetical start
          Length = 352

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 482 RSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519
           R+K S      V RFDHYC W+   +G KN++ F+ F+
Sbjct: 126 RTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFV 163

>Kwal_14.889
          Length = 1094

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%)

Query: 211 DPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDG 270
           D  G+T L  A  +G    V+ L++ GA +   D+ GF PLH+  + G   ++  L+Q  
Sbjct: 731 DEDGQTMLHLACLKGYYNLVSALVRKGARVDAKDSFGFLPLHFACLNGDARIISLLVQCK 790

Query: 271 ADFFQKTDTG 280
           A    +T  G
Sbjct: 791 ATIHAETING 800

>CAGL0G08217g complement(778823..779803) similar to tr|Q06551
           Saccharomyces cerevisiae YLR246w ERF2, hypothetical
           start
          Length = 326

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 41/97 (42%), Gaps = 10/97 (10%)

Query: 433 FGQLVIMDPGCLPEETD-HENVRQTISNLLEI---------GKFDTKNFCIETWIRKPLR 482
           F +    DPG LP     H++  Q   N + +             T  +C    I +P R
Sbjct: 111 FTKTATSDPGVLPRNIHMHKDTPQEYFNNVTLPYGAGGSAGNASVTLKYCHTCKIWRPPR 170

Query: 483 SKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519
           +    +    V   DH+C W+ N VG +N++ F+ F+
Sbjct: 171 ASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFL 207

>KLLA0E15774g 1402940..1406386 similar to sp|P17442 Saccharomyces
           cerevisiae YGR233c PHO81 cyclin-dependent kinase
           inhibitor singleton, start by similarity
          Length = 1148

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 96/222 (43%), Gaps = 18/222 (8%)

Query: 54  EEESGNEQVNHNDEAEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGL 113
           ++E+  + +N  D     PL    H AC+ G    V  +I+ +L++  +  D+T   T L
Sbjct: 413 QQEAFRKLLNAQDIHGRMPL----HYACELGKTNFVSLLINTELIDNIDLLDNTSK-TPL 467

Query: 114 HWASINNRLSVVDFLVSQGADVNARAGALHAT-----PLHWAARYGYVYIVDFLLKHGAD 168
             + INN + V   L++QG +VN        T     PL+ A           +L+ G  
Sbjct: 468 VLSIINNHIEVTKILIAQG-NVNLSPSLCEGTKPQFHPLNVACSNKNYEAAKVILEKGDI 526

Query: 169 --PTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGR-TSLLWAAYQG 225
               + D QG   LH+         ++ +L   VS G  D D  D   +   + +A  +G
Sbjct: 527 NLSRLRDSQGLCPLHIVAKMGGGSELIKLL---VSYG-ADPDEIDGFNKWPPIFYAIQEG 582

Query: 226 DSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLI 267
            + TV  LL+ GA + + D +  + + +   +G   VL  L+
Sbjct: 583 HATTVQVLLELGADVFMKDQQNLSQVFYALWEGHLSVLNVLL 624

>ADL197C [1544] [Homologous to ScYNL326C - SH] (350993..352165)
           [1173 bp, 390 aa]
          Length = 390

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 80/210 (38%), Gaps = 42/210 (20%)

Query: 416 QYTNILMLVILVSVFYLFGQLVIMDPGCLPEETDHENVRQTISNLLEIG----------- 464
           Q T +L LV L+   Y +   + + PG      D E +R    N +E G           
Sbjct: 104 QGTVLLTLVPLI--LYAYFSTIAVGPG---SPLDFEELRIRDLNDVETGMEFPPDFLAAK 158

Query: 465 --KFDT---KNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519
               D+     +C++  + KP R       +    R DH+C W    +G  NHK F+ F 
Sbjct: 159 TVTLDSTGRHRYCVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHF- 217

Query: 520 TLMESGIFTFLALCLEYFDELEDAHEDTSQKNGKCFILGASDLCSGLIYDRFVFLILLWA 579
            L+ + ++ F    +  +D +      + ++     +L              V L+ LWA
Sbjct: 218 -LLYASVYAFWICIITTWDLVVWFRAHSYERE----LLN-------------VHLVCLWA 259

Query: 580 LLQSIWVASLIFV--QAFQICKGMTNTEFN 607
           L  +  VA   F     + +CK  T  E+ 
Sbjct: 260 LSAAATVALTAFCAFNIYLVCKNETTGEYQ 289

>ACL003C [1046] [Homologous to ScYOL003C - SH] (352024..353151)
           [1128 bp, 375 aa]
          Length = 375

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 465 KFDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLK----NHKAFIFFIT 520
           +++ +N+C +    KP R+      N  V   DH+CPW  N +GL+     H  F + I 
Sbjct: 73  RYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIA 132

>Scas_415.1
          Length = 452

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 62/131 (47%), Gaps = 16/131 (12%)

Query: 147 LHWAARYGYVYIVDFLLKHGADP--TMTDDQGFNLLHLSV-----NSSNIMLVLYVLFNV 199
           LH+AA +G   I   L++ G D    +   +G   +HL++      +++++L  +  F  
Sbjct: 255 LHYAAYHGRYLICVHLIQLGHDKHEIIKTFKGNTCVHLALINGHEQTTHLLLQHFPRF-- 312

Query: 200 VSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQ 259
                  I+ +   GRT + +A        ++ L+  GA++ I D +G TPLH      +
Sbjct: 313 -------INEKGEHGRTPVHFACMYDHFQCLSLLIGVGANLTIKDEDGETPLHICLEYSR 365

Query: 260 PHVLKYLIQDG 270
            H +K L+ +G
Sbjct: 366 IHCMKILLSEG 376

 Score = 37.4 bits (85), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 42/96 (43%), Gaps = 4/96 (4%)

Query: 111 TGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPT 170
           T +H A IN        L+          G    TP+H+A  Y +   +  L+  GA+ T
Sbjct: 288 TCVHLALINGHEQTTHLLLQHFPRFINEKGEHGRTPVHFACMYDHFQCLSLLIGVGANLT 347

Query: 171 MTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLD 206
           + D+ G   LH+ +  S I  +  +L    S+G LD
Sbjct: 348 IKDEDGETPLHICLEYSRIHCMKILL----SEGQLD 379

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 39/95 (41%), Gaps = 1/95 (1%)

Query: 213 KGRTSLLWAAYQGDSLTVAELLK-FGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGA 271
           KG T +  A   G   T   LL+ F   I      G TP+H+  +      L  LI  GA
Sbjct: 285 KGNTCVHLALINGHEQTTHLLLQHFPRFINEKGEHGRTPVHFACMYDHFQCLSLLIGVGA 344

Query: 272 DFFQKTDTGKDCFAIAQEMNTVYSLREALTHSGFD 306
           +   K + G+    I  E + ++ ++  L+    D
Sbjct: 345 NLTIKDEDGETPLHICLEYSRIHCMKILLSEGQLD 379

>Kwal_47.18366
          Length = 356

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 60/135 (44%), Gaps = 27/135 (20%)

Query: 421 LMLVILVSVFYLFGQLVIMDPGCLPE------------ETDHENVRQTISNLLE---IGK 465
           ++LV+++++     Q++ + PG  P+            E+D ++  +  +  ++   I +
Sbjct: 58  VLLVLILAI--TLAQIICIGPGQQPKLLPFRIVADSESESDEKDGSEAATRSIKPPRIYQ 115

Query: 466 FDTKNF---CIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFI------ 516
            D + +   C      K  R+  S      + RFDHYC WI   VG KN++ F+      
Sbjct: 116 CDPQGYPIWCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKNYRLFVQFAFYF 175

Query: 517 -FFITLMESGIFTFL 530
             F   M + I +FL
Sbjct: 176 WLFTIYMIASIASFL 190

>Scas_683.37
          Length = 820

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 66/158 (41%), Gaps = 17/158 (10%)

Query: 108 EHITGLHWASINNRLSVVDFLVSQGADVNARAGALHA-TPLHWAARYGYVYIVD-----F 161
           E  +  HWA     L +V+ L S G   N R    H  TPL  +A +   Y        F
Sbjct: 419 EQHSAFHWACSMGILPIVETLFSAG--TNIRTTNSHGQTPLMRSAMFHNSYTRRSFPRIF 476

Query: 162 LLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSK--------GL-LDIDCRDP 212
            L H     + +D    + H+    S+    +Y L  V+SK        G+ + ++ +D 
Sbjct: 477 QLLHETVFDVDNDLQTVIHHIVKRKSSTPSAIYYLDTVLSKIKDFSPQYGVEMLLNAQDN 536

Query: 213 KGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTP 250
            G T+L  AA  GD L    LL  GA   I + +G TP
Sbjct: 537 NGDTALHIAARNGDKLFFDTLLNNGALNTIRNKKGLTP 574

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 9/110 (8%)

Query: 77  YHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVN 136
           +H +  R     + +++H  + +V+ND  +  H      +S  + +  +D ++S+  D +
Sbjct: 463 FHNSYTRRSFPRIFQLLHETVFDVDNDLQTVIHHIVKRKSSTPSAIYYLDTVLSKIKDFS 522

Query: 137 ARAGA---LHA------TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGF 177
            + G    L+A      T LH AAR G     D LL +GA  T+ + +G 
Sbjct: 523 PQYGVEMLLNAQDNNGDTALHIAARNGDKLFFDTLLNNGALNTIRNKKGL 572

>ADR151W [1892] [Homologous to ScYMR068W - SH]
           complement(971060..972322) [1263 bp, 420 aa]
          Length = 420

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 55/123 (44%), Gaps = 6/123 (4%)

Query: 147 LHWAARYGYVYIVDFLLKHGADP--TMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGL 204
           LH+AA YG   I   L++ G D   T+    G   +HL++ + +     +VL     + L
Sbjct: 44  LHYAAYYGRYLICVQLIQQGHDRQGTLRTFTGSTSVHLALKNGHEQTT-HVLLQSFPQTL 102

Query: 205 LDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLK 264
                +D  GRT    A  Q     ++ L   GA + + D +G TPLH   +    + ++
Sbjct: 103 AS---KDVGGRTPAHIACMQDYHTCLSLLSSAGADLSLTDNDGNTPLHIAMMYNSVNCIR 159

Query: 265 YLI 267
            L+
Sbjct: 160 LLV 162

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 35/85 (41%), Gaps = 2/85 (2%)

Query: 111 TGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPT 170
           T +H A  N        L+       A       TP H A    Y   +  L   GAD +
Sbjct: 77  TSVHLALKNGHEQTTHVLLQSFPQTLASKDVGGRTPAHIACMQDYHTCLSLLSSAGADLS 136

Query: 171 MTDDQGFNLLHLSV--NSSNIMLVL 193
           +TD+ G   LH+++  NS N + +L
Sbjct: 137 LTDNDGNTPLHIAMMYNSVNCIRLL 161

>YDR459C (YDR459C) [1277] chr4 complement(1382307..1383431) Protein
           of unknown function, has similarity to Erf2p [1125 bp,
           374 aa]
          Length = 374

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 53/126 (42%), Gaps = 20/126 (15%)

Query: 471 FCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFI----FFITLMESGI 526
           +C E    K  R+  S      + RFDHYC WI   +G  N++ F+    +F TL+   +
Sbjct: 130 WCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFVQFAAYFSTLL---L 186

Query: 527 FTFLALCLEYFDELEDAHEDTSQKNGKCFILGASDLCSGLIYDRFVFLILLWALLQSIWV 586
             ++++C+      +  H  +   N               I    VF IL W L  S+  
Sbjct: 187 IMWVSICVYIRIITQHNHNYSPNLNAN-------------IISTLVFAILGWLLTASLLA 233

Query: 587 ASLIFV 592
           +S+ ++
Sbjct: 234 SSIFYM 239

>Kwal_56.22459
          Length = 383

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%)

Query: 469 KNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFIT 520
           KN C +    KP R+      +  V   DH+CPW  N VG  N   F+ F+ 
Sbjct: 77  KNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLV 128

>CAGL0D01012g 118878..121286 similar to sp|P39678 Saccharomyces
           cerevisiae YDL056w MBP1 transcription factor, start by
           similarity
          Length = 802

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 66/159 (41%), Gaps = 25/159 (15%)

Query: 111 TGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAA-------RYGYVYIVDFLL 163
           T  HWA     L +V+ L   G ++ A A A   TPL  +A       R  +  I + L 
Sbjct: 386 TAFHWACSMGNLPIVEALYETGTNIRA-ANANGQTPLMRSAMFHNSYTRRSFPRIFELLS 444

Query: 164 KHGADPTMTDDQGFNLLH--LSVNSSNIMLVLYVLFNVVSKGLLDI----------DCRD 211
           +   D    D  G  +LH  +   SS    + YV  NV+   + DI          + +D
Sbjct: 445 ETVFD---IDSMGQTVLHHIVKRKSSTPSAIYYV--NVLLSKIKDISPKYRIELLLNTKD 499

Query: 212 PKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTP 250
             G T+L  AA   D      L+K G+   I++ +G TP
Sbjct: 500 ANGDTALHIAARNNDREFFDILIKNGSLSTISNNDGQTP 538

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 211 DPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPL 251
           DP+  T+  WA   G+   V  L + G +I+ A+  G TPL
Sbjct: 381 DPELHTAFHWACSMGNLPIVEALYETGTNIRAANANGQTPL 421

>Scas_716.48
          Length = 327

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 60/151 (39%), Gaps = 25/151 (16%)

Query: 470 NFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITLMESGIFTF 529
             C    + KP R       +  + + DH+CPW    +G +N K F+ F+        T 
Sbjct: 99  RLCQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFLIYC-----TA 153

Query: 530 LALCLEYFDELEDAHEDTSQKNGKCFILGASDLCSGLIYDRFVFLILLWALLQSIWV-AS 588
            ++ + +F   E  H   S K  +               D  + L+LL   + +I +  S
Sbjct: 154 YSIVVLFFTSCE-LHYWFSGKQYE---------------DELIDLMLLTVWILAIVITVS 197

Query: 589 LIFVQAF---QICKGMTNTEFNVLMKESKSI 616
           LIF  +F   Q+ K  T  E   + +E + +
Sbjct: 198 LIFFSSFSIYQLLKNQTTIEMYGMKREKRDL 228

>AGR223W [4534] [Homologous to ScYPL110C - SH]
           complement(1167870..1171835) [3966 bp, 1321 aa]
          Length = 1321

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 73/171 (42%), Gaps = 42/171 (24%)

Query: 145 TPLHWAARYGYVYIVDFLLKH-------GADPTMT------DDQGFNLLHLSVNSSNIML 191
           TPLH++A+YG   +   +L+         AD  +       D +    LHL+V  ++ + 
Sbjct: 420 TPLHYSAQYGLCEVTRIILQALSEWDAWNADVAIDDIDVWGDSENLTPLHLAVIGTHPLT 479

Query: 192 VLYVL-FNVVSKGL--------------------------LDIDCRDPKGRTSLLWAAYQ 224
           V  +L F    K L                           DID ++P+   + L+ A +
Sbjct: 480 VSTLLSFMNPEKSLNSPRLLHLATRLNSPSLLNSLLSAKGFDIDYQEPENLETALYVACK 539

Query: 225 GDSLTVAE-LLKFGASIKIADTE-GFTPLHWGTVKGQPHVLKYLIQDGADF 273
            D    AE L+K GA++++ +   G+TP+     +G   +++ L+  GA +
Sbjct: 540 LDIYEAAEYLVKQGANMELGEKLFGWTPIFAAATEGYARIVQLLVDHGAKY 590

 Score = 37.0 bits (84), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%)

Query: 111 TGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPT 170
           T L+ A   +     ++LV QGA++         TP+  AA  GY  IV  L+ HGA   
Sbjct: 532 TALYVACKLDIYEAAEYLVKQGANMELGEKLFGWTPIFAAATEGYARIVQLLVDHGAKYD 591

Query: 171 MTDDQGF 177
           + D+ G+
Sbjct: 592 LFDESGW 598

>KLLA0F26004g complement(2411261..2412271) some similarities with
           sp|Q04749 Saccharomyces cerevisiae YMR068w singleton,
           hypothetical start
          Length = 336

 Score = 36.6 bits (83), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 54/129 (41%), Gaps = 12/129 (9%)

Query: 212 PKGRTSLLWAAYQGDSLTVAELLKFGASI--KIADTEGFTPLHWGTVKGQPHVLKYLIQD 269
           P+ R  L  A  QG    V  +LK    +   I  T G++ LH+    G+  + ++LIQ 
Sbjct: 3   PEPRIRLREAIVQGKLGVVRRILKRWPDLLENIDSTNGWSSLHYAAFYGRYLICRHLIQL 62

Query: 270 GAD--FFQKTDTGKDCFAIA---QEMNTVYSLREALTHSGFDYHGYPIKKWFK-----KS 319
           G D     KT  G  C  +A    +  TV+ L +     G +      ++W       +S
Sbjct: 63  GHDATAMLKTYDGDTCIHLAITKGDEQTVHLLLQHFLEEGLNLRSSSARRWAPIHIACRS 122

Query: 320 QHAKLVTFI 328
            H++ +  +
Sbjct: 123 NHSRCLALL 131

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 71/197 (36%), Gaps = 36/197 (18%)

Query: 76  RYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADV 135
           R   A  +G L  V+ ++  +  ++  + DST   + LH+A+   R  +   L+  G D 
Sbjct: 8   RLREAIVQGKLGVVRRILK-RWPDLLENIDSTNGWSSLHYAAFYGRYLICRHLIQLGHDA 66

Query: 136 NARAGALHA-TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLY 194
            A        T +H A   G    V  LL+H        ++G NL   S           
Sbjct: 67  TAMLKTYDGDTCIHLAITKGDEQTVHLLLQHFL------EEGLNLRSSSAR--------- 111

Query: 195 VLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWG 254
                     + I CR    R              +A LL+ GA + + D EG T LH  
Sbjct: 112 ------RWAPIHIACRSNHSR-------------CLALLLQCGADVTLEDEEGNTGLHVA 152

Query: 255 TVKGQPHVLKYLIQDGA 271
              G    L  L+Q G 
Sbjct: 153 MEYGAIQCLPILLQCGG 169

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 68/189 (35%), Gaps = 41/189 (21%)

Query: 113 LHWASINNRLSVVDFLVSQGADVNARAGALHA-TPLHWAARYGYVYIVDFLLKHGADPTM 171
           L  A +  +L VV  ++ +  D+     + +  + LH+AA YG   I   L++ G D T 
Sbjct: 9   LREAIVQGKLGVVRRILKRWPDLLENIDSTNGWSSLHYAAFYGRYLICRHLIQLGHDATA 68

Query: 172 TDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVA 231
                             ML  Y                   G T +  A  +GD  TV 
Sbjct: 69  ------------------MLKTY------------------DGDTCIHLAITKGDEQTVH 92

Query: 232 ELLKF----GASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIA 287
            LL+     G +++ +    + P+H          L  L+Q GAD   + + G     +A
Sbjct: 93  LLLQHFLEEGLNLRSSSARRWAPIHIACRSNHSRCLALLLQCGADVTLEDEEGNTGLHVA 152

Query: 288 QEMNTVYSL 296
            E   +  L
Sbjct: 153 MEYGAIQCL 161

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 48/111 (43%), Gaps = 6/111 (5%)

Query: 145 TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGL 204
            P+H A R  +   +  LL+ GAD T+ D++G   LH+++    I   L +L       L
Sbjct: 114 APIHIACRSNHSRCLALLLQCGADVTLEDEEGNTGLHVAMEYGAIQ-CLPILLQCGGATL 172

Query: 205 LDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGT 255
                 D + +  ++         T+ +  +F A I+   + G + +  GT
Sbjct: 173 A-----DEQNQMGIVARQVGNCDETIKKFDQFAAEIRKGVSSGSSTVPIGT 218

>AAR063C [249] [Homologous to ScYCR051W - SH] (453099..453761) [663
           bp, 220 aa]
          Length = 220

 Score = 35.8 bits (81), Expect = 0.070,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 3/85 (3%)

Query: 219 LW-AAYQGDSLTVAELLK-FGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQD-GADFFQ 275
           +W AA  G +  V ELL+  GA   + D  G+TP+H     G   +L+ LI +   D   
Sbjct: 3   VWVAASDGLTAQVEELLQQTGADANVKDPNGYTPMHAAAAYGHIDLLRLLIANYRGDVNV 62

Query: 276 KTDTGKDCFAIAQEMNTVYSLREAL 300
           + + G      A+++ TV  L E L
Sbjct: 63  RDNDGDTPLHHAEDLQTVRVLVEEL 87

 Score = 32.7 bits (73), Expect = 0.72,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 62/125 (49%), Gaps = 14/125 (11%)

Query: 115 WASINNRLS--VVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLL-KHGADPTM 171
           W + ++ L+  V + L   GAD N +    + TP+H AA YG++ ++  L+  +  D  +
Sbjct: 4   WVAASDGLTAQVEELLQQTGADANVKDPNGY-TPMHAAAAYGHIDLLRLLIANYRGDVNV 62

Query: 172 TDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVA 231
            D+ G   LH + +   + +++  L       LL+ D     G T L  A Y+ D+   A
Sbjct: 63  RDNDGDTPLHHAEDLQTVRVLVEELG--ADPSLLNAD-----GNTPL--AVYEDDAEN-A 112

Query: 232 ELLKF 236
           EL+++
Sbjct: 113 ELIEY 117

>YPL110C (YPL110C) [5334] chr16 complement(341067..344738) Member of
           the glycerophosphoryl diester phosphodiesterase family,
           contains six ankyrin (Ank) repeats and a SYG1, Pho81 and
           XPR1 (SPX) N-terminal domain, has weak similarity to S.
           cerevisiae Pho81p, which is a cyclin-dependent kinase
           (CDK) inhibitor [3672 bp, 1223 aa]
          Length = 1223

 Score = 36.6 bits (83), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 59/151 (39%), Gaps = 38/151 (25%)

Query: 113 LHWASINNRLSVVDFLVSQGA-DVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTM 171
           LH A+  N   ++  L+S    D+N +   LH TPL+ A R  +      LL +GAD  +
Sbjct: 508 LHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEI 567

Query: 172 TDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVA 231
            +                      LF                G T++  AA +G +  V 
Sbjct: 568 REK---------------------LF----------------GWTAIFVAAAEGFTDIVK 590

Query: 232 ELLKFGASIKIADTEGFTPLHWGTVKGQPHV 262
            L+   A+  I D  G+TP+    ++G  H+
Sbjct: 591 LLIANNANFDIEDEGGWTPMEHAVLRGHLHI 621

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 66/153 (43%), Gaps = 30/153 (19%)

Query: 134 DVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVL 193
           DV+A   A   TPLH      +    + LL+   DP +   +  +LLHL+   +N  L L
Sbjct: 464 DVSAFGDAESLTPLHLCVLGAHPKTTEVLLQ-SLDPNVKL-KSSSLLHLATEWNNYPL-L 520

Query: 194 YVLFNVVSKGLLDIDCRDPKGRTSLLWAA-------------YQGDSLTVAELLKFGASI 240
           +VL   +S    DI+ +D +   + L+ A             Y G  L + E L    +I
Sbjct: 521 HVL---LSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAI 577

Query: 241 KIADTEGFTPLHWGTVKGQPHVLKYLIQDGADF 273
            +A  EGFT            ++K LI + A+F
Sbjct: 578 FVAAAEGFT-----------DIVKLLIANNANF 599

>ABR203W [797] [Homologous to ScYDR459C - SH]
           complement(782702..783781) [1080 bp, 359 aa]
          Length = 359

 Score = 36.2 bits (82), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 52/116 (44%), Gaps = 17/116 (14%)

Query: 434 GQLVIMDPG---------CLPEETDH-ENVRQTISNLL---EIGKFDTKNF---CIETWI 477
            Q+++M PG          LPE  D  E  ++  +  +   ++ + DT+ +   C     
Sbjct: 68  AQIIMMGPGRQPRVAPFMILPEMADAGERAKEGAATSVLPPDVYQCDTQGYPVWCSVCQS 127

Query: 478 RKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAF-IFFITLMESGIFTFLAL 532
            K LR+  S      V R DHYC W+   +G +N++ F  F +  +   +  F+++
Sbjct: 128 LKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLMCFLMHALIIFVSV 183

>Kwal_27.12751
          Length = 1093

 Score = 36.6 bits (83), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 53/113 (46%), Gaps = 2/113 (1%)

Query: 67  EAEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINN-RLSVV 125
           E    P  +  + AC   +    + ++    +++++  DS   +  LH  + N     ++
Sbjct: 467 EVSSRPQFSPLNVACAHKNYEAAQLVLKYSNIDLSSVRDS-HGLCPLHIVAKNGGDAKMI 525

Query: 126 DFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFN 178
           + L+  GAD N   G    TP+ +A + G+   V+ LLK+GA   +TD+   +
Sbjct: 526 ELLIKHGADPNGVDGFNGWTPVFYAVQEGHRNTVEELLKNGARLDITDEDNLS 578

>YMR068W (AVO2) [4027] chr13 (406303..407583) Component of the TOR
           complex 2 (Tor2p-Lst8p-Kog1p-Avo1p-Avo2p-Tsc11p), which
           is involved in signaling to the actin cytoskeleton [1281
           bp, 426 aa]
          Length = 426

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 71/161 (44%), Gaps = 7/161 (4%)

Query: 113 LHWASINNRLSVVDFLVSQGADVNARAGALHA-TPLHWAARYGYVYIVDFLLKHGADP-- 169
           L  A I   L +V  L+ +  D+     + +  + LH+A+ +G   I  +L++ G D   
Sbjct: 9   LREAIIEGNLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHE 68

Query: 170 TMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLT 229
            +   +G   +HL++   +    L++L     +    I+ R   GR  +  A        
Sbjct: 69  LIKTFKGNTCVHLALMKGHEQ-TLHLLLQQFPRF---INHRGENGRAPIHIACMNDYYQC 124

Query: 230 VAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDG 270
           ++ L+  GA + + DT G TPLH     G    +K L+ +G
Sbjct: 125 LSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEG 165

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 4/74 (5%)

Query: 218 LLWAAYQGDSLTVAELLKFGASI--KIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQ 275
           L  A  +G+ L V  LL+    +   I    G++ LH+ +  G+  +  YLIQ G D  +
Sbjct: 9   LREAIIEGNLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHE 68

Query: 276 --KTDTGKDCFAIA 287
             KT  G  C  +A
Sbjct: 69  LIKTFKGNTCVHLA 82

>KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA
           Kluyveromyces lactis Transcription factor MBP1 (MBF
           subunit P120), start by similarity
          Length = 754

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 60/143 (41%), Gaps = 14/143 (9%)

Query: 143 HATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFN-LLHLSVNSSNIMLVLY-VLFNVV 200
           H T  HWA   G + IV+ LLK G+     ++ G   L+  S+  +      Y  +F ++
Sbjct: 376 HHTAFHWACAMGTLPIVEALLKAGSSIRSLNNVGETPLIRSSIFHNCYTKRTYPQIFEIL 435

Query: 201 SKGLLDIDCRDPK------GRTSLLWAAYQGDSLTVAELLKFGASIKI------ADTEGF 248
              + D+D +          R S   +A     + ++++  F    +I       D +G 
Sbjct: 436 KDTVFDLDAKSRNVIHRIVSRKSHTPSAVYYLDVVLSKIKDFTPQYRIDVLINQQDNDGN 495

Query: 249 TPLHWGTVKGQPHVLKYLIQDGA 271
           +PLH+          + L+Q+GA
Sbjct: 496 SPLHYAATNKDDQFYQLLLQNGA 518

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 68/161 (42%), Gaps = 23/161 (14%)

Query: 108 EHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAA-------RYGYVYIVD 160
           EH T  HWA     L +V+ L+  G+ + +    +  TPL  ++       +  Y  I +
Sbjct: 375 EHHTAFHWACAMGTLPIVEALLKAGSSIRS-LNNVGETPLIRSSIFHNCYTKRTYPQIFE 433

Query: 161 FLLKHGADPTMTDDQGFNLLHLSVN-SSNIMLVLYVLFNVVSKGLLD----------IDC 209
            L     D    D +  N++H  V+  S+    +Y L  V+SK + D          I+ 
Sbjct: 434 ILKDTVFD---LDAKSRNVIHRIVSRKSHTPSAVYYLDVVLSK-IKDFTPQYRIDVLINQ 489

Query: 210 RDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTP 250
           +D  G + L +AA   D      LL+ GA   + +  G TP
Sbjct: 490 QDNDGNSPLHYAATNKDDQFYQLLLQNGALTTVQNNSGMTP 530

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%)

Query: 211 DPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTV 256
           DP+  T+  WA   G    V  LLK G+SI+  +  G TPL   ++
Sbjct: 373 DPEHHTAFHWACAMGTLPIVEALLKAGSSIRSLNNVGETPLIRSSI 418

>Scas_649.8
          Length = 373

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 1/85 (1%)

Query: 113 LHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMT 172
           +H A +N        L+          G    +PLH A  + Y   ++ L+  GAD  + 
Sbjct: 77  IHLALLNGHEQTTHLLLQYFPQFINDKGERGKSPLHIACMFDYDRCLNLLIGLGADINVI 136

Query: 173 DDQGFNLLHLSVNSSNIMLVLYVLF 197
           DD G  ++HL +  S++   ++VL 
Sbjct: 137 DDNGDGVMHLCLQYSSLK-CMHVLI 160

>CAGL0B01166g 103561..105987 similar to sp|P09959 Saccharomyces
           cerevisiae YLR182w SWI6 transcription factor,
           hypothetical start
          Length = 808

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 145 TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNI 189
           T L+ AAR G V I+D LL +GADP +++  G   +     +S +
Sbjct: 482 TCLNIAARLGNVSIIDALLDYGADPVISNKSGLRPVDFGAGTSKL 526

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 145 TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSN 188
           TPLHW      + +V  L+KHGA   + D+ G + L  +V S N
Sbjct: 345 TPLHWLTSIANIDLVKELVKHGASRLLGDNAGESALVKAVKSVN 388

>KLLA0C01826g 144307..146532 gi|730856|sp|P40418|SWI6_KLULA
           Kluyveromyces lactis Regulatory protein SWI6 (Cell-cycle
           box factor, chain SWI6) (Trans-acting activator of HO
           endonuclease gene) (MBF subunit P90), start by
           similarity
          Length = 741

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 207 IDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWG 254
           ++ RD  G T L  AA  G+   V  LL +GA   IA+  G  P+ +G
Sbjct: 416 LNARDSNGDTCLNIAARLGNVAIVEALLDYGADPNIANNSGLCPVDFG 463

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%)

Query: 145 TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGF 177
           T L+ AAR G V IV+ LL +GADP + ++ G 
Sbjct: 425 TCLNIAARLGNVAIVEALLDYGADPNIANNSGL 457

>Scas_693.32
          Length = 329

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 54/123 (43%), Gaps = 14/123 (11%)

Query: 415 EQYTNILMLVI----LVSVFYLFGQLVIMDPGCLPEETDHENVRQTISNLLEIGKFDTKN 470
           E+Y  I +++I    +  VF +F +     P    + +D  +      NL+    F  + 
Sbjct: 85  EKYMWIPLIIIASPLIFGVFTMFTK-----PTYTKKYSDEIDNEYAFDNLI----FYPQI 135

Query: 471 FCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAF-IFFITLMESGIFTF 529
            C      KP RSK   + +  V   DH+C W+ N VG  N+  F +F IT   S  + F
Sbjct: 136 LCRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFLITNTFSLTYAF 195

Query: 530 LAL 532
           + L
Sbjct: 196 IRL 198

>Scas_587.4
          Length = 751

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 25/43 (58%)

Query: 145 TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSS 187
           T L+ AAR G V IVD LL++GADP + +  G   L     +S
Sbjct: 412 TCLNIAARLGNVGIVDALLEYGADPYIANKSGLRPLDFGAGTS 454

>KLLA0C09108g complement(795433..796059) similar to sp|P25631
           Saccharomyces cerevisiae YCR051w singleton, start by
           similarity
          Length = 208

 Score = 34.3 bits (77), Expect = 0.22,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 219 LW-AAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQD 269
           +W AA  G++  V + +K G +    D  G+TP+H     G   +LK L+Q+
Sbjct: 3   IWIAASNGETELVEKFIKQGQTANDKDENGYTPIHAAAAYGHIDLLKKLVQE 54

 Score = 30.0 bits (66), Expect = 5.9,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 2/67 (2%)

Query: 116 ASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLK-HGADPTMTDD 174
           A+ N    +V+  + QG   N +    + TP+H AA YG++ ++  L++ H  D  + D 
Sbjct: 6   AASNGETELVEKFIKQGQTANDKDENGY-TPIHAAAAYGHIDLLKKLVQEHNGDVNIKDS 64

Query: 175 QGFNLLH 181
                LH
Sbjct: 65  DNDTPLH 71

>AGR065W [4375] [Homologous to ScYDR126W (PSL10) - SH]
           complement(835877..836857) [981 bp, 326 aa]
          Length = 326

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 472 CIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITL 521
           C    +RKP RS+   +    V   DH+C W+ N VG  N+   +F++ L
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYG--LFYLAL 173

>Scas_713.9
          Length = 1208

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 24/40 (60%)

Query: 195 VLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELL 234
           V + V  KGLLDI+ +D  G T L  AAYQ  +  VA L+
Sbjct: 86  VKYYVDEKGLLDINQKDANGNTPLHLAAYQSRTDAVAYLM 125

>Scas_685.12
          Length = 1131

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 5/88 (5%)

Query: 162 LLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWA 221
           +L   A+ +M DD+G  LLHL+      +   + L +++ +  + ++ RD  G T+L +A
Sbjct: 752 MLDSRANISMCDDRGRTLLHLAS-----LKRYFNLCSILIRSGIRVNDRDAFGFTALHFA 806

Query: 222 AYQGDSLTVAELLKFGASIKIADTEGFT 249
              GD+  +  LL     I    T G T
Sbjct: 807 CISGDARIIRLLLSCKVDIGAIATNGVT 834

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 46/102 (45%), Gaps = 2/102 (1%)

Query: 206 DIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKY 265
           +I   D +GRT L  A+ +      + L++ G  +   D  GFT LH+  + G   +++ 
Sbjct: 758 NISMCDDRGRTLLHLASLKRYFNLCSILIRSGIRVNDRDAFGFTALHFACISGDARIIRL 817

Query: 266 LIQDGADFFQKTDTGKDCFAIAQEMNTVYSLREALTHSGFDY 307
           L+    D       G     +  + N V++  E LT+S  +Y
Sbjct: 818 LLSCKVDIGAIATNGVTARQLFMK-NHVHTSHE-LTNSSLEY 857

>KLLA0D06149g 527705..528754 similar to sgd|S0002867 Saccharomyces
           cerevisiae YDR459c, start by similarity
          Length = 349

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 482 RSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFF 518
           R+  S      V RFDHYC WI   +G  N+K F+ F
Sbjct: 138 RTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQF 174

>YLR182W (SWI6) [3586] chr12 (517942..520353) Transcription factor
           that participates in the SBF complex (Swi4p-Swi6p) for
           regulation at the cell cycle box (CCB) and in the MBF
           complex (Mbp1p-Swi6p) for regulation at the Mlu1 cell
           cycle box (MCB) [2412 bp, 803 aa]
          Length = 803

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 145 TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGF 177
           T L+ AAR G + IVD LL +GADP + +  G 
Sbjct: 472 TCLNIAARLGNISIVDALLDYGADPFIANKSGL 504

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%)

Query: 244 DTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIA 287
           D  G TPLHW T      ++K+L++ G++     + G+ C   A
Sbjct: 315 DEHGNTPLHWLTSIANLELVKHLVKHGSNRLYGDNMGESCLVKA 358

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%)

Query: 145 TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSN 188
           TPLHW      + +V  L+KHG++    D+ G + L  +V S N
Sbjct: 320 TPLHWLTSIANLELVKHLVKHGSNRLYGDNMGESCLVKAVKSVN 363

>KLLA0F19690g 1820355..1821329 weakly similar to sp|Q04629
           Saccharomyces cerevisiae YDR126w, start by similarity
          Length = 324

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 477 IRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519
           I+ P RSK  P+    +   DH+C WI N VG  N++ F  F+
Sbjct: 135 IKVP-RSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFL 176

>Kwal_33.13259
          Length = 664

 Score = 33.5 bits (75), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%)

Query: 145 TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGF 177
           T L+ A+R G V IV+ LL +GADP ++++ G 
Sbjct: 360 TCLNIASRLGNVSIVEALLDYGADPRISNNSGL 392

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%)

Query: 207 IDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGT 255
           ++ RD  G T L  A+  G+   V  LL +GA  +I++  G  P+ +G 
Sbjct: 351 LNARDINGDTCLNIASRLGNVSIVEALLDYGADPRISNNSGLRPMDFGA 399

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%)

Query: 145 TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSN 188
           TPLHW      V +   L++ GAD  + D  G + L  +V S N
Sbjct: 223 TPLHWLCSIANVNLTKDLIRSGADRLLGDTSGESPLVKAVKSVN 266

>Sklu_2055.3 YDL056W, Contig c2055 5141-7372
          Length = 743

 Score = 33.5 bits (75), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%)

Query: 211 DPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTV 256
           DP+G T+  WA   G+      L   GAS +  +T G TPL   ++
Sbjct: 353 DPEGHTAFHWACAMGNIAIAEALYNVGASTRSVNTLGETPLMRSSI 398

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 60/156 (38%), Gaps = 21/156 (13%)

Query: 111 TGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAA-------RYGYVYIVDFLL 163
           T  HWA     +++ + L + GA   +    L  TPL  ++       +  Y  I   L 
Sbjct: 358 TAFHWACAMGNIAIAEALYNVGASTRS-VNTLGETPLMRSSIFHNSYTKRTYPKICHLLQ 416

Query: 164 KHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLD----------IDCRDPK 213
               D    D Q   ++H  V   +         +V+   + D          I+ +D +
Sbjct: 417 DTTYD---VDSQLQTVIHHIVRRKSSTPSAVYYLDVLLSKIKDFSPQYRIESLINAQDQR 473

Query: 214 GRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFT 249
           G T+L  AA+  D +    LL+ GA   I + EG T
Sbjct: 474 GNTALHVAAFNDDRIFFNTLLEHGALSTIKNNEGTT 509

>KLLA0F00660g 54232..58356 similar to sgd|S0006031 Saccharomyces
           cerevisiae YPL110c, start by similarity
          Length = 1374

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 79/178 (44%), Gaps = 42/178 (23%)

Query: 145 TPLHWAARYGYV----YIVDFLLKHGA-------DPTMT--DDQGFNLLHLSVNSSNIML 191
           TPLH++A+YG V     I++ L++ GA       D      D +G   +HL+V  ++ + 
Sbjct: 462 TPLHYSAQYGLVETSRIIIESLIEWGAWNADIPIDDVHVWGDSEGLTPIHLAVIGTHPLT 521

Query: 192 V------------------LYVLFNVVSKGLL---------DIDCRDPKGRTSLLWAAYQ 224
           V                  L++   + S  L+         DI+ RD     + L+ A +
Sbjct: 522 VRILTSHLGPDTKLNTPRLLHLATRLNSPDLIDALLSVPGFDINYRDLDHLETALYLACK 581

Query: 225 GDSLTVAE-LLKFGASIKIADTE-GFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTG 280
            +    AE LL  GA ++I +   G+TP+     +G   ++K L + GA++    ++G
Sbjct: 582 LNLREAAEHLLNRGADMEIGEKLFGWTPIFVAATEGFTDLVKVLKEHGANYDALDESG 639

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%)

Query: 111 TGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPT 170
           T L+ A   N     + L+++GAD+         TP+  AA  G+  +V  L +HGA+  
Sbjct: 574 TALYLACKLNLREAAEHLLNRGADMEIGEKLFGWTPIFVAATEGFTDLVKVLKEHGANYD 633

Query: 171 MTDDQGFN 178
             D+ G++
Sbjct: 634 ALDESGWS 641

>YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcription
           factor that is a component of the SBF (Swi4p-Swi6p)
           complex that regulates expression at promoters
           containing the cell cycle box (CCB) element, contains
           two ankyrin repeats [3282 bp, 1093 aa]
          Length = 1093

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 20/42 (47%)

Query: 244 DTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFA 285
           D +G TPLHW T      ++K LI   A+  Q    G +C  
Sbjct: 518 DDQGHTPLHWATAMANIPLIKMLITLNANALQCNKLGFNCIT 559

>YDL056W (MBP1) [809] chr4 (352877..355378) Transcription factor
           that collaborates with Swi6p to form the MBF
           (Mbp1p-Swi6p) factor for regulation at Mlu1 cell cycle
           box (MCB) elements, has two ankyrin repeats [2502 bp,
           833 aa]
          Length = 833

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 59/156 (37%), Gaps = 21/156 (13%)

Query: 111 TGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAA-------RYGYVYIVDFLL 163
           T  HWA     L + + L   G  + +   +   TPL  ++       R  +  I   L 
Sbjct: 397 TAFHWACSMGNLPIAEALYEAGTSIRS-TNSQGQTPLMRSSLFHNSYTRRTFPRIFQLLH 455

Query: 164 KHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLD----------IDCRDPK 213
           +   D    D Q   ++H  V   +         +VV   + D          ++ +D  
Sbjct: 456 ETVFD---IDSQSQTVIHHIVKRKSTTPSAVYYLDVVLSKIKDFSPQYRIELLLNTQDKN 512

Query: 214 GRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFT 249
           G T+L  A+  GD +    L+K GA   I++ EG T
Sbjct: 513 GDTALHIASKNGDVVFFNTLVKMGALTTISNKEGLT 548

>AGL297C [4015] [Homologous to ScYER111C (SWI4) - SH]
           (147990..150902) [2913 bp, 970 aa]
          Length = 970

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 132 GADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSV 184
           G DVN        T LHWAA    + ++  LL   AD    +D+GFN +  S+
Sbjct: 438 GLDVNFIIDKQGHTSLHWAAAMANIPLIKILLTLEADIFHCNDKGFNCITKSI 490

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 23/53 (43%)

Query: 242 IADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVY 294
           I D +G T LHW        ++K L+   AD F   D G +C   +   N  Y
Sbjct: 444 IIDKQGHTSLHWAAAMANIPLIKILLTLEADIFHCNDKGFNCITKSIFYNNCY 496

>YPL239W (YAR1) [5211] chr16 (99484..100086) Protein with 2 ankyrin
           repeats [603 bp, 200 aa]
          Length = 200

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 34/77 (44%), Gaps = 19/77 (24%)

Query: 67  EAEEDPLLTRYHTACQRGDLATVK------------EMIHGKLLEVNNDGDSTEHITGLH 114
           E+E D   T  H A   G + TV+            E +   + EVN  G+     T LH
Sbjct: 46  ESESDS--TALHMAAANGHIETVRYILETVSRANSAEDLKAFVNEVNKTGN-----TALH 98

Query: 115 WASINNRLSVVDFLVSQ 131
           WAS+N +L VV  L  +
Sbjct: 99  WASLNGKLDVVKLLCDE 115

>Scas_717.62
          Length = 374

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 5/51 (9%)

Query: 482 RSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITLMESGIFTFLAL 532
           RS  S      + RFDHYC WI   +   N++ F+ ++     G F  L L
Sbjct: 128 RSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLFLQYV-----GWFNLLLL 173

>KLLA0E20867g complement(1852522..1855323) weakly similar to
           sp|P25302 Saccharomyces cerevisiae YER111c SWI4
           transcription factor, start by similarity
          Length = 933

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%)

Query: 145 TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSV 184
           T LHWA     + ++  LL   AD    +D+GFN L  SV
Sbjct: 471 TSLHWAVAMSNIPLIRVLLVQDADLLRCNDKGFNCLTKSV 510

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 23/53 (43%)

Query: 242 IADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVY 294
           + D +G T LHW        +++ L+   AD  +  D G +C   +   N  Y
Sbjct: 464 LIDDQGHTSLHWAVAMSNIPLIRVLLVQDADLLRCNDKGFNCLTKSVFYNNCY 516

>Scas_458.3
          Length = 198

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 64/147 (43%), Gaps = 22/147 (14%)

Query: 151 ARYGYVYIVDFLLKHGADPTM-----TDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLL 205
           AR+G +  +  +     DP++      +D G   LH++  + +IM+V Y+L       L 
Sbjct: 20  ARHGEIGSLREIFTTLIDPSLLPTCRDEDTGTTALHMAAGNGHIMVVQYLL-----SLLP 74

Query: 206 DIDCR-------DPKGRTSLLWAAYQGDSLTVAELL--KFGASIKIADTEGFTPLHWGTV 256
           D D R       +  G T+L WA+  G  L V +LL  ++ A   I +  G   +     
Sbjct: 75  DEDDRKEYVNAVNNTGNTALHWASLNG-KLDVVKLLCDEYDADPFIRNQFGHDAIFEAEN 133

Query: 257 KGQPHVLKYLIQ--DGADFFQKTDTGK 281
            G+  V  Y ++  D     ++ D GK
Sbjct: 134 NGREEVETYFLKKYDVEPENEEEDNGK 160

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 5/32 (15%)

Query: 100 VNNDGDSTEHITGLHWASINNRLSVVDFLVSQ 131
           VNN G+     T LHWAS+N +L VV  L  +
Sbjct: 86  VNNTGN-----TALHWASLNGKLDVVKLLCDE 112

>Sklu_2439.8 YMR068W, Contig c2439 8208-9653 reverse complement
          Length = 481

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 64/163 (39%), Gaps = 41/163 (25%)

Query: 70  EDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLV 129
           +DP + R   A   G+L  VK ++  +  ++  + D +   + LH+AS + R  V  FL+
Sbjct: 3   QDPSI-RLRNAITEGNLLIVKRLLK-RFPDLLTNIDPSNGWSSLHYASYHGRYLVCVFLI 60

Query: 130 SQGADVNARAGALHA-TPLHWAARYGYVYIVDFLLKH----------------------- 165
             G D +         T +H A   G+      LL+H                       
Sbjct: 61  QLGHDRDEILRTFKGNTSVHLALLNGHEQTTHLLLQHFPRCLNTGGHHGMTPAQVSCCHD 120

Query: 166 -----------GADPTMTDDQGFNLLHLSVNSSNI----MLVL 193
                      GA+ T+TDD G   LH+S+   ++    MLVL
Sbjct: 121 HYQCLSLLMSIGANLTLTDDYGDTALHISLKFGSVNCTKMLVL 163

>Scas_510.2
          Length = 1043

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 23/51 (45%)

Query: 244 DTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVY 294
           D +G TPLHW T      ++K LI   A+  Q    G +C   +   N  Y
Sbjct: 522 DEQGHTPLHWATAMANVPLIKLLIILNANALQCNSLGFNCVTKSVFYNNCY 572

>YAR042W (SWH1) [83] chr1 (192615..196181) Protein implicated in
           ergosterol biosynthesis, member of the yeast OSBP family
           of putative oxysterol-binding proteins [3567 bp, 1188
           aa]
          Length = 1188

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 107/288 (37%), Gaps = 77/288 (26%)

Query: 78  HTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNA 137
           H A Q   +A +KE++H                   HW S  N   +   L     D+N 
Sbjct: 57  HYAVQVAPMAVIKEIVH-------------------HWVSTTNTTFLNIHL-----DLNE 92

Query: 138 RAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHL-------SVNSSNIM 190
           R    + TPLH AA      IV FLL     PT+ +D   N  HL       ++N + +M
Sbjct: 93  RDSNGN-TPLHIAAYQSRGDIVAFLLDQ---PTI-NDCVLNNSHLQAIEMCKNLNIAQMM 147

Query: 191 LVLYVLF--NVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTE-G 247
            V    +      +     + RD     S+L       S   AELL     I   D E G
Sbjct: 148 QVKRSTYVAETAQEFRTAFNNRDFGHLESIL------SSPRNAELL----DINGMDPETG 197

Query: 248 FTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMN---TVYSLREALT--- 301
            T LH    K    + ++L++ GAD F++   GK    + +++N   T  S + A+    
Sbjct: 198 DTVLHEFVKKRDVIMCRWLLEHGADPFKRDRKGKLPIELVRKVNENDTATSTKIAIDIEL 257

Query: 302 ---------------------HSGFDYHGYPIKKWFKKSQHAKLVTFI 328
                                H    Y GY +KKW   +Q  KL  FI
Sbjct: 258 KKLLERATREQSVIDVTNNNLHEAPTYKGY-LKKWTNFAQGYKLRWFI 304

>CAGL0C03003g 297244..297864 similar to sp|P25631 Saccharomyces
           cerevisiae YCR051w, hypothetical start
          Length = 206

 Score = 31.2 bits (69), Expect = 2.0,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 2/67 (2%)

Query: 116 ASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLK-HGADPTMTDD 174
           A+ + R  +V+  ++ G   N++    + TP+H AA YG++ ++  L + HG D  + D 
Sbjct: 6   AASDGRGDIVEKFLADGLSANSKDPNGY-TPVHAAAAYGHLDLLRKLCQEHGGDINVRDS 64

Query: 175 QGFNLLH 181
            G   LH
Sbjct: 65  DGDTPLH 71

>CAGL0J09306g 915641..916849 highly similar to tr|Q99385
           Saccharomyces cerevisiae YDL128w VCX1, start by
           similarity
          Length = 402

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 163 LKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKG 203
           L HG +  + DD+   +LHLS  +S I+L++YVLF V   G
Sbjct: 179 LPHGKEDWIVDDK---ILHLSRGTSLILLMIYVLFLVFQLG 216

>AFR690C [3883] [Homologous to ScYLR182W (SWI6) - SH]
           (1712445..1714547) [2103 bp, 700 aa]
          Length = 700

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 145 TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFN 178
           T L+ A+R G V IV+ LL +GADP + +  G  
Sbjct: 377 TCLNIASRLGNVSIVEALLDYGADPYIANSSGLR 410

>Kwal_14.982
          Length = 416

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 57/131 (43%), Gaps = 18/131 (13%)

Query: 147 LHWAARYGY----VYIVDFLLKHGADPTMTDDQGFNLLHLSV----NSSNIMLVLYVLFN 198
           LH+A+ +G     VY+V   L HG    +   QG   +HL++      +  +L+ +  + 
Sbjct: 44  LHYASYHGRYLTCVYLVQ--LGHGKKEILRTFQGNTCVHLALLNGHEQTAHLLLQHFPYC 101

Query: 199 VVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKG 258
           +  KG          GRT +           ++ LL  GA + + D  G T LH   + G
Sbjct: 102 LNIKGHY--------GRTPVQMTCQYDHYQCLSLLLGLGADLSVRDEFGNTALHICLIYG 153

Query: 259 QPHVLKYLIQD 269
             + ++ L+++
Sbjct: 154 SENCMRMLVRE 164

>CAGL0A04565g 445883..449008 similar to sp|P25302 Saccharomyces
           cerevisiae YER111c SWI4, start by similarity
          Length = 1041

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 21/40 (52%)

Query: 145 TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSV 184
           TPLHW A    + +V  L+   A+    + QGFN +  +V
Sbjct: 485 TPLHWTAAMANIPLVKLLIGLNANALHCNSQGFNCITKAV 524

>Kwal_56.23638
          Length = 4922

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 13/61 (21%)

Query: 10   RASTLTNEEQTVDPSNNDSQEDISL--GDSNEITSLASLKAIRSGNEEESGNEQVNHNDE 67
            +A   + E+Q+ D   N +++D+    GD +E           SG+++E   EQ NH+DE
Sbjct: 4166 QAEDSSKEKQSDDAPQNSAEDDVKAAEGDRDE-----------SGSKDEDQKEQPNHDDE 4214

Query: 68   A 68
            A
Sbjct: 4215 A 4215

>KLLA0D08910g 750828..751448 similar to sp|P46683 Saccharomyces
           cerevisiae YPL239w YAR1 ankyrin repeat-containing
           protein singleton, start by similarity
          Length = 206

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 5/58 (8%)

Query: 78  HTACQRGDLATVKEMI----HGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQ 131
           H A   G    VK ++      KL E  N  + T + T LHWAS+N +L +V  L  +
Sbjct: 55  HMAAANGHFEVVKYLLSIFPKDKLKEWVNKQNETGN-TALHWASLNGKLDIVQLLCEE 111

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 56/127 (44%), Gaps = 14/127 (11%)

Query: 81  CQRGDLATVKEMIH-----GKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVS----- 130
            + GDL ++K++         L+E     D     + LH A+ N    VV +L+S     
Sbjct: 20  ARAGDLESLKDIFTTLIDPSALIECT---DELSKSSALHMAAANGHFEVVKYLLSIFPKD 76

Query: 131 QGADVNARAGALHATPLHWAARYGYVYIVDFLL-KHGADPTMTDDQGFNLLHLSVNSSNI 189
           +  +   +      T LHWA+  G + IV  L  ++ ADP + ++   + ++ + N+   
Sbjct: 77  KLKEWVNKQNETGNTALHWASLNGKLDIVQLLCEEYEADPFIRNNFDHDAIYEAENNGQE 136

Query: 190 MLVLYVL 196
            +  Y L
Sbjct: 137 EIETYYL 143

>AER188C [2690] [Homologous to ScYFR019W (FAB1) - SH]
           (986526..993050) [6525 bp, 2174 aa]
          Length = 2174

 Score = 30.0 bits (66), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 3/63 (4%)

Query: 230 VAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQE 289
           +A      +S+  + +  F    + T KGQP     L     D++ K ++ K+CFA  + 
Sbjct: 142 IASTKSVSSSLTASFSRNFLYGFYNTKKGQPRNRAIL---SKDYWMKDESAKECFACTKT 198

Query: 290 MNT 292
            NT
Sbjct: 199 FNT 201

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,625,537
Number of extensions: 1156597
Number of successful extensions: 4114
Number of sequences better than 10.0: 139
Number of HSP's gapped: 4084
Number of HSP's successfully gapped: 228
Length of query: 750
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 641
Effective length of database: 12,822,747
Effective search space: 8219380827
Effective search space used: 8219380827
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)