Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR097C (MSH6)1242122061970.0
Scas_636.17118499039820.0
CAGL0G08129g121696737710.0
Kwal_56.234451329114536550.0
KLLA0C17732g119499035840.0
AGR116W116795534820.0
KLLA0C18590g10299166268e-67
CAGL0E00473g10255996091e-64
Sklu_2128.210609196039e-64
ADR168C10329815886e-62
Kwal_23.646610379325861e-61
CAGL0I07733g9577895563e-58
YCR092C (MSH3)10479105557e-58
Kwal_56.226139568415521e-57
Scas_628.39597955521e-57
YOL090W (MSH2)9648275182e-53
KLLA0F02706g9565615082e-52
AFR603C9566004976e-51
Scas_720.10210386014907e-50
KLLA0F24156g9409364102e-40
Scas_544.28746103807e-37
KLLA0F11022g8887093423e-32
Sklu_1903.38997243316e-31
ABR137W9552043309e-31
YFL003C (MSH4)8786873253e-30
KLLA0C16423g9346053219e-30
YHR120W (MSH1)9592123211e-29
Scas_697.279482123131e-28
CAGL0I03586g8672403093e-28
Kwal_33.147389632053066e-28
CAGL0L13002g9492063041e-27
Scas_707.288815313031e-27
CAGL0F02167g8951552889e-26
YDL154W (MSH5)9012242753e-24
CAGL0K00869g11292740.35
ACL004W1377116780.68
YER034W18547668.4
ACR244C300114678.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR097C
         (1220 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR097C (MSH6) [947] chr4 complement(640103..643831) Component w...  2391   0.0  
Scas_636.17                                                          1538   0.0  
CAGL0G08129g complement(770779..774429) similar to sp|Q03834 Sac...  1457   0.0  
Kwal_56.23445                                                        1412   0.0  
KLLA0C17732g complement(1572115..1575699) similar to sp|Q03834 S...  1385   0.0  
AGR116W [4427] [Homologous to ScYDR097C (MSH6) - SH] complement(...  1345   0.0  
KLLA0C18590g complement(1642291..1645380) similar to sp|P25336 S...   245   8e-67
CAGL0E00473g 44001..47078 similar to sp|P25336 Saccharomyces cer...   239   1e-64
Sklu_2128.2 YCR092C, Contig c2128 573-3755 reverse complement         236   9e-64
ADR168C [1910] [Homologous to ScYCR092C (MSH3) - SH] (997371..10...   231   6e-62
Kwal_23.6466                                                          230   1e-61
CAGL0I07733g 742340..745213 highly similar to sp|P25847 Saccharo...   218   3e-58
YCR092C (MSH3) [615] chr3 complement(276760..279903) Component o...   218   7e-58
Kwal_56.22613                                                         217   1e-57
Scas_628.3                                                            217   1e-57
YOL090W (MSH2) [4730] chr15 (147381..150275) Component with Msh3...   204   2e-53
KLLA0F02706g 245783..248653 gi|14348673|gb|AAK61336.1|AF332582_1...   200   2e-52
AFR603C [3795] [Homologous to ScYOL090W (MSH2) - SH] (1524851..1...   196   6e-51
Scas_720.102                                                          193   7e-50
KLLA0F24156g 2251454..2254276 similar to sp|P25846 Saccharomyces...   162   2e-40
Scas_544.2                                                            150   7e-37
KLLA0F11022g complement(1016214..1018880) similar to sp|P40965 S...   136   3e-32
Sklu_1903.3 YFL003C, Contig c1903 4902-7601                           132   6e-31
ABR137W [729] [Homologous to ScYHR120W (MSH1) - SH] complement(6...   131   9e-31
YFL003C (MSH4) [1678] chr6 complement(134516..137152) Meiosis-sp...   129   3e-30
KLLA0C16423g complement(1437001..1439805) similar to sp|Q12175 S...   128   9e-30
YHR120W (MSH1) [2408] chr8 (349576..352455) Protein involved in ...   128   1e-29
Scas_697.27                                                           125   1e-28
CAGL0I03586g 303943..306546 similar to sp|Q12175 Saccharomyces c...   123   3e-28
Kwal_33.14738                                                         122   6e-28
CAGL0L13002g 1388045..1390894 similar to sp|P25846 Saccharomyces...   121   1e-27
Scas_707.28                                                           121   1e-27
CAGL0F02167g complement(216080..218767) similar to sp|P40965 Sac...   115   9e-26
YDL154W (MSH5) [716] chr4 (178335..181040) Meiosis-specific prot...   110   3e-24
CAGL0K00869g complement(88607..88945) weakly similar to sp|P4293...    33   0.35 
ACL004W [1045] [Homologous to ScYOL004W (SIN3) - SH] complement(...    35   0.68 
YER034W (YER034W) [1459] chr5 (221845..222402) Protein of unknow...    30   8.4  
ACR244C [1291] [Homologous to ScYKR062W (TFA2) - SH] (789953..79...    30   8.9  

>YDR097C (MSH6) [947] chr4 complement(640103..643831) Component with
            Msh2p of DNA mismatch binding factor, involved in repair
            of single base mismatches [3729 bp, 1242 aa]
          Length = 1242

 Score = 2391 bits (6197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1156/1220 (94%), Positives = 1156/1220 (94%)

Query: 1    MAPATPKTSKTAHFENGXXXXXXXXXXXXXXXXXXXXVPSGTPSKKVQKPTPATLENTAT 60
            MAPATPKTSKTAHFENG                    VPSGTPSKKVQKPTPATLENTAT
Sbjct: 1    MAPATPKTSKTAHFENGSTSSQKKMKQSSLLSFFSKQVPSGTPSKKVQKPTPATLENTAT 60

Query: 61   DKITKNPQGGKTGKLFVDVDEDNDLTIAEETVSTVRSDIMHSQEPQSDTMLNSNTTEPKS 120
            DKITKNPQGGKTGKLFVDVDEDNDLTIAEETVSTVRSDIMHSQEPQSDTMLNSNTTEPKS
Sbjct: 61   DKITKNPQGGKTGKLFVDVDEDNDLTIAEETVSTVRSDIMHSQEPQSDTMLNSNTTEPKS 120

Query: 121  TTTDEDLSSSQSRRNHKRRVNYAEXXXXXXXXXFTAKRKKGKVVDSESDEDEYLPXXXXX 180
            TTTDEDLSSSQSRRNHKRRVNYAE         FTAKRKKGKVVDSESDEDEYLP     
Sbjct: 121  TTTDEDLSSSQSRRNHKRRVNYAESDDDDSDTTFTAKRKKGKVVDSESDEDEYLPDKNDG 180

Query: 181  XXXXXXXXXXXXXXXXLAEDSGDDDDLISLAETTSKKKFSYNTSHSSSPFTRNISRDNSK 240
                            LAEDSGDDDDLISLAETTSKKKFSYNTSHSSSPFTRNISRDNSK
Sbjct: 181  DEDDDIADDKEDIKGELAEDSGDDDDLISLAETTSKKKFSYNTSHSSSPFTRNISRDNSK 240

Query: 241  KKSRPNQAPSRSYNPSHSQPSATSKSSKFNKQNEERYQWLVDERDAQRRPKSDPEYDPRT 300
            KKSRPNQAPSRSYNPSHSQPSATSKSSKFNKQNEERYQWLVDERDAQRRPKSDPEYDPRT
Sbjct: 241  KKSRPNQAPSRSYNPSHSQPSATSKSSKFNKQNEERYQWLVDERDAQRRPKSDPEYDPRT 300

Query: 301  LYIPSSAWNKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDALLANALFDLKIAGGG 360
            LYIPSSAWNKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDALLANALFDLKIAGGG
Sbjct: 301  LYIPSSAWNKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDALLANALFDLKIAGGG 360

Query: 361  RANMQLAGIPEMSFEYWAAQFIQMGYKVAKVDQRESMLAKEMREGSKGIVKRELQCILTS 420
            RANMQLAGIPEMSFEYWAAQFIQMGYKVAKVDQRESMLAKEMREGSKGIVKRELQCILTS
Sbjct: 361  RANMQLAGIPEMSFEYWAAQFIQMGYKVAKVDQRESMLAKEMREGSKGIVKRELQCILTS 420

Query: 421  GTLTDGDMLHSDLATFCLAIREEPGNFYNETQLDSSTIVQKLNTKIFGAAFIDTATGELQ 480
            GTLTDGDMLHSDLATFCLAIREEPGNFYNETQLDSSTIVQKLNTKIFGAAFIDTATGELQ
Sbjct: 421  GTLTDGDMLHSDLATFCLAIREEPGNFYNETQLDSSTIVQKLNTKIFGAAFIDTATGELQ 480

Query: 481  MLEFEDDSECTKLDTLMSQVRPMEVVMERNNLSTLANKIVKFNSAPNAIFNEVKAGEEFY 540
            MLEFEDDSECTKLDTLMSQVRPMEVVMERNNLSTLANKIVKFNSAPNAIFNEVKAGEEFY
Sbjct: 481  MLEFEDDSECTKLDTLMSQVRPMEVVMERNNLSTLANKIVKFNSAPNAIFNEVKAGEEFY 540

Query: 541  DCDKTYAEIISSEYFSTEEDWPEVLKSYYDTGKKVGFSAFGGXXXXXXXXXXXXXXISMK 600
            DCDKTYAEIISSEYFSTEEDWPEVLKSYYDTGKKVGFSAFGG              ISMK
Sbjct: 541  DCDKTYAEIISSEYFSTEEDWPEVLKSYYDTGKKVGFSAFGGLLYYLKWLKLDKNLISMK 600

Query: 601  NIKEYDFVKSQHSMVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAITPMGKRMMKKWLM 660
            NIKEYDFVKSQHSMVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAITPMGKRMMKKWLM
Sbjct: 601  NIKEYDFVKSQHSMVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAITPMGKRMMKKWLM 660

Query: 661  HPLLRKNDIESRLDSVDSLLQDITLREQLEITFSKLPDLERMLARIHSRTIKVKDFEKVI 720
            HPLLRKNDIESRLDSVDSLLQDITLREQLEITFSKLPDLERMLARIHSRTIKVKDFEKVI
Sbjct: 661  HPLLRKNDIESRLDSVDSLLQDITLREQLEITFSKLPDLERMLARIHSRTIKVKDFEKVI 720

Query: 721  TAFETIIELQDSLKNNDLKGDVSKYISSFPEGLVEAVKSWTNAFERQKAINENIIVPQRG 780
            TAFETIIELQDSLKNNDLKGDVSKYISSFPEGLVEAVKSWTNAFERQKAINENIIVPQRG
Sbjct: 721  TAFETIIELQDSLKNNDLKGDVSKYISSFPEGLVEAVKSWTNAFERQKAINENIIVPQRG 780

Query: 781  FDIEFDKSMDRIQELEDELMEILMTYRKQFKCSNIQYKDSGKEIYTIEIPISATKNVPSN 840
            FDIEFDKSMDRIQELEDELMEILMTYRKQFKCSNIQYKDSGKEIYTIEIPISATKNVPSN
Sbjct: 781  FDIEFDKSMDRIQELEDELMEILMTYRKQFKCSNIQYKDSGKEIYTIEIPISATKNVPSN 840

Query: 841  WVQMAANKTYKRYYSDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQ 900
            WVQMAANKTYKRYYSDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQ
Sbjct: 841  WVQMAANKTYKRYYSDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQ 900

Query: 901  AISNIDCLLAITRTSEYLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTA 960
            AISNIDCLLAITRTSEYLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTA
Sbjct: 901  AISNIDCLLAITRTSEYLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTA 960

Query: 961  KDFIPNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDR 1020
            KDFIPNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDR
Sbjct: 961  KDFIPNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDR 1020

Query: 1021 IMTRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVL 1080
            IMTRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVL
Sbjct: 1021 IMTRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVL 1080

Query: 1081 HHVATHIQSLGFFATHYGTLASSFKHHPQVRPLKMSILVDEATRNVTFLYKMLEGQSEGS 1140
            HHVATHIQSLGFFATHYGTLASSFKHHPQVRPLKMSILVDEATRNVTFLYKMLEGQSEGS
Sbjct: 1081 HHVATHIQSLGFFATHYGTLASSFKHHPQVRPLKMSILVDEATRNVTFLYKMLEGQSEGS 1140

Query: 1141 FGMHVASMCGISKEIIDNAQIAADNLEHTSRLVKERDLAANNLNGEVVSVPGGLQSDFVR 1200
            FGMHVASMCGISKEIIDNAQIAADNLEHTSRLVKERDLAANNLNGEVVSVPGGLQSDFVR
Sbjct: 1141 FGMHVASMCGISKEIIDNAQIAADNLEHTSRLVKERDLAANNLNGEVVSVPGGLQSDFVR 1200

Query: 1201 IAYGDGLKNTKLGSGEGVLN 1220
            IAYGDGLKNTKLGSGEGVLN
Sbjct: 1201 IAYGDGLKNTKLGSGEGVLN 1220

>Scas_636.17
          Length = 1184

 Score = 1538 bits (3982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 712/990 (71%), Positives = 840/990 (84%), Gaps = 8/990 (0%)

Query: 234  ISRDNSKKKSRPNQAPSRSYNPSHSQPSATSKSSKFNKQNEERYQWLVDERDAQRRPKSD 293
            I +  +  +  P   P R+     SQP+   K+ KFNKQNEERY WLV+E+DAQ R  +D
Sbjct: 180  IKKSPTPMRKLPVPKPKRT-----SQPATQPKAQKFNKQNEERYHWLVNEKDAQGRAPTD 234

Query: 294  PEYDPRTLYIPSSAWNKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDALLANALFD 353
            PEYDPRTL+IPSSAW KFT FEKQYWEIKSKMWDC+VFFKKGKF+ELYEKDA LAN+LFD
Sbjct: 235  PEYDPRTLHIPSSAWGKFTAFEKQYWEIKSKMWDCVVFFKKGKFYELYEKDAFLANSLFD 294

Query: 354  LKIAGGGRANMQLAGIPEMSFEYWAAQFIQMGYKVAKVDQRESMLAKEMREGSKGIVKRE 413
             K+AGGGRANMQLAG+PEMSFEYWA+QFIQ GYKVAKVDQ+ESMLAKEMREGSKGIVKRE
Sbjct: 295  WKLAGGGRANMQLAGVPEMSFEYWASQFIQYGYKVAKVDQKESMLAKEMREGSKGIVKRE 354

Query: 414  LQCILTSGTLTDGDMLHSDLATFCLAIREEPGNFYNETQLD---SSTIVQKLNTKIFGAA 470
            L+C+LTSGTLTDGDMLHSDLATFCLA+REEP +FY + Q      ST    +  K+FG A
Sbjct: 355  LECVLTSGTLTDGDMLHSDLATFCLAVREEPRDFYIDEQTTFTTDSTGPSSIGKKLFGIA 414

Query: 471  FIDTATGELQMLEFEDDSECTKLDTLMSQVRPMEVVMERNNLSTLANKIVKFNSAPNAIF 530
            FIDT+TGELQ+LEFEDDSECTKLDT+MSQV+P E++ME+NNLS+LANKIVKFN+APNAIF
Sbjct: 415  FIDTSTGELQLLEFEDDSECTKLDTIMSQVKPKEIIMEKNNLSSLANKIVKFNAAPNAIF 474

Query: 531  NEVKAGEEFYDCDKTYAEIISSEYFSTEEDWPEVLKSYYDTGKKVGFSAFGGXXXXXXXX 590
            N +K  +EFY+ +KTY E+I+  YF  E  WPE LK+YY  GKK+GFS FGG        
Sbjct: 475  NNIKPDQEFYNFEKTYDELITGNYFEDESKWPETLKNYYKEGKKIGFSTFGGLLYYLKWL 534

Query: 591  XXXXXXISMKNIKEYDFVKSQHSMVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAITPM 650
                  IS+ NIKEY+ ++SQ+S++LDG+TLQNLEIFSNSFDG+DKGTLFKLFNRAITPM
Sbjct: 535  KLDQNLISLGNIKEYNPIESQNSLILDGVTLQNLEIFSNSFDGTDKGTLFKLFNRAITPM 594

Query: 651  GKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDITLREQLEITFSKLPDLERMLARIHSRT 710
            GKRMMKKWLMHPLL K DIE RLDS+++L+ ++ LR+ +E TF+KLPD+ERMLARIHS T
Sbjct: 595  GKRMMKKWLMHPLLHKKDIEKRLDSIETLMNNVELRDTIESTFTKLPDVERMLARIHSGT 654

Query: 711  IKVKDFEKVITAFETIIELQDSLKNNDLKGDVSKYISSFPEGLVEAVKSWTNAFERQKAI 770
            +KVKDF++VI AFE I+ LQ+S+K+ DLKG +S Y S  P+ L++ V++WTNAF+R KA+
Sbjct: 655  LKVKDFDRVIQAFEDIVTLQNSIKDFDLKGALSVYFSQIPKSLIDDVENWTNAFDRIKAV 714

Query: 771  NENIIVPQRGFDIEFDKSMDRIQELEDELMEILMTYRKQFKCSNIQYKDSGKEIYTIEIP 830
             ENII+P RG + EFDKS+D IQELED+L + L  Y+K+FK SNIQYKDSGKEIYTIE+P
Sbjct: 715  EENIIIPHRGIEPEFDKSLDDIQELEDQLQDQLNLYKKRFKNSNIQYKDSGKEIYTIEVP 774

Query: 831  ISATKNVPSNWVQMAANKTYKRYYSDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAH 890
            +S TK +PS+W QMAANK+ KRYYS+EVR LARSMAEA+E+HK LE +LK RLC+KFDAH
Sbjct: 775  VSITKQIPSDWTQMAANKSTKRYYSEEVRVLARSMAEARELHKALENELKIRLCKKFDAH 834

Query: 891  YNTIWMPTIQAISNIDCLLAITRTSEYLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRH 950
            YNT WMPT+  ISNIDCLLA+TRTSE LG P+CRP + DEV+ +T T+LNG+LKF SLRH
Sbjct: 835  YNTTWMPTVHVISNIDCLLALTRTSESLGYPACRPVLRDEVNLETGTKLNGYLKFTSLRH 894

Query: 951  PCFNLGATTAKDFIPNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPC 1010
            PCFNLG+++ KDFIPND+ELGK+ P+LGLLTGANAAGKST+LRM CIAVIMAQMGCYVPC
Sbjct: 895  PCFNLGSSSTKDFIPNDVELGKDSPQLGLLTGANAAGKSTVLRMTCIAVIMAQMGCYVPC 954

Query: 1011 ESAVLTPIDRIMTRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSS 1070
            ESA LT  DRIMTRLGANDNIMQGKSTFFVEL+ETKKILD+ATNRSLLV+DELGRGGSS+
Sbjct: 955  ESAELTSFDRIMTRLGANDNIMQGKSTFFVELSETKKILDLATNRSLLVLDELGRGGSSN 1014

Query: 1071 DGFAIAESVLHHVATHIQSLGFFATHYGTLASSFKHHPQVRPLKMSILVDEATRNVTFLY 1130
            DGFAIAESVLHHVATHIQSLGFFATHY +L  SFK HPQV+P+KMSILVD+ TRNVTFLY
Sbjct: 1015 DGFAIAESVLHHVATHIQSLGFFATHYASLGLSFKGHPQVKPMKMSILVDDETRNVTFLY 1074

Query: 1131 KMLEGQSEGSFGMHVASMCGISKEIIDNAQIAADNLEHTSRLVKERDLAANNLNGEVVSV 1190
            K++ GQSEGSFGMHVASMCGI  EI+DNAQ+AAD LEHTSRL+KER +    LN ++++V
Sbjct: 1075 KLVPGQSEGSFGMHVASMCGIPSEIVDNAQVAADTLEHTSRLMKERKMLNGGLNEDIITV 1134

Query: 1191 PGGLQSDFVRIAYGDGLKNTKLGSGEGVLN 1220
            P GLQSDFVR+ YGDGL+NT  G+GEGVLN
Sbjct: 1135 PMGLQSDFVRLVYGDGLRNTSKGAGEGVLN 1164

>CAGL0G08129g complement(770779..774429) similar to sp|Q03834
            Saccharomyces cerevisiae YDR097c MSH6 DNA mismatch repair
            protein, start by similarity
          Length = 1216

 Score = 1457 bits (3771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 682/967 (70%), Positives = 806/967 (83%), Gaps = 7/967 (0%)

Query: 255  PSHSQPSATSKSSKFNKQNEERYQWLVDERDAQRRPKSDPEYDPRTLYIPSSAWNKFTPF 314
            P  +  +   K++ FNKQNEERYQWLVDERDAQ+RPK DPEYDPRTLYIPSSAWNKFTPF
Sbjct: 232  PKFTMATTGPKNNTFNKQNEERYQWLVDERDAQKRPKDDPEYDPRTLYIPSSAWNKFTPF 291

Query: 315  EKQYWEIKSKMWDCIVFFKKGKFFELYEKDALLANALFDLKIAGGGRANMQLAGIPEMSF 374
            EKQYWEIKSKMWDCIVFFKKGKFFELYEKDA LANALFD K+AGGGRANMQLAGIPEMSF
Sbjct: 292  EKQYWEIKSKMWDCIVFFKKGKFFELYEKDAFLANALFDWKLAGGGRANMQLAGIPEMSF 351

Query: 375  EYWAAQFIQMGYKVAKVDQRESMLAKEMREGSKGIVKRELQCILTSGTLTDGDMLHSDLA 434
            E+WA+QFIQ+GYKVAKVDQRESMLAKEMREGSKGIVKRELQC+LTSGTL DGDM+HSDLA
Sbjct: 352  EHWASQFIQLGYKVAKVDQRESMLAKEMREGSKGIVKRELQCVLTSGTLVDGDMIHSDLA 411

Query: 435  TFCLAIREEPGNFYNETQLDSSTIVQKLNTKIFGAAFIDTATGELQMLEFEDDSECTKLD 494
            T+CLA+REEP NFY+ TQ  S+T      TKIFG AFIDT+TGE+QM EF DD EC++LD
Sbjct: 412  TYCLAVREEPSNFYDITQPSSATY-----TKIFGVAFIDTSTGEVQMTEFLDDEECSRLD 466

Query: 495  TLMSQVRPMEVVMERNNLSTLANKIVKFNSAPNAIFNEVKAGEEFYDCDKTYAEIISSE- 553
            TLMSQVRP EV++E++NL  LANKIVKF +APNA+FN +K  EEFYD +KT+ E++++E 
Sbjct: 467  TLMSQVRPKEVIIEKHNLCNLANKIVKFCAAPNALFNYIKPVEEFYDFEKTHNELLANEE 526

Query: 554  -YFSTEEDWPEVLKSYYDTGKKVGFSAFGGXXXXXXXXXXXXXXISMKNIKEYDFVKSQH 612
             YF T + WP VLK+YYD+ KKVGFSAFGG              ISMKN  EY+FVKSQ+
Sbjct: 527  AYFGTADGWPSVLKNYYDSNKKVGFSAFGGLLYYLKWLKLDESLISMKNFTEYNFVKSQN 586

Query: 613  SMVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAITPMGKRMMKKWLMHPLLRKNDIESR 672
            +MVLDGI+LQNLEIFSNSFDGSDKGTLFKLFN +ITPMGKRMM+KWLM+PLL K DIE R
Sbjct: 587  TMVLDGISLQNLEIFSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNPLLLKEDIEKR 646

Query: 673  LDSVDSLLQDITLREQLEITFSKLPDLERMLARIHSRTIKVKDFEKVITAFETIIELQDS 732
             DSV+ L+ +  LR ++E  F+ LPDLER+L+RIH+ ++KVKDF+KVITAFE I+++   
Sbjct: 647  QDSVELLMNNHELRTKIESVFTGLPDLERLLSRIHAGSLKVKDFDKVITAFENILQMTKE 706

Query: 733  LKNNDLKGDVSKYISSFPEGLVEAVKSWTNAFERQKAINENIIVPQRGFDIEFDKSMDRI 792
            +++N+L G +  Y    P+ L   V+ W +AF+R+KA+ E +I+P+ G + +FDKS++++
Sbjct: 707  IESNELHGALKSYFIQIPKQLENEVQHWESAFDRRKAVEEGVIIPEVGVEPDFDKSLEKL 766

Query: 793  QELEDELMEILMTYRKQFKCSNIQYKDSGKEIYTIEIPISATKNVPSNWVQMAANKTYKR 852
            + LE+EL  +L +Y K  K SN+QYKDSGKEIYTIE+P+SATK VP+NWVQM ANK  KR
Sbjct: 767  EGLENELNLLLKSYMKLLKTSNLQYKDSGKEIYTIEVPVSATKYVPANWVQMGANKNTKR 826

Query: 853  YYSDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNIDCLLAIT 912
            YYSDEVR LARS+AEA+E+HKTLE DL  RLC+KFD  Y+T+WMPT+  ++NIDCLL + 
Sbjct: 827  YYSDEVRVLARSVAEARELHKTLENDLNFRLCRKFDTQYSTVWMPTVTCLANIDCLLGLV 886

Query: 913  RTSEYLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIELGK 972
            RTSE LG PSCRP I DEVD  T  +  GF+ FKSLRHPCFNL +   KDFIPND+ LG 
Sbjct: 887  RTSESLGTPSCRPVICDEVDPSTKCKKQGFVDFKSLRHPCFNLDSRVNKDFIPNDVTLGN 946

Query: 973  EQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIM 1032
            + P +GLLTGANAAGKST+LRM CIAVIMAQ+GCYVP ESA LTPIDRIMTRLGANDNIM
Sbjct: 947  KSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNIM 1006

Query: 1033 QGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQSLGF 1092
            QGKSTFFVEL+ETK+ILD+ATNRSLLV+DELGRGGSS+DGF+IAESVLHHVATHIQSLGF
Sbjct: 1007 QGKSTFFVELSETKRILDLATNRSLLVLDELGRGGSSNDGFSIAESVLHHVATHIQSLGF 1066

Query: 1093 FATHYGTLASSFKHHPQVRPLKMSILVDEATRNVTFLYKMLEGQSEGSFGMHVASMCGIS 1152
            FATHYG+L  SF+ HPQ++P+KMSILVDEATRNVTFLYK+++GQSEGSFGMHVASMCGI+
Sbjct: 1067 FATHYGSLGLSFRSHPQIKPMKMSILVDEATRNVTFLYKLVDGQSEGSFGMHVASMCGIA 1126

Query: 1153 KEIIDNAQIAADNLEHTSRLVKERDLAANNLNGEVVSVPGGLQSDFVRIAYGDGLKNTKL 1212
            K I+DNAQ AADNLEHTSRL+KER  A          VP GLQSDF R+A+GDGL N  +
Sbjct: 1127 KSIVDNAQSAADNLEHTSRLIKERKEALQGHADPGSMVPLGLQSDFTRLAFGDGLNNKSV 1186

Query: 1213 GSGEGVL 1219
            G+GEGVL
Sbjct: 1187 GTGEGVL 1193

>Kwal_56.23445
          Length = 1329

 Score = 1412 bits (3655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 697/1145 (60%), Positives = 853/1145 (74%), Gaps = 44/1145 (3%)

Query: 97   SDIMHSQEPQSDTMLNSNTT----EP-KSTTTDEDLSSSQ--SRRNHKRRVNYAEXXXXX 149
            +D++  +  +  + L+  TT    EP K     E+ +SSQ    R  KR ++YAE     
Sbjct: 183  ADVIAQRTSKDASELSDGTTVHGKEPGKQKEISENDASSQISDGRLPKRNISYAELSDDD 242

Query: 150  XXXXFTAKRKKGKVVDSESDEDEYLPXXXXXXXXXXXXXXXXXXXXXLAEDSGDDDDLIS 209
                 +  +KK + + S+ DE+EY+P                       E+  D+D+  +
Sbjct: 243  DEEVLSVGKKKRRQLPSD-DEEEYVPEDQAAN-----------------ENDDDEDEYAA 284

Query: 210  LAETTSKKKFSYNTSHSSSPFTRNISRDNSKKKSRPNQAP------------SRSYNPSH 257
            +    +K++   + S        +I + ++KK      A             +R  +P+H
Sbjct: 285  VDAANAKEELKEDPSDVLDDDDDDILQLSNKKPKLKGAAQRSSSQSPQRSSIARRPSPTH 344

Query: 258  --SQPSATSKSSKFNKQNEERYQWLVDERDAQRRPKSDPEYDPRTLYIPSSAWNKFTPFE 315
              S  +   K S F K+NE+RYQWLV+ERDAQ R   D +YDPRTLYIP SAW KFTPFE
Sbjct: 345  KASSSAGKGKHSNFAKENEDRYQWLVNERDAQGRATDDSDYDPRTLYIPPSAWTKFTPFE 404

Query: 316  KQYWEIKSKMWDCIVFFKKGKFFELYEKDALLANALFDLKIAGGGRANMQLAGIPEMSFE 375
            KQYWEIKS+MWDCIVFFKKGKFFELYEKDALL N LFDLKIAGGGRANMQLAGIPEMSF+
Sbjct: 405  KQYWEIKSRMWDCIVFFKKGKFFELYEKDALLGNHLFDLKIAGGGRANMQLAGIPEMSFD 464

Query: 376  YWAAQFIQMGYKVAKVDQRESMLAKEMREGSKGIVKRELQCILTSGTLTDGDMLHSDLAT 435
            YWA QFIQ GYKVAKVDQRESMLAKEMREG+KGIVKRELQ +LTSGTLTD  ML SD AT
Sbjct: 465  YWAMQFIQHGYKVAKVDQRESMLAKEMREGNKGIVKRELQHVLTSGTLTDSGMLQSDHAT 524

Query: 436  FCLAIREEPGNFYNETQLDSSTIVQKLNTKIFGAAFIDTATGELQMLEFEDDSECTKLDT 495
            FCLA+REE G++Y+  + +S+   QK + K++G AFIDTATGE+++LEFEDD EC+KLDT
Sbjct: 525  FCLAVREEDGSYYDAGE-ESNGTSQK-SAKVYGVAFIDTATGEIELLEFEDDDECSKLDT 582

Query: 496  LMSQVRPMEVVMERNNLSTLANKIVKFNSAPNAIFNEVKAGEEFYDCDKTYAEIISSE-- 553
            LMSQVRP E++ME+ NL  LA+KIVK+N+   AIFN +K  EEFYD ++T+ E+ SS+  
Sbjct: 583  LMSQVRPKEIIMEKGNLCNLAHKIVKYNAQSQAIFNYLKPQEEFYDFNRTFDELTSSDAK 642

Query: 554  YFSTEEDWPEVLKSYYDTGKKVGFSAFGGXXXXXXXXXXXXXXISMKNIKEYDFVKSQHS 613
            YFS  + WPE+L  YY+ G+KVGFSAFGG              ISM NIKEY+ V+SQ S
Sbjct: 643  YFSGMDQWPEILTKYYEKGRKVGFSAFGGLLYYLKWLKLDEAMISMGNIKEYNPVRSQTS 702

Query: 614  MVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAITPMGKRMMKKWLMHPLLRKNDIESRL 673
            +VLDG+TLQNLEIF NS+D +DKGTLFKL NRAITPMGKRM+KKW++ PLL+K DIE RL
Sbjct: 703  LVLDGVTLQNLEIFGNSYDNTDKGTLFKLVNRAITPMGKRMLKKWVIQPLLQKKDIEQRL 762

Query: 674  DSVDSLLQDITLREQLEITFSKLPDLERMLARIHSRTIKVKDFEKVITAFETIIELQDSL 733
            DSVD LL D  LRE LE TFS LPDLER LARIHS  +K+KDF +VI  FE I++L + L
Sbjct: 763  DSVDLLLTDCDLRETLEETFSGLPDLERFLARIHSGNLKIKDFNRVIEGFEAILQLLEKL 822

Query: 734  KNNDLKGDVSKYISSFPEGLVEAVKSWTNAFERQKAINENIIVPQRGFDIEFDKSMDRIQ 793
            +   L G +  ++   P+ L E VKSW+ AF+R+KA+NE +IVP+ G + EFD+S+  I+
Sbjct: 823  QKYQLTGSLKYFLEQVPQKLAECVKSWSGAFDRKKAVNEGVIVPEPGVEPEFDQSLQGIK 882

Query: 794  ELEDELMEILMTYRKQFKCSNIQYKDSGKEIYTIEIPISATKNVPSNWVQMAANKTYKRY 853
            EL+DEL E L +Y+K+FKCS+IQYKDSGKEIYTIE+P+SAT+ +PS+W+QM ANK+ KRY
Sbjct: 883  ELKDELEEYLSSYKKRFKCSSIQYKDSGKEIYTIEVPMSATRQIPSDWIQMGANKSNKRY 942

Query: 854  YSDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNIDCLLAITR 913
            YS EV  LARSMAE KE+HK LEE LK+RL  KFD HY  +WMPT+ AIS IDC+L++ R
Sbjct: 943  YSPEVAKLARSMAEGKEMHKILEEGLKSRLYNKFDTHYKDVWMPTLTAISQIDCILSLAR 1002

Query: 914  TSEYLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIELGKE 973
            TSE LG P CRP  VD+VD  T  +LNGF+ F+ LRHPCFNLG TT++DFIPNDI LG +
Sbjct: 1003 TSESLGFPCCRPKFVDDVDPVTGHKLNGFINFQELRHPCFNLGTTTSRDFIPNDISLGGD 1062

Query: 974  QPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIMQ 1033
              ++GLLTGANAAGKST+LRM CIAVIMAQ+GCY+P ESA L+PIDRIMTRLGANDNIMQ
Sbjct: 1063 SHQIGLLTGANAAGKSTVLRMTCIAVIMAQIGCYIPAESATLSPIDRIMTRLGANDNIMQ 1122

Query: 1034 GKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQSLGFF 1093
            GKSTFFVEL+ETKKILD ATNRSLLV+DELGRGGSSSDGFAIAE VLHHVATHIQSLGFF
Sbjct: 1123 GKSTFFVELSETKKILDTATNRSLLVLDELGRGGSSSDGFAIAEGVLHHVATHIQSLGFF 1182

Query: 1094 ATHYGTLASSFKHHPQVRPLKMSILVDEATRNVTFLYKMLEGQSEGSFGMHVASMCGISK 1153
            ATHYG L   FKHHP+V+PLKM+ILVDE +R +TFLYK+++GQSEGSFGMHVASMCGI K
Sbjct: 1183 ATHYGGLGLGFKHHPKVQPLKMNILVDEESREITFLYKLVKGQSEGSFGMHVASMCGIGK 1242

Query: 1154 EIIDNAQIAADNLEHTSRLVKERDLAANNLNGEVVSVPGGLQSDFVRIAYGDGLKNTKLG 1213
            EI++NAQ AA+N EHTS L+KER  A   ++ E + +P GLQSD VR+ +GDGL   KLG
Sbjct: 1243 EIVNNAQQAAENREHTSLLIKERQAADKGVSEEKM-IPLGLQSDLVRLRHGDGLSTQKLG 1301

Query: 1214 SGEGV 1218
             GEGV
Sbjct: 1302 CGEGV 1306

>KLLA0C17732g complement(1572115..1575699) similar to sp|Q03834
            Saccharomyces cerevisiae YDR097c MSH6 DNA mismatch repair
            protein, start by similarity
          Length = 1194

 Score = 1385 bits (3584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 640/990 (64%), Positives = 800/990 (80%), Gaps = 17/990 (1%)

Query: 235  SRDNSKKK--SRPNQAPSRSYNPSHSQPS---ATSKSSKFNKQNEERYQWLVDERDAQRR 289
            S+ ++KK   S P + P  +YNP+ S P+   +  K +KFNK N ERYQWLV ERDA+ R
Sbjct: 192  SKKSTKKAVVSTPARKP-LAYNPNRSLPATPKSQGKHTKFNKTNGERYQWLVHERDAEGR 250

Query: 290  PKSDPEYDPRTLYIPSSAWNKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDALLAN 349
             KSDP+YDPRTLYIP  AW+KFTPFEKQYWEIKSKMWDCI+FFKKGKFFELYEKDA L +
Sbjct: 251  DKSDPDYDPRTLYIPGDAWSKFTPFEKQYWEIKSKMWDCILFFKKGKFFELYEKDAHLGH 310

Query: 350  ALFDLKIAGGGRANMQLAGIPEMSFEYWAAQFIQMGYKVAKVDQRESMLAKEMREGSKGI 409
             LFDLKIAGGGRANMQLAG+PEMSF+YWA+QFIQ GYKVAKVDQ+ESMLAKEMREGSKGI
Sbjct: 311  HLFDLKIAGGGRANMQLAGVPEMSFDYWASQFIQYGYKVAKVDQKESMLAKEMREGSKGI 370

Query: 410  VKRELQCILTSGTLTDGDMLHSDLATFCLAIREEPGNFYNETQLDSSTIVQKLNTKIFGA 469
            V+RELQC+LTSGTLTD +ML SDLAT+C+A+REEP  +Y+E       +      K FG 
Sbjct: 371  VERELQCVLTSGTLTDSEMLKSDLATYCVAVREEPITYYDE-----EILALPKTGKYFGF 425

Query: 470  AFIDTATGELQMLEFEDDSECTKLDTLMSQVRPMEVVMERNNLSTLANKIVKFNSAPNAI 529
            A IDTATG + +LEFEDD EC++LDT+MSQ +P EV+ME++N+ +LA KI+KFN+ P AI
Sbjct: 426  AAIDTATGHIDLLEFEDDEECSQLDTIMSQFKPTEVIMEKSNVCSLAQKIIKFNAQPEAI 485

Query: 530  FNEVKAGEEFYDCDKTYAEIISSEYFSTEEDWPEVLKSYYDTGKKVGFSAFGGXXXXXXX 589
             N+ +  +EFYD +KT+ E+I+ EYF + + WP VLKSYY+TGKKVGF AFGG       
Sbjct: 486  INQ-RTSKEFYDFEKTFDELITHEYFKSMDRWPTVLKSYYETGKKVGFHAFGGLLSYLQW 544

Query: 590  XXXXXXXISMKNIKEYDFVKSQHSMVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAITP 649
                   ++M  ++EY+ V+SQ  + LDGITLQNLEIF+N++DG+D+G+LFKL NRAITP
Sbjct: 545  LKLDTSLVTMGQVEEYNPVRSQTCLALDGITLQNLEIFANTYDGTDRGSLFKLINRAITP 604

Query: 650  MGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDITLREQLEITFSKLPDLERMLARIHSR 709
            MGKR ++KW+MHPLL+  DI SRLDSVD LL D+ LR+ LE    KLPDLERML+R+HS 
Sbjct: 605  MGKRKLRKWVMHPLLKIEDINSRLDSVDLLLSDMNLRDLLENELLKLPDLERMLSRVHSC 664

Query: 710  TIKVKDFEKVITAFETIIELQDSLK-NNDLKGDVSKYISSFPEGLVEAVKSWTNAFERQK 768
            ++K++ F KV+  FE I+ L + L    DLKG +  Y++  P  L   +++W+NAF+R  
Sbjct: 665  SLKIQYFNKVLCGFEDILALVEKLSIFADLKGSLKSYLTEIPSSLTTVLEAWSNAFDRNL 724

Query: 769  AINENIIVPQRGFDIEFDKSMDRIQELEDELMEILMTYRKQFKCSNIQYKDSGKEIYTIE 828
            A+ + +IVP RG + EFD+SMDRIQ +ED+L E L  Y+K  K SNIQ+KDSGKEIYTIE
Sbjct: 725  AVKDGVIVPNRGVEPEFDESMDRIQGIEDQLQECLTQYKKLLKSSNIQFKDSGKEIYTIE 784

Query: 829  IPISATKNVPSNWVQMAANKTYKRYYSDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFD 888
            +P++AT+NVP  W QMAANK++KRYYS +V+ LAR MAEA+E+HK LE+DLKNRL +KF 
Sbjct: 785  VPMAATRNVPHEWTQMAANKSFKRYYSADVQRLARQMAEAREMHKVLEDDLKNRLYKKFT 844

Query: 889  AHYNTIWMPTIQAISNIDCLLAITRTSEYLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSL 948
             HYN +W+PTIQAISNIDC++++ RTSE LG P+CRP +V+ +  +TN +LNG+++FK L
Sbjct: 845  NHYNAVWLPTIQAISNIDCIISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIRFKEL 904

Query: 949  RHPCFNLGATTAKDFIPNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYV 1008
            RHPCFN+G+++AK+FIPND+ LGK+ P+LGLLTGANAAGKST+LRM C+AVI+AQ+GCY+
Sbjct: 905  RHPCFNMGSSSAKEFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYI 964

Query: 1009 PCESAVLTPIDRIMTRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGS 1068
            PCE A  TP+DRIMTRLGA+DNIMQGKSTFFVEL+ETKKILD+ TNRSLLVVDELGRGGS
Sbjct: 965  PCEEAEFTPVDRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGS 1024

Query: 1069 SSDGFAIAESVLHHVATHIQSLGFFATHYGTLASSFKHHPQVRPLKMSILVDEATRNVTF 1128
            SSDGFAIAE+VLHHVATHIQSLGFFATHY  L SSF +HP V+PLKM+ILVDE +RNVTF
Sbjct: 1025 SSDGFAIAEAVLHHVATHIQSLGFFATHYAALGSSFTNHPNVQPLKMAILVDEESRNVTF 1084

Query: 1129 LYKMLEGQSEGSFGMHVASMCGISKEIIDNAQIAADNLEHTSRLVKERDLAANNLNGEVV 1188
            LYK+++G+S+GSFGMHVASMCGI + ++DNA IAA+NLEHTS+L+KER     NL+  + 
Sbjct: 1085 LYKLVDGKSDGSFGMHVASMCGIPRSVVDNASIAAENLEHTSKLIKER----KNLHQSIN 1140

Query: 1189 SVPGGLQSDFVRIAYGDGLKNTKLGSGEGV 1218
             VP GLQSD VR+ YGDGL N+K G+GEGV
Sbjct: 1141 PVPLGLQSDVVRLVYGDGLTNSKGGTGEGV 1170

>AGR116W [4427] [Homologous to ScYDR097C (MSH6) - SH]
            complement(960587..964090) [3504 bp, 1167 aa]
          Length = 1167

 Score = 1345 bits (3482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/955 (65%), Positives = 761/955 (79%), Gaps = 5/955 (0%)

Query: 264  SKSSKFNKQNEERYQWLVDERDAQRRPKSDPEYDPRTLYIPSSAWNKFTPFEKQYWEIKS 323
             K S F+K NEERYQWLVDERDA  RP SDPEYDPRTL+IP+ AW +FTPFEKQYW+IKS
Sbjct: 193  GKHSNFSKNNEERYQWLVDERDAAGRPPSDPEYDPRTLHIPAQAWARFTPFEKQYWQIKS 252

Query: 324  KMWDCIVFFKKGKFFELYEKDALLANALFDLKIAGGGRANMQLAGIPEMSFEYWAAQFIQ 383
            KMWDCIVFFKKGKFFELYEKDA LAN LFDLKIAGGGRANMQLAGIPEMSF+YWA+QFIQ
Sbjct: 253  KMWDCIVFFKKGKFFELYEKDAHLANQLFDLKIAGGGRANMQLAGIPEMSFDYWASQFIQ 312

Query: 384  MGYKVAKVDQRESMLAKEMREGSKGIVKRELQCILTSGTLTDGDMLHSDLATFCLAIREE 443
             GYKVAKVDQ+ESMLAKEMREG+KGIV+RELQC+L+ GTLTD  MLHSD +T+CL+I E 
Sbjct: 313  HGYKVAKVDQKESMLAKEMREGNKGIVERELQCVLSGGTLTDLKMLHSDQSTYCLSIHEA 372

Query: 444  PGNFYNETQLDSSTIVQKLNTKIFGAAFIDTATGELQMLEFEDDSECTKLDTLMSQVRPM 503
            P   Y   + ++     +   ++FG AFIDTATG + +LEFEDDSECT+LDTLM+QVRP 
Sbjct: 373  PLALYAMERGEAVPPEAQQQGRLFGTAFIDTATGRICLLEFEDDSECTQLDTLMAQVRPK 432

Query: 504  EVVMERNNLSTLANKIVKFNSAPNAIFNEVKAGEEFYDCDKTYAEIISSEYFSTEEDWPE 563
            EVVME+ NLS +A+KIVKFNS P+ IFN  +   EFYD  +T+ E+ +  YF+  + WP 
Sbjct: 433  EVVMEKRNLSVIAHKIVKFNSQPDCIFN-YRTSAEFYDYARTFDEVSNGGYFAGMDSWPA 491

Query: 564  VLKSYYDTGKKVGFSAFGGXXXXXXXXXXXXXXISMKNIKEYDFVKSQHSMVLDGITLQN 623
            +LK YYD GKKVGFSAFGG              +SM  ++EY+ +K+Q S+VLDGITLQN
Sbjct: 492  ILKQYYDQGKKVGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQTSLVLDGITLQN 551

Query: 624  LEIFSNSFDGSDKGTLFKLFNRAITPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDI 683
            LEIF+NSFDG+DKGTLFKL NRAITPMGKR M+ W+MHPLLRK  IE RLDSVD LL ++
Sbjct: 552  LEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLDSVDQLLNEM 611

Query: 684  TLREQLEITFSKLPDLERMLARIHSRTIKVKDFEKVITAFETIIELQDSLKNNDLKGDVS 743
             +R+  E + + LPDLER+LAR+HS  + +KDF+KVI  FE I+ L  SL   +L G +S
Sbjct: 612  PIRDLWESSLTGLPDLERLLARVHSGNLPIKDFDKVICGFENIVRLISSLNEYELSGSLS 671

Query: 744  KYISSFPEGLVEAVKSWTNAFERQKAINENIIVPQRGFDIEFDKSMDRIQELEDELMEIL 803
            +++   P  L   V+SWT  ++R  A++E  +VP  G + +FD S+ +++ LE+EL  +L
Sbjct: 672  RFLHDIPSTLKSDVESWTTLYDRNMAVSEGKVVPNAGVEPDFDVSLSKMRALEEELDAVL 731

Query: 804  MTYRKQFKCSNIQYKDSGKEIYTIEIPISATKNVPSNWVQMAANKTYKRYYSDEVRALAR 863
              Y++ FKCS IQYKDSGKE+YTIE+PIS  K+VPSNW Q+ ANK+ KRYYS +V+ LAR
Sbjct: 732  SEYKRSFKCSKIQYKDSGKELYTIELPISIAKSVPSNWTQLGANKSTKRYYSPKVQKLAR 791

Query: 864  SMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNIDCLLAITRTSEYLGAPSC 923
            SMAEA+E+HK LEE LK RL QKFD +++T W PTI+AISNIDC+L++ RTSE LG P+C
Sbjct: 792  SMAEARELHKILEEGLKGRLYQKFDQNFSTTWFPTIKAISNIDCILSLARTSESLGFPAC 851

Query: 924  RPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIELGKEQPRLGLLTGA 983
            RP   DE+D  T  +LNG+L FK LRHPC+N G   A +FIPND+ LGK   ++ LLTGA
Sbjct: 852  RPNFKDEIDPTTGHKLNGYLSFKELRHPCYNAGVNGATEFIPNDVHLGKSTAQIALLTGA 911

Query: 984  NAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIMQGKSTFFVELA 1043
            NAAGKSTILRM CIAVIMAQ+GCYVPCE A L+P+DRIMTRLGANDNIMQGKSTFFVEL+
Sbjct: 912  NAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVELS 971

Query: 1044 ETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQSLGFFATHYGTLASS 1103
            ET+KILDMATNR+L+V+DELGRGGSSSDGFAIAE VLHH++TH+QSLGFFATHYGTL  S
Sbjct: 972  ETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQSLGFFATHYGTLGQS 1031

Query: 1104 FKHHPQVRPLKMSILVDEATRNVTFLYKMLEGQSEGSFGMHVASMCGISKEIIDNAQIAA 1163
            F HHP V+PL+M+ILVDE ++ VTFLYK++EGQSEGSFGMHVA+MCGI + +++NA+ AA
Sbjct: 1032 FTHHPMVKPLQMAILVDEGSKKVTFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENAERAA 1091

Query: 1164 DNLEHTSRLVKERDLAANNLNGEVVSVPGGLQSDFVRIAYGDGLKNTKLGSGEGV 1218
            ++ EHTSR++KER      +N E V VP GLQSDFVR+ +GDGLK T LGSGEGV
Sbjct: 1092 ESFEHTSRILKER---KRYINDEHV-VPLGLQSDFVRLVFGDGLKKTALGSGEGV 1142

>KLLA0C18590g complement(1642291..1645380) similar to sp|P25336
            Saccharomyces cerevisiae YCR092c MSH3 DNA mismatch repair
            protein, hypothetical start
          Length = 1029

 Score =  245 bits (626), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 225/916 (24%), Positives = 401/916 (43%), Gaps = 146/916 (15%)

Query: 310  KFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDALLANALFDLKIAGGGRA------- 362
            K T  ++Q+ E+K K  D I+  + G  ++ + KDA + + +  +K+  G +        
Sbjct: 148  KLTELDQQFKELKLKHMDTILCVRVGYKYKFFAKDAEIVSNILQIKLVPGKKTLDESDPN 207

Query: 363  -----NMQLAGIPEMSFEYWAAQFIQMGYKVAKVDQRE-SMLAKEMREGSKGIVKRELQC 416
                   Q   IP+        + +   YKVA V+Q E S L K    GS  +  RE++ 
Sbjct: 208  DRNYRKFQYCSIPDTRLHVHLQRLVFFNYKVAVVEQTETSALKKNNNSGS--LFTREIKN 265

Query: 417  ILTSGTL-------TDGDMLHSDL-ATFCLAIREEPGNFYNETQLDSSTIVQKLNTKIFG 468
            I T  +           D +  DL + + ++I E             ++ ++K+N     
Sbjct: 266  IFTKVSYGINETFDKSEDRILGDLTSVWAISINE-------------TSKMRKVN----- 307

Query: 469  AAFIDTATGELQMLEFEDDSEC-TKLDTLMSQVRPMEVVMERNNLSTLANKIVKFNSAPN 527
               +   +GE+   +F DD      L+  +  + P E++ E            +   +  
Sbjct: 308  LISVQLNSGEIVHDQFSDDILLNVNLEARIRYLNPTEIITEE-----------ELPPSIR 356

Query: 528  AIFNEVKAGEEFYD-----CDKTYAEIISSEYFSTEEDWPEVLKSYYDTGKKVGFSAFGG 582
             IF ++    +FY      C   +  +   +  +  +    VL SY  T +      F  
Sbjct: 357  TIFTKLNQDIQFYQSHKEACPNLFDALQGLDLNNELKRLLSVLHSYLSTFENTKVLYFAS 416

Query: 583  XXXXXXXXXXXXXXISMKNIKEYDFVKSQHSMVLDGITLQNLEIFSNSFDGSDKGTLFKL 642
                                  Y    +++ MVL   T+++LEIF NS      G+L  +
Sbjct: 417  ---------------------NYSSFTAKNFMVLPRNTIESLEIFENSTTNKTNGSLLWV 455

Query: 643  FNRAITPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDI--TLREQLEITFSKLPDLE 700
             +   T  G R+++KW+  PL+    I  R D++  +++++     E       K  DLE
Sbjct: 456  MDHTRTQFGYRLLRKWISKPLIDLKSILDRQDAITCIMKEVHSIFFESFNELLRKSIDLE 515

Query: 701  RMLARIHSRTIKVKD---FEKVITAFETIIELQDSLKNNDLKGDVS--KYISSFPEGLVE 755
            R L RI   +   K+   F K I  F ++ +   +  ++ L  + S  +  S     +++
Sbjct: 516  RALNRIAYGSTSRKEVYFFLKQIATFASLFKSHHTFIHDQLHKENSALRKTSCLLFNILQ 575

Query: 756  AVKSWTNAFER-------------QKAINENII----VPQRGFDIEFDKSMDRIQELEDE 798
             + ++ +A +               K  ++N+I    + +  F          I+E++ E
Sbjct: 576  NLDAFFSATDLPLFLQMINVDAALDKDSHKNVIEFFNLNKYDFPEGLLHKYRDIEEVKTE 635

Query: 799  LMEILMTYRKQFKCSNIQYKDSGKEIYTIEIPISATKNVPSNWVQMAANKTYKRYYSDEV 858
            L + L   ++  K   + YKD+    Y IE+  +  K VPSNWV++ + K   R+ + + 
Sbjct: 636  LDDELQNIKRVLKRPTLSYKDTKD--YLIEVRNTQAKTVPSNWVKVNSTKAVSRFRTPKT 693

Query: 859  RALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNIDCLLAITRTSEYL 918
              L   +    ++   L ED   R  Q+    Y  I    I  ++  DC+L++  TS   
Sbjct: 694  EELVGKLLYHNDLLNLLAEDEFKRFLQRIVDRYAEI-KTCINNLATYDCILSLAATSS-- 750

Query: 919  GAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIELGKEQPRLG 978
                 +P +         T+L+  +K K+ R+P      +   +++PND+ +     ++ 
Sbjct: 751  NVNYVKPKL---------TELHQKVKVKNGRNPII---ESLDVNYVPNDVLMSSNSGKIN 798

Query: 979  LLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIMQGKSTF 1038
            ++TG N  GKS+ +R   + VIM Q+GCY+P +SA ++  DRI TR+G++D+++  KSTF
Sbjct: 799  IITGPNMGGKSSYIRQVALLVIMTQIGCYIPADSAEMSICDRIFTRIGSHDDLLNAKSTF 858

Query: 1039 FVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQS--LGFFATH 1096
             VE++E   IL+ +T RSLL++DE+GRG  + DG +I+ ++L++      +  L  F TH
Sbjct: 859  QVEMSEVLHILNSSTPRSLLLLDEVGRGTGTHDGLSISFAILNYFVYLADNCPLVLFITH 918

Query: 1097 YGTLAS-----------SF--KHHPQVRPLKMSILVDEATRNVTFLYKMLEGQSEGSFGM 1143
            Y  L             S+  KH P            E   NV FLYK++ GQ+  S+G 
Sbjct: 919  YSALCQIDSKLIANYHMSYIEKHQP-----------GEKWTNVIFLYKLVLGQAHNSYGF 967

Query: 1144 HVASMCGISKEIIDNA 1159
            +VA +  I  EII+ A
Sbjct: 968  NVAKLSNIPTEIINRA 983

>CAGL0E00473g 44001..47078 similar to sp|P25336 Saccharomyces
            cerevisiae YCR092c DNA mismatch repair protein,
            hypothetical start
          Length = 1025

 Score =  239 bits (609), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 188/599 (31%), Positives = 308/599 (51%), Gaps = 88/599 (14%)

Query: 613  SMVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAITPMGKRMMKKWLMHPLLRKNDIESR 672
            S+ L   T+ NL++ SN  D S KGTLF + +   TP GKR++K+WL+ PLL K+ I  R
Sbjct: 426  SIQLQAQTINNLDLISN--DDS-KGTLFWILDHTRTPFGKRLLKEWLLRPLLSKDAIVDR 482

Query: 673  LDSVDSLLQ--DITLREQLEITFSKLPDLERMLARIH-----SRTIK--VKDFEKVITAF 723
            L+++D +L+  +    E L      +PDL R + R+       R +   +K    VI  F
Sbjct: 483  LNAIDCILESANSIFFESLNQMMKGIPDLLRTINRVSFGKTSQREVYFLLKQLTGVIKHF 542

Query: 724  ET---IIELQDSLKNNDLKGDVSKYIS------------SFPEGLVEAVKSWTNAFERQK 768
            E     IE++ +  +  +K   +K  S              P+ L+    S     +++K
Sbjct: 543  EAHKDYIEVEINSNSGAIKTKSTKLASIMTQMFEFSLSSVIPQLLLMINVSAVMEKDQKK 602

Query: 769  AI-----------NENIIVPQRGFDIEFDKSMDRIQELEDELMEILMTYRKQFKCSNIQY 817
             +           +ENII  QR  DI+  K+     +L DEL  I    +K  K  ++ Y
Sbjct: 603  QLLGFFHLNNYDNSENIIKMQR--DIDSVKA-----QLHDELQNI----KKILKRPHLAY 651

Query: 818  KDSGKEIYTIEIPISATKNVPSNWVQMAANKTYKRYYSDEVRALARSMAEAKEIHKTLEE 877
            KD     + IE+  +  K +PS+WV++   K   R+ +   + L   +    ++      
Sbjct: 652  KDEVD--FLIEVRNTQVKGIPSDWVKVNNTKMISRFLTPRTKELVELLEYQNDL------ 703

Query: 878  DLKNRLCQKFD-------AHYNTIWMPTIQAISNIDCLLAITRTSEYLGAPSCRPTIVDE 930
             L N + +++D       ++YN +    I  ++  DCLL+       L A SC       
Sbjct: 704  -LYNEISKEYDQFLNRIASYYNEV-KTFIMNLAEYDCLLS-------LAAVSCNVGYTRP 754

Query: 931  VDSKTNTQLNGFLKFKSLRHPCF-NLGATTAKDFIPNDIELGKEQPRLGLLTGANAAGKS 989
            V + +N QL   +  K  R+P   +LG     D++PNDIE+ K+  R+ ++TG N  GKS
Sbjct: 755  VFTDSNEQL---IIAKQARNPIIESLGV----DYVPNDIEMEKDSGRVLVITGPNMGGKS 807

Query: 990  TILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIMQGKSTFFVELAETKKIL 1049
            + +R   + VIMAQ+G YVP ES  L+  D ++TR+G+ DNI+QG+STF VEL+ET +I+
Sbjct: 808  SYIRQIALMVIMAQIGSYVPAESLKLSVFDNVLTRIGSQDNILQGQSTFKVELSETVEII 867

Query: 1050 DMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQS-LGFFATHYGTLASSFKHHP 1108
            +  T+++LL++DE+GRG S+ DG AIA +++ +     Q     F TH+ T+ ++ K  P
Sbjct: 868  NSCTSKTLLLLDEVGRGTSTRDGNAIAWALIKYFVEEEQCPFILFTTHF-TIVTTVK-SP 925

Query: 1109 QVRPLKMSILV----DEATRNVTFLYKMLEGQSEGSFGMHVASMCGISKEIIDNAQIAA 1163
             ++   M+ +     +E    V FLY++  G ++ S+G++VA + GI   II+ A   A
Sbjct: 926  LLKSYHMNYVQHKNENENWTTVVFLYQLKAGVTDSSYGLNVAKLAGIDTHIINRAHDVA 984

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/106 (18%), Positives = 49/106 (46%), Gaps = 12/106 (11%)

Query: 309 NKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDALLANALFDLKIAGGGRA------ 362
           ++ TP ++Q  ++K    D ++  + G  ++++ +DA++A+ +  L++  G         
Sbjct: 146 DQLTPLDRQVKDLKLGNMDKVLVIRVGYKYKIFAQDAIIASTILHLQLIPGKVTIDDSNP 205

Query: 363 ------NMQLAGIPEMSFEYWAAQFIQMGYKVAKVDQRESMLAKEM 402
                        P++  +    + ++ G KVA V+Q E+   K+ 
Sbjct: 206 NDSKYKQFAYCSFPDVRLKVHLERLVRSGLKVAVVEQSETATTKKF 251

>Sklu_2128.2 YCR092C, Contig c2128 573-3755 reverse complement
          Length = 1060

 Score =  236 bits (603), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 236/919 (25%), Positives = 393/919 (42%), Gaps = 148/919 (16%)

Query: 309  NKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDALLA-NALFDLKIAGG-------- 359
            N  TP ++QY ++K K  D I+  + G  ++ + +DA++    L ++ I G         
Sbjct: 178  NNLTPLDQQYKDLKLKNMDKILAVRVGYKYKFFAQDAVIVTQILHNMLIPGKLTIDDSDP 237

Query: 360  -GRANMQLA--GIPEMSFEYWAAQFIQMGYKVAKVDQRESMLAKEMREGSKGIVKRELQC 416
              +   Q A   IP+        + I    K+  V+Q E+   K+   G   + +RE+  
Sbjct: 238  QDKLYKQFAYCSIPDNRLNIHLQKLIHYNLKIGVVEQVETSAVKKNNGGGSSVFEREVTN 297

Query: 417  ILTSGTLTDGDMLHSDLATFCLAIREEPGNFYNETQLDSSTIV-----QKLNTKIFGAAF 471
            + T  T                 I E  G+       +S+TI       +   K +    
Sbjct: 298  VFTRATY---------------GINENFGSSEKHVIGESNTIWGLHFESESKYKNYWLIS 342

Query: 472  IDTATGELQMLEFEDDSECT-KLDTLMSQVRPMEVVMERNNLSTLANKIVKFNSAPNAIF 530
            +   +GE+   EF+++     +L+T +  + P+EVV +    + L + + K       IF
Sbjct: 343  VKVNSGEVTYDEFKEEVALNEQLETRLKYLEPIEVVSK----NELPHDVCK-------IF 391

Query: 531  NEVKAGEEFYDCD---KTYAEIISSEYFSTEEDWPEVLKSYYDTGKKVGFSAFGGXXXXX 587
                   +FY  D    +  E +  +     E   +V +  Y   K              
Sbjct: 392  RRENPDIKFYQSDPENDSCLEKVLVDKLGLSERLRQVTQILYRYLKTYSIENV------- 444

Query: 588  XXXXXXXXXISMKNIKEYDFVKSQHSMVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAI 647
                       +K    +    S+  M L   TL++LEIF+N  D   KG+L  + +   
Sbjct: 445  -----------LKITGNFKAFSSKTHMTLSAGTLESLEIFNNHTDKGVKGSLIWVLDHTR 493

Query: 648  TPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDITL--REQLEITFSKLPDLERMLAR 705
            T  G + +K W+  PL+   DIE RLD+++ +  ++ +   E L       PDL R+L R
Sbjct: 494  TAFGFQQLKDWIAKPLIHLKDIEDRLDAIECITTEVNMIFVESLNNMLKDTPDLLRILNR 553

Query: 706  I-HSRTIK--VKDFEKVITAFETIIELQDSLKNNDLKGDVSKYISSFPEGLVEAVKS--- 759
            I + +T +  V  F K I  F  +              D  KY+       +  V +   
Sbjct: 554  ITYGKTSRKEVYFFLKHINLFVKLF------------ADHYKYLEEHIYSKIGRVATKSI 601

Query: 760  -WTNAFERQKAINENIIVPQRGFDIEFDKSMDR--------------------------- 791
              T  F+      +   +P+    I     MD+                           
Sbjct: 602  LLTELFKELDTYLKECQIPKLLSMINVAAVMDKNQEAACVEFFNLNNYDNPERIISRQRN 661

Query: 792  IQELEDELMEILMTYRKQFKCSNIQYKDSGKEIYTIEIPISATKNVPSNWVQMAANKTYK 851
            I E+  EL E L   R+  K   + YKD     + IE+  +  KNVP +WV++ + K   
Sbjct: 662  IDEVRTELDEELQKIRRILKRPMLNYKDDID--FLIEVRNTQVKNVPVSWVKINSTKMVS 719

Query: 852  RYYSDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNIDCLLAI 911
            R+ + E   L   +   KE+   + E+      ++   +Y  +    IQ ++  DC+L++
Sbjct: 720  RFRTPETTKLVEKLQYHKELLIKVAEEEYLDFLKRIGENYMDL-KKAIQNLATYDCILSL 778

Query: 912  TRTSEYLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIELG 971
              TS  +     RPT   E            LK K+ R+P      +   +++PNDIE+ 
Sbjct: 779  AATSSNVNY--VRPTFKAE---------KQHLKIKNGRNPII---ESLDVNYVPNDIEMT 824

Query: 972  KEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNI 1031
            ++  ++ ++TG N  GKS+ +R   I VIM+Q+G +VP ESA L+  D I TR+GA DNI
Sbjct: 825  QKMNKVMVITGPNMGGKSSYIRQVAIIVIMSQVGAFVPAESAELSLCDAIYTRIGATDNI 884

Query: 1032 MQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQS-- 1089
            ++G+STF+VE+ E  +IL   T  SLL++DE+GRG  ++DG AI  S+L       +   
Sbjct: 885  LRGESTFYVEMLEMLQILKSCTENSLLLLDEVGRGTGTTDGIAITYSILKFFLELQEKCP 944

Query: 1090 LGFFATHY---GTLASSF--KHH----PQVRPLKMSILVDEATRNVTFLYKMLEGQSEGS 1140
            L  F THY   GT+ S     +H     + RP       +E   +V FLYK+ +G +  S
Sbjct: 945  LILFTTHYPVLGTIKSKLLGNYHMSYIEEKRP-------NENWPSVVFLYKLRKGLAHNS 997

Query: 1141 FGMHVASMCGISKEIIDNA 1159
            +G++VA +  +   II+ A
Sbjct: 998  YGLNVARLANVPTSIINRA 1016

>ADR168C [1910] [Homologous to ScYCR092C (MSH3) - SH]
            (997371..1000469) [3099 bp, 1032 aa]
          Length = 1032

 Score =  231 bits (588), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 245/981 (24%), Positives = 427/981 (43%), Gaps = 178/981 (18%)

Query: 268  KFNKQNE-----------ERYQWLVDERDAQRRPKSDPEYDPRTLYIPSSAWNKFTPFEK 316
            +FN++ E           ER Q +++ R+     + + E D        +  N+ T  ++
Sbjct: 86   RFNRRREACGKEQEVGFAERLQRIMERREGGCVEEDETELDNEAPRSKRAKPNRLTELDQ 145

Query: 317  QYWEIKSKMWDCIVFFKKGKFFELYEKDALLANALFDLKIAGGG------------RANM 364
            Q+ ++K +  D ++  + G  ++ + +DA++ + +  +K+  G                 
Sbjct: 146  QFKDLKLQHMDKVLAVRVGYKYKFFAEDAVMVSRVLQIKLVPGKLTVHETDPADHKHKKF 205

Query: 365  QLAGIPEMSFEYWAAQFIQMGYKVAKVDQRESMLAKEMREGSKGIVKRELQCILTSGTL- 423
                IP+   E    + +    KV  V+Q E+   K+    S  +  RE+  I T  T  
Sbjct: 206  AYCTIPDTRLEVHLQRLMHHNLKVGVVEQTETSAVKKNSGTSSSVFSREVTNIFTRATYG 265

Query: 424  -------TDGDMLHSDLATFCLAIREEPGNFYNETQLDSSTIVQKLNTKIFGAAFIDTAT 476
                    D  +L    + + L  + +P                   T+ F  + ++  +
Sbjct: 266  INETFGTKDRRVLGDSASVWGLVCKRQPSY-----------------TRYFLVS-VNLNS 307

Query: 477  GELQMLEFEDDSECTK-LDTLMSQVRPMEVVMERNNLSTLANKIVKFNSAPNAI-FNEVK 534
            GE+   +F+++   T+ L+T +    P EVV+  + L +   K+  F+++ + I  N + 
Sbjct: 308  GEVIFDDFKEERFLTEALETRIKYTNPSEVVVG-DGLGSEIEKV--FHTSDSDITLNRI- 363

Query: 535  AGEEFYDCDKTYAEIISSEYFSTEEDWP-----EVLKSYYDTGKKVGFSAFGGXXXXXXX 589
                  +    Y EI S  + + + + P      ++  Y    K      F         
Sbjct: 364  ------ELVGLYEEIFSEPHPAFKGNVPLQTALMLVHGYLTNFKNESLLFFK-------- 409

Query: 590  XXXXXXXISMKNIKEYDFVKSQHSMVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAITP 649
                      +N K +    S+  M+L    +++L+IF NS D S KG+L  + +   T 
Sbjct: 410  ----------ENFKPF---CSKTHMILPSSAIESLDIFENSTDRSSKGSLLWVLDHTRTN 456

Query: 650  MGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDI--TLREQLEITFSKLPDLERMLARI- 706
             G R +K W+  PL+  + I+ RLD+V  +  ++     E L        DLER+L RI 
Sbjct: 457  YGLRNLKNWIAKPLINIDQIQQRLDAVQCISTEVGNIFIESLNNMLRDGQDLERILNRIA 516

Query: 707  HSRTIK--VKDFEKVITAFETI------------------IELQDSLKNNDLKGDVSKYI 746
            + +T +  V  F + +T   T+                  I +Q SL  N +  D+ +Y 
Sbjct: 517  YGKTSRREVYLFLRELTQLATLFSSHHRYIETNVLSANGKIRMQSSLLAN-IFTDLDEYW 575

Query: 747  SSFPEGLVEAVKSWTNAFERQKAINENIIVPQRGFDIEFDKS-MDR-------------- 791
              FP      + ++        A+++N   P R +   F+ +  DR              
Sbjct: 576  KQFP------IPNFLAMINIDAALDKN---PDRPYVEYFNLTKYDRAEPLISKQQDIEAV 626

Query: 792  IQELEDELMEILMTYRKQFKCSNIQYKDSGKEI-YTIEIPISATKNVPSNWVQMAANKTY 850
            I EL DEL  I    R   K   + YKD   EI + +EI  +   +VP +WV++A+ K  
Sbjct: 627  IGELRDELKNI----RVILKRPMLNYKD---EIDFLVEIRNTQVSSVPVDWVKVASTKAV 679

Query: 851  KRYYSDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNIDCLLA 910
             R+ +     L   +   KE+ + L         ++    Y ++    I  +S  DC+L+
Sbjct: 680  SRFQTPGTAKLVAKLQYHKELLQDLALQEYESFIKRITGEYTSL-RKAILHLSTYDCILS 738

Query: 911  ITRTSEYLGAPSCRPTIVDEVDSKTNTQ------LNGFLKFKSLRHPCFNLGATTAKDFI 964
                   L A SC    VD V  K NT       +NG       R+P      +    ++
Sbjct: 739  -------LAATSCN---VDYVRPKFNTAPQCINVING-------RNPIIE---SLDVRYM 778

Query: 965  PNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTR 1024
            PND+ L +E  ++ ++TG N  GKS+ +R   + VIMAQ+GCYVP + A  +  D+I TR
Sbjct: 779  PNDVNLNREGKKIMIITGPNMGGKSSYIRQVALLVIMAQIGCYVPAQEAEFSIFDQIFTR 838

Query: 1025 LGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHH-V 1083
            +GA DN+++  STF +E+ E  +IL  +T  SLL++DE+GRG  + DG +I+ ++L + +
Sbjct: 839  IGAYDNLLRNDSTFKIEMTEMVQILRSSTENSLLLLDEVGRGTGTHDGISISYALLRYFI 898

Query: 1084 ATH-IQSLGFFATHYGTLASSFKHHPQVRPLKMSILVD----EATRNVTFLYKMLEGQSE 1138
              H    L  F THY +L S     P +    MS + +    E   +V FLYK+ EG++ 
Sbjct: 899  ELHNACPLILFITHYASLGSI--RSPILGNYHMSYIEEKRPGENWPSVVFLYKLKEGRAH 956

Query: 1139 GSFGMHVASMCGISKEIIDNA 1159
             S+G++VA +  I   II+ A
Sbjct: 957  NSYGLNVAKLADIQTGIINRA 977

>Kwal_23.6466
          Length = 1037

 Score =  230 bits (586), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 229/932 (24%), Positives = 416/932 (44%), Gaps = 137/932 (14%)

Query: 309  NKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDALLANALFDLKIAGG--------- 359
            +K TP ++Q  ++K +  D ++  + G  ++ +  DA++ + +  + + GG         
Sbjct: 150  DKLTPLDQQVKDLKLQHMDKVLAVRVGYKYKFFAMDAVIVSKILQIMLIGGKLTLDNSHP 209

Query: 360  -GRANMQLA--GIPEMSFEYWAAQFIQMGYKVAKVDQRESMLAKEMREGSKGIVKRELQC 416
              RA  QLA   IP+   +    + +    KV  V+Q E+   K+    S G+ +R++  
Sbjct: 210  GDRAYKQLAYCSIPDNRLQVHIQRLLHHNLKVGVVEQTETQAIKKANGSSSGVFRRQVDK 269

Query: 417  ILTSGTLTDGDMLH------SDLATFCLAIR-EEPGNFYNETQLDSSTIVQKLNTKIFGA 469
            + T  T +  +         S+      A+R +E   FY+                 F  
Sbjct: 270  VFTKATFSINENFSRTQINPSEEINTIWALRVDEDDQFYH-----------------FWL 312

Query: 470  AFIDTATGELQMLEFEDDSECTKLDT--LMSQVRPMEVVMERNNLSTLANKIVKFNSAPN 527
              +  ++GE+   +F D+ +  KL+    +S ++P+E+V  +  LS L +  ++    P+
Sbjct: 313  FSVQLSSGEVIYDQFSDNKKLVKLELEKRISYLQPIEIV-SKGTLSPLISTFIR-KRQPD 370

Query: 528  AIFNEVKAGEEFYDCDKTYAEIISSEYFSTEEDWPEVLKSYYDTGKKVGFSAFGGXXXXX 587
                      +F+D D                  P+V +     G  +            
Sbjct: 371  V---------QFHDYDSL---------------LPDVCEDDQVGGLNLEKELLELRNTLR 406

Query: 588  XXXXXXXXXISMKNIKEYDFVKSQHSMVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAI 647
                       M     Y    S+ +M+L   TL++LEIF N  DG+ +G+L  L +   
Sbjct: 407  RYLENYNTEKVMDIPHNYKPFHSKTNMILSSNTLESLEIFENQTDGNSRGSLMWLLDHTR 466

Query: 648  TPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDIT--LREQLEITFSKLPDLERMLAR 705
            T  G R++++W+  PL  K+ I  RLD+V+   Q++T    E L       PD  R L R
Sbjct: 467  TSFGYRLLREWISRPLTDKDSINERLDAVECTKQEVTNIFMEALGNVLKDTPDFLRNLNR 526

Query: 706  IH----SRTIK---VKDFEKVITAFETI-IELQDSLKNNDLKGDV---SKYISSFPEGLV 754
            I+    SR+     +K  +KV   F +    LQ+ + ++   G V   SK ++S  + L 
Sbjct: 527  IYYGQTSRSEVYNFLKHLDKVAKHFTSHHYYLQEQVFSSS--GRVHQKSKLMTSLLQRLH 584

Query: 755  EAVK-----------SWTNAFERQKAINENIIVPQRGFD---IEFDKSMDRIQELEDELM 800
            + +K           + + A E+ K  +         +D   +   K  D I+ +++EL 
Sbjct: 585  DGLKKVNTTNLLNMINVSGALEKDKEKSCVEFFNLNNYDNADVILSKLKD-IESVKEELQ 643

Query: 801  EILMTYRKQFKCSNIQYKDSGKEI-YTIEIPISATKNVPSNWVQMAANKTYKRYYSDEVR 859
              L   R+  K     YKD   EI + IE+  +    +P++W+++ + K   R+ + +  
Sbjct: 644  IELGNIRRLLKRPRFCYKD---EIEFLIEVRNTQLTGLPTDWIKVGSTKMVSRFKTPKTT 700

Query: 860  ALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNI---DCLLAITRTSE 916
             L   +    + HK L   + +   ++F A+ ++ ++   + I N+   DC+L++  TS 
Sbjct: 701  KLIDQL----DYHKNLLVIICDEQFKRFLANISSQYLLLKEVIENLATFDCMLSLAATS- 755

Query: 917  YLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIELGKEQPR 976
                   RP   +             +K ++ R+P      +   +++ ND+ + ++Q +
Sbjct: 756  -FNRQYVRPQFCEGRRE---------MKIRNGRNPIIE---SLDVNYVANDVYMKEDQSK 802

Query: 977  LGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIMQGKS 1036
            L ++TG N  GKS+ +R   +  I+AQ+G +VP ESA L     I TR+GA+DN+++G S
Sbjct: 803  LLIITGPNMGGKSSFIRQVALISILAQVGSFVPAESANLPIFSNIFTRIGAHDNLIKGDS 862

Query: 1037 TFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQSLGF--FA 1094
            TF VE+ E   IL  +   SLL++DE+GRG  ++DG +I+++ +++     +   F  F 
Sbjct: 863  TFKVEMLEMLDILKNSDENSLLLLDEVGRGTGTTDGISISDATINYFIDMDKKCPFILFI 922

Query: 1095 THYGTLASSFKHHPQVRPLKMSIL----VDEATRNVTFLYKMLEGQSEGSFGMHVASMCG 1150
            THY  L S     P +    M  +      E      FLYK+ +G +  S+G++VA +  
Sbjct: 923  THYPILGSI--KSPLIENYHMGFMEERRAGEKWPTAVFLYKLTQGIATDSYGLNVARLAN 980

Query: 1151 ISKEIIDNAQI----------AADNLEHTSRL 1172
            +   II+NA +          AA NL  TS+L
Sbjct: 981  LPMSIINNAYVVSEGVKAEMEAAKNLRFTSKL 1012

>CAGL0I07733g 742340..745213 highly similar to sp|P25847 Saccharomyces
            cerevisiae YOL090w MSH2 DNA mismatch repair protein,
            start by similarity
          Length = 957

 Score =  218 bits (556), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 203/789 (25%), Positives = 365/789 (46%), Gaps = 99/789 (12%)

Query: 444  PGNFYNETQL-----DSSTIVQKLNTK--------IFGAAFIDTATGELQMLEFEDDSEC 490
            PGN    + L     D+S ++  L  +        I G  FIDT+  ++ M++  D+   
Sbjct: 121  PGNIEQVSDLLNLNIDASIVIASLKIQQNPKDAHVILGLTFIDTSNYKIGMMDIIDNEAY 180

Query: 491  TKLDTLMSQVRPMEVVMERNNLSTLANKIVKFNSAPNAIFNEVKAGEEFYDCDKTYAEII 550
            + L++ + Q+   E ++   +LS         N + N    E+K      D   +   I+
Sbjct: 181  SNLESFLIQLGIRECLVP--DLSQ--------NGSTNP---ELKKITNVIDRCGSVVTIV 227

Query: 551  SSEYFS---TEEDWPEVLKS--YYDTGKKVGFSAFGGXXXXXXXXXXXXXXISMKNIKEY 605
             +  FS    E D  ++L +       + V   A G                  + + +Y
Sbjct: 228  PNSEFSNKDVEVDLAKLLGNDLTLTLPQNVSQLALGACNALLNYLQLLS---EQEMLGKY 284

Query: 606  DFVKSQHS----MVLDGITLQNLEIF-----------SNSFDGSDKGT----LFKLFNRA 646
            + +  QHS    M LD   ++ L +F            +   GS+ GT    LF+L N  
Sbjct: 285  ELI--QHSLESIMKLDSSAIKALNLFPQNNATFFTPMQSGTVGSNGGTKVASLFQLLNNC 342

Query: 647  ITPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDITLREQLEITF-SKLPDLERMLAR 705
             T  G R++ +WL  PL   + I+ R + V+ L+  + LR+ L+  +   +PD+ R++ +
Sbjct: 343  KTNSGVRLLNEWLKQPLTDFSGIQVRHNLVEFLIDQLELRQILQTEYLPGVPDIRRLVKK 402

Query: 706  IHSR-----TIKVKDFEKVITAFETIIE--LQDSLKNNDLKGDVSKYISSFPEGLVEAVK 758
            ++        +KV  F   +     IIE  L+D +   D+K  V K      +  +E +K
Sbjct: 403  LNKNGTLEDVLKVYQFSLKVPDIINIIESFLEDDITTTDIKELVRKTWCDPLKEFMEPLK 462

Query: 759  SW---------TNAFERQKAINENIIVPQRGFDIEFDKSMDRIQELEDELMEILMTYRKQ 809
             +          +A+E     NE +I  +  F+ E  K  +++  + DE+  I +   + 
Sbjct: 463  KFDEMVQTTVDLDAYEEN---NEFMI--RVEFNEELAKVREQLTAMRDEINAIHLEAAED 517

Query: 810  FKCS-NIQYKDSGKEIYTIEIPIS-----ATKNVPSNWVQMAANKTYKRYYSDEVRALAR 863
                 N + K     I+   + ++     A +N    +++++  K    + + +++ +A+
Sbjct: 518  LGFDPNKKLKLENHHIHGWCMRLTRNDAKALRN-HKQYIELSTVKAGIFFSTRKMKEIAQ 576

Query: 864  SMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNIDCLLAITRTSEYLGAPSC 923
                 ++ ++ L+  L   +       Y  I+      I+++D L +    S Y   P  
Sbjct: 577  ETVVLQKDYERLQSSLVKEIVS-ITLTYTPIFEKLSLVIAHLDVLCSFAHASSYAPIPYV 635

Query: 924  RPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIELGKEQPRLGLLTGA 983
            RPT+   + S   T      K  + RHP   +       FI ND+++ K+     ++TG 
Sbjct: 636  RPTM-HPLSSDRRT------KLMNSRHPVLEVQDDVT--FIANDVDMAKDVSEFQIITGP 686

Query: 984  NAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIMQGKSTFFVELA 1043
            N  GKST +R   +  +MAQ+GC+VPC++A ++ +D I+ R+GA D+ ++G STF VE+ 
Sbjct: 687  NMGGKSTYIRQVGVITLMAQIGCFVPCDNAEISIVDAILCRVGAGDSQLKGVSTFMVEML 746

Query: 1044 ETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQSLGFFATHYGTLASS 1103
            ET  IL  AT+ SL++VDELGRG S+ DGF +A ++  H+A  I+    FATH+  L + 
Sbjct: 747  ETASILKNATSNSLIIVDELGRGTSTYDGFGLAWAIAEHIAKEIRCFALFATHFHELTNL 806

Query: 1104 FKHHPQVRPLKMSILVDEATR-----NVTFLYKMLEGQSEGSFGMHVASMCGISKEIIDN 1158
             +  P V+ + +   +DE+ +     ++T LYK+  G S+ SFG+HVA +    K+I+  
Sbjct: 807  SEQLPNVKNMHVIAHIDESEKALNSNDITLLYKVEPGISDRSFGIHVAEVVQFPKKIVSM 866

Query: 1159 AQIAADNLE 1167
            A+  A+ LE
Sbjct: 867  AKRKANELE 875

>YCR092C (MSH3) [615] chr3 complement(276760..279903) Component of DNA
            mismatch binding factor along with Msh2p, involved in
            mismatch repair involving microsatellite (short repeat)
            sequences [3144 bp, 1047 aa]
          Length = 1047

 Score =  218 bits (555), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 220/910 (24%), Positives = 399/910 (43%), Gaps = 129/910 (14%)

Query: 310  KFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDALLANALFDLKIAGG---------- 359
            K TP +KQ  ++K    D ++  + G  ++ + +DA+  + +  +K+  G          
Sbjct: 160  KLTPLDKQVKDLKMHHRDKVLVIRVGYKYKCFAEDAVTVSRILHIKLVPGKLTIDESNPQ 219

Query: 360  --GRANMQLAGIPEMSFEYWAAQFIQMGYKVAKVDQRESMLAKEMREGSK--GIVKRELQ 415
                        P++       + +    KVA V+Q E+   K+   G+    + +R++ 
Sbjct: 220  DCNHRQFAYCSFPDVRLNVHLERLVHHNLKVAVVEQAETSAIKKHDPGASKSSVFERKIS 279

Query: 416  CILTSGTLTDGDMLHSDLATFCLAIREEPGNFYNETQLDSSTIVQKLNTKIFGAAFIDTA 475
             + T  T           +TF L  +   G+  +   L  S  V +     +    ++  
Sbjct: 280  NVFTKATFGVN-------STFVLRGKRILGDTNSIWAL--SRDVHQGKVAKYSLISVNLN 330

Query: 476  TGELQMLEFEDDSEC-TKLDTLMSQVRPMEVVMERNNLSTLANKIVKFNSAP-------- 526
             GE+   EFE+ +    KL   +  ++P+EV++  ++L     K  K  S P        
Sbjct: 331  NGEVVYDEFEEPNLADEKLQIRIKYLQPIEVLVNTDDLPLHVAKFFKDISCPLIHKQEYD 390

Query: 527  --NAIFNEVKAGEEFYDCDKTYAEIISSEYFSTEEDWPEVLKSYYDTGKKVGFSAFGGXX 584
              + +   +K   E      +   ++S  Y    E         Y+  + +   +     
Sbjct: 391  LEDHVVQAIKVMNEKIQLSPSLIRLVSKLYSHMVE---------YNNEQVMLIPSI---- 437

Query: 585  XXXXXXXXXXXXISMKNIKEYDFVKSQHSMVLDGITLQNLEIFSNSFDGSDKGTLFKLFN 644
                                Y    S+  M+LD  +LQ+L+IF++  DG  KG+LF L +
Sbjct: 438  --------------------YSPFASKIHMLLDPNSLQSLDIFTH--DGG-KGSLFWLLD 474

Query: 645  RAITPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDI---TLREQLEITFSKLPDLER 701
               T  G RM+++W++ PL+  + IE RLD+++ +  +I      E L    +  PDL R
Sbjct: 475  HTRTSFGLRMLREWILKPLVDVHQIEERLDAIECITSEINNSIFFESLNQMLNHTPDLLR 534

Query: 702  MLARIHSRTIKVKD---FEKVITAFETIIELQDS-----LKNND------------LKGD 741
             L RI   T   K+   + K IT+F    ++  S      K++D            L  +
Sbjct: 535  TLNRIMYGTTSRKEVYFYLKQITSFVDHFKMHQSYLSEHFKSSDGRIGKQSPLLFRLFSE 594

Query: 742  VSKYISS--FPEGL----VEAVKSWTNAFERQKAINENIIVPQRGFDIEFDKSMDRIQ-E 794
            +++ +S+   P  L    V AV    +  +     N N      G  I+  +  + ++ +
Sbjct: 595  LNELLSTTQLPHFLTMINVSAVMEKNSDKQVMDFFNLNNYDCSEGI-IKIQRESESVRSQ 653

Query: 795  LEDELMEILMTYRKQFKCSNIQYKDSGKEIYTIEIPISATKNVPSNWVQMAANKTYKRYY 854
            L++EL EI    RK  K   + ++D     Y IE+  S  K++P +W+++   K   R+ 
Sbjct: 654  LKEELAEI----RKYLKRPYLNFRDEVD--YLIEVKNSQIKDLPDDWIKVNNTKMVSRFT 707

Query: 855  SDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNIDCLLAITRT 914
            +   + L + +   K++     E        K  A Y  +   T+  ++  DC+L++  T
Sbjct: 708  TPRTQKLTQKLEYYKDLLIRESELQYKEFLNKITAEYTELRKITLN-LAQYDCILSLAAT 766

Query: 915  SEYLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIELGKEQ 974
            S        RPT V+   +         +  K+ R+P      +    ++PNDI +  E 
Sbjct: 767  S--CNVNYVRPTFVNGQQA---------IIAKNARNPIIE---SLDVHYVPNDIMMSPEN 812

Query: 975  PRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIMQG 1034
             ++ ++TG N  GKS+ +R   +  IMAQ+G +VP E   L+  + ++TR+GA+D+I+ G
Sbjct: 813  GKINIITGPNMGGKSSYIRQVALLTIMAQIGSFVPAEEIRLSIFENVLTRIGAHDDIING 872

Query: 1035 KSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQS-LGFF 1093
             STF VE+ +   IL     RSLL++DE+GRG  + DG AI+ +++ + +      L  F
Sbjct: 873  DSTFKVEMLDILHILKNCNKRSLLLLDEVGRGTGTHDGIAISYALIKYFSELSDCPLILF 932

Query: 1094 ATHYGTLASSFKHHPQVRPLKMSILVDEAT----RNVTFLYKMLEGQSEGSFGMHVASMC 1149
             TH+  L       P +R   M  + ++ T     +V FLYK+ +G +  S+GM+VA + 
Sbjct: 933  TTHFPMLGEI--KSPLIRNYHMDYVEEQKTGEDWMSVIFLYKLKKGLTYNSYGMNVAKLA 990

Query: 1150 GISKEIIDNA 1159
             + K+II+ A
Sbjct: 991  RLDKDIINRA 1000

>Kwal_56.22613
          Length = 956

 Score =  217 bits (552), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 209/841 (24%), Positives = 386/841 (45%), Gaps = 116/841 (13%)

Query: 444  PGNFYN-----ETQLDSSTIVQKLNTK--------IFGAAFIDTATGELQMLEFEDDSEC 490
            PGN           LDSS ++  +  +        + G +FID+++ ++ ML+  D+   
Sbjct: 121  PGNIEQVDDLMNVSLDSSIVLTSIKLQPNAQEGNCVLGVSFIDSSSYKIGMLDIVDNEVY 180

Query: 491  TKLDTLMSQVRPMEVVM-ERNNLSTLANKIVKFNSAPNAIFNEVKAGEEFYDCDKTYAEI 549
            + L++ + Q+   E ++ E  +   +A+++ K  S  +      + G     C  T+ + 
Sbjct: 181  SNLESFLIQMGVRECLLPELRSNENVASELKKMVSVLD------RCG-----CVSTFVK- 228

Query: 550  ISSEYF--STEEDWPEVLKSYYDTGKKVGFSAFGGXXXXXXXXXXXXXXISMKN----IK 603
             +SE+     E+D  +++      G ++  S                  + + N    + 
Sbjct: 229  -NSEFAPKDVEQDLIKLV------GDELSMSLMKFSNLALGSCNALLNYLQLMNSESQLG 281

Query: 604  EYDFVKSQHS----MVLDGITLQNLEIF--------------SNSFDGSDKGTLFKLFNR 645
             Y+ V  QHS    M LD   L+ L IF               N+       ++F+L N+
Sbjct: 282  RYELV--QHSLTEFMKLDASALKALNIFPVGPATTSGPPVAHGNTSSTGKISSIFQLLNK 339

Query: 646  AITPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDITLREQLEITF-SKLPDLERMLA 704
              T  G R++ +WL  PL     I+ R D V+ L+  + LR+ L+  +   +PD+ R+  
Sbjct: 340  CKTNAGIRLLNEWLKQPLTDLEAIQKRHDLVEFLIDQLELRQVLQTDYLPAVPDVRRLTK 399

Query: 705  RIHSR-----TIKVKDFEKVITAFETIIE--LQDSLKNNDLKGDVSKY-----------I 746
            +++        +K+  F + +     ++E  L+D   ++ +K  V +            +
Sbjct: 400  KLNKNGNLEDVLKIYQFAQKVPEVSKVLEEYLKDVSDDSHIKSLVMETWHQPLNAHIAPL 459

Query: 747  SSFPEGLVEAVKSW-----TNAFERQKAINENIIVPQRGFDIEFDKSMDRIQELEDELME 801
              F E +VE          TN F  +   NE++    RG   E D   + I+ +  +  E
Sbjct: 460  DKFQE-MVETTVDLDAYEDTNEFMIKVDFNEDL-AKIRG---ELDVLKENIKSIHLDAAE 514

Query: 802  IL-MTYRKQFKCSNIQYKDSGKEIYTIEIPISATKNVPSN--WVQMAANKTYKRYYSDEV 858
             L     K+ K  N          + + +  +  K +  +  +++++  K    + + E+
Sbjct: 515  DLGFDPEKKLKLENHHMHG-----WCMRLTRNDGKALRQHKKYLELSTVKAGIYFSTKEL 569

Query: 859  RALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNIDCLLAITRTSEYL 918
            + +A   A  ++ +  L+ DL   + Q     Y  +       ++N+D L +    S Y 
Sbjct: 570  KQIAEQTAALQKEYDRLQSDLVKEIVQ-ITLTYTPVLEKLSIVLANLDVLSSFAHVSSYA 628

Query: 919  GAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIELGKEQPRLG 978
              P  RP ++  + ++  T+L G       RHP   +       FI ND++L K +    
Sbjct: 629  PIPYVRP-LMHGLGTQRKTELIGS------RHPVLEVLDDVT--FISNDVKLEKGKNEFL 679

Query: 979  LLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIMQGKSTF 1038
            ++TG N  GKST +R   +  +MAQ+GC+VPC++A +  +D ++ R+GA D+ ++G STF
Sbjct: 680  IITGPNMGGKSTYIRQVGVISLMAQIGCFVPCDTAEIAVVDAVLCRVGAGDSQLKGVSTF 739

Query: 1039 FVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQSLGFFATHYG 1098
             VE+ ET  IL  AT  SL++VDELGRG S+ DGF +A S+  H+A+ I+    FATH+ 
Sbjct: 740  MVEMLETASILKNATENSLIIVDELGRGTSTYDGFGLAWSISEHIASKIKCFALFATHFH 799

Query: 1099 TLASSFKHHPQVRPLKMSILVDEA------TRNVTFLYKMLEGQSEGSFGMHVASMCGIS 1152
             L S     P V+ + +   +++A      + ++T LYK+  G S+ SFG+HVA +    
Sbjct: 800  ELTSLADQIPTVKNMHVIAHIEDAEKSNHNSEDITLLYKVEPGISDQSFGIHVAEVVQFP 859

Query: 1153 KEIIDNAQIAADNLE---HTSRLVKERDLAANNLNGEVVSVPGGLQSDFVRIAYGDGLKN 1209
            ++I+  A+  A  LE   H S+ +K++  +A+ +      +   L+S +V+    +GL N
Sbjct: 860  RKIVSMAKRKAAELEELKHDSQTLKKQKCSASEIAAGTAVLKDVLKS-WVKSVRDEGLHN 918

Query: 1210 T 1210
            +
Sbjct: 919  S 919

>Scas_628.3
          Length = 959

 Score =  217 bits (552), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 204/795 (25%), Positives = 347/795 (43%), Gaps = 111/795 (13%)

Query: 444  PGNFYNETQL-----DSSTIVQKL----NTK----IFGAAFIDTATGELQMLEFEDDSEC 490
            PGN      L     DSS ++  L    N+K    + G AFIDT+  ++ ML+  D+   
Sbjct: 121  PGNVEQVNDLMNIAIDSSIVIASLKLQVNSKEGNSVLGVAFIDTSNYKIGMLDIVDNEVY 180

Query: 491  TKLDTLMSQVRPMEVVME----RNNLSTLANKIVKFNSAPNAIFNEVKAGE-EFYDCDKT 545
            + L++ + Q+   E +++      N S    KI+       ++   VK  E    D +  
Sbjct: 181  SNLESFLIQLGVRECIVQDLTNNENTSREFKKIIGVIDRCGSVVTLVKNSEFSEKDVEMD 240

Query: 546  YAEIISSEYFSTEEDWPEVLKSYYDTGKKVGFSAFGGXXXXXXXXXXXXXXISMKNIKEY 605
              ++I++E   +      + K Y +       +  G               +   +++E+
Sbjct: 241  LTKLINNELSLS------LPKKYSNLAMGACNALLGYLELLNEQDQLGKFELIEHSLQEF 294

Query: 606  DFVKSQHSMVLDGITLQNLEIF------------SNSF---DGSDKGTLFKLFNRAITPM 650
                    M LD   ++ L +F            + SF    G    +LF+L N   T  
Sbjct: 295  --------MKLDASAIKALNLFPQGPVQPFGPTPTASFGTASGGKIASLFQLLNNCKTNA 346

Query: 651  GKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDITLREQLEI-TFSKLPDLERMLARIHSR 709
            G R++ +WL  PL     IE R D VD L+  + LR+ L+  T   +PDL R+  +++  
Sbjct: 347  GIRLLNEWLKQPLTDLARIEQRHDLVDYLIDQLELRQMLQTDTLPMIPDLRRLTKKLNKN 406

Query: 710  -----TIKVKDFEKVITAFETIIE--LQDSLKNNDLKGDVSKY-----------ISSFPE 751
                  +K+  F + I     ++E  L+D   N+ +K  +              +S F E
Sbjct: 407  GNLEDVLKIFQFSQKIPEVAQLLESFLEDDNSNSKVKSLIKMVWLDPLTSHLDPLSKFQE 466

Query: 752  GLVEAVKSWTNAFERQKAINENIIVPQRGFDIEFDKSMDRIQELEDELMEILMTYR---- 807
             +VE       AFE            Q    +EF++ + +I+E  D L E +        
Sbjct: 467  -MVETTVDL-EAFETNN---------QFMIKVEFNEELAKIREQLDSLREQINAIHLNAA 515

Query: 808  --------KQFKCSNIQYKDSGKEIYTIEIPISATKNVPS--NWVQMAANKTYKRYYSDE 857
                    K+ K  N          + + +  +  K +    N+++++  K    + + E
Sbjct: 516  DDLGFDPDKKLKLENHHLHG-----WCMRLTRNDAKELRKHRNYLELSTVKAGIFFSTKE 570

Query: 858  VRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNIDCLLAITRTSEY 917
            ++ +A+   + ++ +  L+  L   +       Y  +     Q ++++D L +    S Y
Sbjct: 571  LKEIAQETIKLQKDYDRLQSALVKEIV-GITVTYTPVLEKLSQVLAHLDVLCSFAHVSSY 629

Query: 918  LGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIELGKEQPRL 977
               P  RP +    DS   T L G       RHP   +       FI ND++L   +   
Sbjct: 630  APIPYVRPKM-HPFDSTRRTHLVGS------RHPVLEMQDDLT--FISNDVDLVDGEGDF 680

Query: 978  GLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIMQGKST 1037
             ++TG N  GKST +R   +  +MAQ+GC+VPCE A +  +D I+ R+GA D+ ++G ST
Sbjct: 681  LIITGPNMGGKSTYIRQVGVISLMAQIGCFVPCEEAEIAIVDAILCRVGAGDSQLKGVST 740

Query: 1038 FFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQSLGFFATHY 1097
            F VE+ ET  IL  AT  SL++VDELGRG S+ DGF +A ++  H+A+ I     FATH+
Sbjct: 741  FMVEMLETASILKNATKNSLIIVDELGRGTSTYDGFGLAWAIAEHIASKIGCFALFATHF 800

Query: 1098 GTLASSFKHHPQVRPLKMSILVDEAT-----RNVTFLYKMLEGQSEGSFGMHVASMCGIS 1152
              L S       V+ + +   +++ T      ++T LYK+  G S+ SFG+HVA +    
Sbjct: 801  HELTSLSDKFSNVKNMHVVAYIEKGTDQLESDDITLLYKVEPGISDQSFGIHVAEVVQFP 860

Query: 1153 KEIIDNAQIAADNLE 1167
             +I+  A+  A  LE
Sbjct: 861  DKIVKMAKRKASELE 875

>YOL090W (MSH2) [4730] chr15 (147381..150275) Component with Msh3p and
            Msh6p of DNA mismatch binding factor, involved in repair
            of single base mismatches and short insertions/deletions
            [2895 bp, 964 aa]
          Length = 964

 Score =  204 bits (518), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 216/827 (26%), Positives = 359/827 (43%), Gaps = 149/827 (18%)

Query: 444  PGNFYNETQL-----DSSTIVQKLNTK--------IFGAAFIDTATGELQMLEFEDDSEC 490
            PGN     +L     DSS I+  L  +        I G AFIDT   ++ ML+  D+   
Sbjct: 121  PGNIEQVNELMNMNIDSSIIIASLKVQWNSQDGNCIIGVAFIDTTAYKVGMLDIVDNEVY 180

Query: 491  TKLDTLMSQVRPMEVVMERNNLSTLANKIVKFNSAPNAI-----FNEVKAGEEFYDCDKT 545
            + L++ + Q+   E +++  +L++ +N   +     N I        +    EF + D  
Sbjct: 181  SNLESFLIQLGVKECLVQ--DLTSNSNSNAEMQKVINVIDRCGCVVTLLKNSEFSEKD-- 236

Query: 546  YAEIISSEYFSTEEDWPEVLKSYYDTGKKVGFSAFGGXXXXXXXXXXXXXXISMKNIKEY 605
              E+  ++     +D    L   Y        +A  G                   + +Y
Sbjct: 237  -VELDLTKLLG--DDLALSLPQKYSKLSMGACNALIGYLQLLS---------EQDQVGKY 284

Query: 606  DFV--KSQHSMVLDGITLQNLEIF----SNSFDGSDKG--------------TLFKLFNR 645
            + V  K +  M LD   ++ L +F     N F  ++                +LF+L N 
Sbjct: 285  ELVEHKLKEFMKLDASAIKALNLFPQGPQNPFGSNNLAVSGFTSAGNSGKVTSLFQLLNH 344

Query: 646  AITPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDITLREQLEITF-SKLPDLERMLA 704
              T  G R++ +WL  PL   ++I  R D VD L+  I LR+ L   +   +PD+ R+  
Sbjct: 345  CKTNAGVRLLNEWLKQPLTNIDEINKRHDLVDYLIDQIELRQMLTSEYLPMIPDIRRLTK 404

Query: 705  RIHSR-----TIKVKDFEK-------VITAF-------ETIIELQDSLKNNDLKGDVSKY 745
            +++ R      +K+  F K       V T+F       E + EL  S+    L   V   
Sbjct: 405  KLNKRGNLEDVLKIYQFSKRIPEIVQVFTSFLEDDSPTEPVNELVRSVWLAPLSHHVEP- 463

Query: 746  ISSFPEGLVEAVKSWTNAFERQKAINENIIVPQRGFDIEFDKSMDRIQELEDELMEILMT 805
            +S F E +   V    +A+E     NE +I  +  F+ E  K   ++  L DE+  I + 
Sbjct: 464  LSKFEEMVETTVD--LDAYEEN---NEFMI--KVEFNEELGKIRSKLDTLRDEIHSIHLD 516

Query: 806  YR--------KQFKCSNIQY--------KDSGKEI--YTIEIPISATKN---VPSNWVQM 844
                      K+ K  N           ++  KE+  +   I +S  K      +  ++ 
Sbjct: 517  SAEDLGFDPDKKLKLENHHLHGWCMRLTRNDAKELRKHKKYIELSTVKAGIFFSTKQLKS 576

Query: 845  AANKT--YKRYYSDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAI 902
             AN+T   ++ Y  +  AL R +     I+ TL               Y  ++      +
Sbjct: 577  IANETNILQKEYDKQQSALVREI-----INITLT--------------YTPVFEKLSLVL 617

Query: 903  SNIDCLLAITRTSEYLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKD 962
            +++D + +   TS Y   P  RP +   +DS+  T L       S RHP   +    +  
Sbjct: 618  AHLDVIASFAHTSSYAPIPYIRPKL-HPMDSERRTHL------ISSRHPVLEMQDDIS-- 668

Query: 963  FIPNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIM 1022
            FI ND+ L   +    ++TG N  GKST +R   +  +MAQ+GC+VPCE A +  +D I+
Sbjct: 669  FISNDVTLESGKGDFLIITGPNMGGKSTYIRQVGVISLMAQIGCFVPCEEAEIAIVDAIL 728

Query: 1023 TRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHH 1082
             R+GA D+ ++G STF VE+ ET  IL  A+  SL++VDELGRG S+ DGF +A ++  H
Sbjct: 729  CRVGAGDSQLKGVSTFMVEILETASILKNASKNSLIIVDELGRGTSTYDGFGLAWAIAEH 788

Query: 1083 VATHIQSLGFFATHYGTLASSFKHHPQVRPLKMSILVDEATR-------NVTFLYKMLEG 1135
            +A+ I     FATH+  L    +  P V+ + +   +++  +       ++T LYK+  G
Sbjct: 789  IASKIGCFALFATHFHELTELSEKLPNVKNMHVVAHIEKNLKEQKHDDEDITLLYKVEPG 848

Query: 1136 QSEGSFGMHVASMCGISKEIIDNAQIAADNLEHTSRLVKERDLAANN 1182
             S+ SFG+HVA +    ++I+  A+  A+ L+         DL  NN
Sbjct: 849  ISDQSFGIHVAEVVQFPEKIVKMAKRKANELD---------DLKTNN 886

>KLLA0F02706g 245783..248653 gi|14348673|gb|AAK61336.1|AF332582_1
            Kluyveromyces lactis mismatch repair protein Msh2p, start
            by similarity
          Length = 956

 Score =  200 bits (508), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 149/561 (26%), Positives = 265/561 (47%), Gaps = 49/561 (8%)

Query: 637  GTLFKLFNRAITPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDITLREQL-EITFSK 695
             +LF+L NR  T  G R++ +WL  PL   + I  R D V+  +  + LR  L E     
Sbjct: 330  SSLFQLLNRCKTNSGVRLLNEWLKQPLTDIDQITKRHDLVEFFMDQLELRSSLQEECLPS 389

Query: 696  LPDLERMLARIHSRTIKVKDFEKVITAFETIIELQDSLKNNDLKGDVSKYISSFPEGLVE 755
            +PD+ R+  ++  +   ++D  K+    + +  + D LK    + D +  +    E L++
Sbjct: 390  VPDIRRLTKKLQ-KNGNLEDVLKIYQFAQMVPVISDLLKQKTEEVDSNDLMILVKEVLLD 448

Query: 756  AVKSWTNAFERQKAINENII-------VPQRGFDIEFDKSMDRIQELEDELMEILMTYR- 807
             +    N  E+ K + E  +         +    +EF++ +  I+   DEL + + T   
Sbjct: 449  PMLENANPLEKLKELVETTVDLEAYEETNEFMIKVEFNEQLSIIRTHLDELKDAIRTIHL 508

Query: 808  -----------KQFKCSNIQYKDSGKEIYTIEIPISATKNVPSN--WVQMAANKTYKRYY 854
                       K+ K  N          + + +  +  K +  +  +++++  K    + 
Sbjct: 509  DTADDLGFDPEKKLKLENHHLHG-----WCMRLTRNDAKALRQHKKYIELSTVKAGIFFS 563

Query: 855  SDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAIS----NIDCLLA 910
            + E++ +A   +E ++ ++  +  L   +           + P ++ +S     +D L +
Sbjct: 564  TKELKNIAEETSELQKKYEQQQASLVKEI-----VSITLSYTPVLEKLSVVTAQLDILCS 618

Query: 911  ITRTSEYLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIEL 970
              + S Y   P  RP +    D    T+L       + RHP   +       FI ND++L
Sbjct: 619  FAQVSSYAPIPYVRPKMYPLNDQNRTTEL------IASRHPIVEMQDDVT--FISNDVKL 670

Query: 971  GKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDN 1030
             +      ++TG N  GKST +R   +  +MAQ+GC+VPC+ A +  +D I+ R+GA D+
Sbjct: 671  VQGDSEFIVITGPNMGGKSTYIRQIGVICLMAQIGCFVPCDEAKIAAVDAILCRVGAGDS 730

Query: 1031 IMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQSL 1090
             ++G STF +E+ ET  IL  AT+ SL++VDELGRG S+ DGF +A S+  H+AT+I   
Sbjct: 731  QLKGVSTFMMEMLETASILKNATHNSLVIVDELGRGTSTYDGFGLAWSISEHIATNINCF 790

Query: 1091 GFFATHYGTLASSFKHHPQVRPLKMSILV-DEATRN---VTFLYKMLEGQSEGSFGMHVA 1146
              FATH+  L +       V  + +   + D  + N   +T LYK+  G S+ SFG+HVA
Sbjct: 791  TLFATHFHELTTLADKLDNVSNMHVVAHIEDNGSHNSDDITLLYKVEAGSSDQSFGIHVA 850

Query: 1147 SMCGISKEIIDNAQIAADNLE 1167
             +     +I++ A+  A  LE
Sbjct: 851  EVVQFPSKIVNMAKRKAAELE 871

>AFR603C [3795] [Homologous to ScYOL090W (MSH2) - SH]
            (1524851..1527721) [2871 bp, 956 aa]
          Length = 956

 Score =  196 bits (497), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 163/600 (27%), Positives = 277/600 (46%), Gaps = 68/600 (11%)

Query: 614  MVLDGITLQNLEIF------------SNSFDGSDKGT-LFKLFNRAITPMGKRMMKKWLM 660
            M LD   ++ L IF            S  F G+ K T L +L N+  T  G R++ +WL 
Sbjct: 294  MKLDASAVKALSIFPQGPSTQSGMATSGKFGGNGKITSLLQLLNKCKTNAGVRLLNEWLK 353

Query: 661  HPLLRKNDIESRLDSVDSLLQDITLREQLEITFSKL-PDLERMLARIHSR-----TIKVK 714
             PL  K  IE R + VD L+  + LR  L   +  L PD+ R+  +++        +KV 
Sbjct: 354  QPLSDKGSIEKRHNLVDYLVDQLELRSILRDDYLPLVPDVRRLTKKLNRNGSLEDVLKVY 413

Query: 715  DFEKVITAFETII-ELQDSLKNNDLKGDVSKYISSFPEGLVEAVKSW---------TNAF 764
             F + I     ++ E  D+L       D+   + ++   L E V+           T   
Sbjct: 414  QFAQRIPEINGVLKENLDALSEGSHVKDL--VLETWYNPLNEHVEPLHKFQEMVETTVDL 471

Query: 765  ERQKAINENIIVPQRGFDIEFDKSMDRIQ----ELEDELMEILMTY--------RKQFKC 812
            E  +  NE +I       +EF+  + RI+    +L+D++  I +           K+ K 
Sbjct: 472  EAYEETNEFMI------KVEFNDELARIRTELVDLKDKIRTIHLDTSDDLGFDPEKKLKL 525

Query: 813  SNIQYKDSGKEIYTIEIPISATKNVPSN--WVQMAANKTYKRYYSDEVRALARSMAEAKE 870
             N          + + +  +  K +  +  +++++  K    + + E++ L+  +   ++
Sbjct: 526  ENHHVHG-----WCMRLTRNDAKALRQHKKYLELSTVKAGIYFSTKELKLLSDEIGTLQQ 580

Query: 871  IHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNIDCLLAITRTSEYLGAPSCRPTIVDE 930
             +   +  L   +       Y+ +       ++N+D L +    S Y   P  RP + D 
Sbjct: 581  DYDRKQSALVKEIV-TITLSYSPVLEKLSLVLANLDVLCSFAHVSSYAPIPYVRPVMYDM 639

Query: 931  VDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIELGKEQPRLGLLTGANAAGKST 990
               +   +L       + RHP     A     FI ND+ L  +     ++TG N  GKST
Sbjct: 640  HAGQRKMEL------LASRHPLVE--AQDEVTFISNDVVLEADSSGFAIITGPNMGGKST 691

Query: 991  ILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIMQGKSTFFVELAETKKILD 1050
             +R   +  ++AQ+GC+VPC++A +T +D I+ R+GA D+ ++G STF  E+ ET  IL 
Sbjct: 692  YIRQVGVICLLAQIGCFVPCDAAEITIVDAILCRVGAGDSQLKGVSTFMAEMLETASILR 751

Query: 1051 MATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQSLGFFATHYGTLASSFKHHPQV 1110
             AT  SL+++DELGRG S+ DGF +A S+  H+A +I     FATH+  L +     P V
Sbjct: 752  NATKNSLIIIDELGRGTSTYDGFGLAWSISEHIAKNIGCFALFATHFHELTALADDCPNV 811

Query: 1111 RPLKMSILVDEATR---NVTFLYKMLEGQSEGSFGMHVASMCGISKEIIDNAQIAADNLE 1167
              L +   V+E +    ++T LYK+  G S+ SFG+HVA +     +I+  A+  A  L+
Sbjct: 812  TNLHVVAHVEEKSHKSDDITLLYKVEPGISDQSFGIHVAEVVQFPSKIVKMAKRKATELD 871

>Scas_720.102
          Length = 1038

 Score =  193 bits (490), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 173/601 (28%), Positives = 285/601 (47%), Gaps = 90/601 (14%)

Query: 607  FVKSQHSMVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAITPMGKRMMKKWLMHPLLRK 666
            F+ +QH M L   TL+ L+I  N  DG +KG+L  L +   T  G R ++ W++HPL   
Sbjct: 434  FLANQH-MTLSDSTLEGLDILRN--DG-EKGSLLWLLDHTRTSFGLRKLRDWVLHPLRTI 489

Query: 667  NDIESRLDSVDSLLQDIT--LREQLEITFSKLPDLERMLARI---HSRTIKVKDFEKVIT 721
            + IE RLD+++ +L++I     E        LPDL R L RI   H+   +V  F K + 
Sbjct: 490  DKIEERLDAIECILKEINCIFLESFNQLLKGLPDLLRTLNRIAYGHTSKKEVYFFLKQMC 549

Query: 722  A----FETI--------------IELQDSLKNNDLKGDVSKYISS-FPE--GLVEAVKSW 760
            +    F+T               I  Q  L  + LK   + Y  +  P+   ++      
Sbjct: 550  SIGDHFKTHSSYIKEQVLSPDGRINKQSQLLTSILKDIENNYQETHLPQLFAMINVAAVM 609

Query: 761  TNAFERQKA--INEN-------IIVPQRGFDIEFDKSMDRIQELEDELMEILMTYRKQFK 811
                E QK    N N       II  QR  DIE  KS     +L  EL  I    RK   
Sbjct: 610  NKNLENQKTEFFNLNNYDNPDGIIKIQR--DIEDVKS-----DLSAELKHI----RKVLG 658

Query: 812  CSNIQYKDSGKEIYTIEIPISATKNVPSNWVQMAANKTYKRYYSDEVRALARSMAEAKEI 871
               + YKD  +  Y IE+  +   N+PS+W+++       R+ +     L   +    + 
Sbjct: 659  RPYLNYKDEIE--YLIEVKNTQVTNLPSDWIKINNTLKISRFATPTTTKLVEKL----QF 712

Query: 872  HKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNI---DCLLAITRTSEYLGAPSC----- 923
            HK L      +  Q+F +  N  ++     I NI   DCLL+       L A SC     
Sbjct: 713  HKDLLVQEVEKEYQRFLSKINDEYIRLRNIIENIATYDCLLS-------LSAVSCNIKYT 765

Query: 924  RPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIELGKEQPRLGLLTGA 983
            RP   +E            +K K  R+P      +   +++PND ++ ++   + +++G 
Sbjct: 766  RPIFSNE---------KQVIKLKGARNPII---ESLDINYVPNDTDMNRKDGLINIISGP 813

Query: 984  NAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIMQGKSTFFVELA 1043
            N  GKS+ +R   + +I+AQ+G +VP +   ++  D I+TR+GA+D++++G+STF  E+ 
Sbjct: 814  NMGGKSSYIRQVALLIILAQIGSFVPADYMEVSIFDNILTRIGAHDDLLRGESTFKKEML 873

Query: 1044 ETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQS-LGFFATHYGTLAS 1102
            +  ++L+  T  SL+++DE+GRG  + DG AI+ S++++        L  F +H+  L +
Sbjct: 874  DVLQVLENCTKDSLVLLDEVGRGTGTLDGKAISYSLINYFMEETDCPLILFTSHFPILGT 933

Query: 1103 SFKHHPQVRPLKMSILVD----EATRNVTFLYKMLEGQSEGSFGMHVASMCGISKEIIDN 1158
                 P V+   M  + +    E   +VTFLYK+  G +  S+G++VA +  I K+II+ 
Sbjct: 934  I--KSPLVKCYHMDYVEEKRPGENWSSVTFLYKLKSGFTTNSYGLNVAKLASIDKDIINE 991

Query: 1159 A 1159
            A
Sbjct: 992  A 992

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 48/240 (20%), Positives = 98/240 (40%), Gaps = 42/240 (17%)

Query: 197 LAEDSGDDDDLISLAETTSKKKFSYNTSHSSSPFTRNISRDNSKKKSRPNQAPSRSYNPS 256
           +++ + + +D +        K   Y+    +SP T   +  +++K+SR N A        
Sbjct: 67  VSDSNLEKNDTVKCGTIELHKNIPYSMDAEASPETTREASKSTRKRSRNNVA-------- 118

Query: 257 HSQPSATSKSSKFNKQNEERYQWLVDERDAQRRPKSDPEYDPRTLYIPSSAWNKFTPFEK 316
                  +KS + N + E+R    V E D  R         P        + +K TP ++
Sbjct: 119 -------AKSLEENVEPEQR----VPENDDVR---------PSRKKKAKISKSKLTPLDQ 158

Query: 317 QYWEIKSKMWDCIVFFKKGKFFELYEKDALLANALFDLKIAGG----------GRANMQL 366
           Q  E+KS   + ++  + G  ++ + +DA++A+ +  +K+  G           + + Q 
Sbjct: 159 QIQELKSIHKNKLLVVRVGYKYKCFAEDAIIASKILKIKLVPGKLTIDESNPADKDHKQF 218

Query: 367 A--GIPEMSFEYWAAQFIQMGYKVAKVDQRESMLAKEMREGSKG--IVKRELQCILTSGT 422
           A    P+        + I    KV  V+Q E+   K+  + S    + +R++  I +  T
Sbjct: 219 AYCSFPDTRLNVHLERLIYNNCKVGVVEQAETSAIKKNSQTSNKSQVFERKITGIFSKAT 278

>KLLA0F24156g 2251454..2254276 similar to sp|P25846 Saccharomyces
            cerevisiae YHR120w MSH1 DNA mismatch repair protein,
            mitochondrial, hypothetical start
          Length = 940

 Score =  162 bits (410), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 217/936 (23%), Positives = 381/936 (40%), Gaps = 154/936 (16%)

Query: 309  NKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDALLANALFDLKIAGGG--RANMQL 366
            N   P  +   ++  K    +V  + G F+ELY + A +   + ++ +         +  
Sbjct: 67   NSLPPSLQYVRDVMDKYTGHVVLTQIGSFYELYFEHATIYAPILNITLTSKSIVSGKVPF 126

Query: 367  AGIPEMSFEYWAAQFI-QMGYKVAKVDQRESMLAKEMREGSKGIVKRELQCILTSGTLTD 425
            AG P           + Q GY VA  DQ +    + + +  K    R +  I+T GT  D
Sbjct: 127  AGFPLNQLNRHLKVLVKQYGYSVAVCDQFKH---ETLVDNDKNKFMRRVTRIVTPGTFID 183

Query: 426  GDMLHSDLATFCLAIREEPGNFYNETQLDSSTIVQKLNTKIFGAAFIDTATGELQMLEFE 485
                +     + L +       ++E  +  +     LN  + G ++ D +TGE+    F 
Sbjct: 184  EAFENFQENQYLLTVH------FSENCMKRAA---DLNIPV-GLSWCDISTGEI----FV 229

Query: 486  DDSECTKLDTLMSQVRPMEVVMERNNLSTLANKIVKFNSAPNAIFNEVKAGEEFYDCDKT 545
                   L + ++++RPMEV+++   +                   E+  GE +    K 
Sbjct: 230  QQVYLKDLVSSITRIRPMEVLLDEEIMPV-----------------EITNGEWY----KE 268

Query: 546  YAEIISSEYFSTEEDWP---EVLKSYYDTGKKVGFSAFGGXXXXXXXXXXXXXXISMKNI 602
              E+   +YF   +  P     ++S++       FS   G               +++N+
Sbjct: 269  LTEL--KKYFIKYQKMPSKHRPIQSFFKL-----FSNAEGDIGRSLGNFTQKEIAALRNL 321

Query: 603  KEY----------DFVKSQHSMV-----LDGITLQNLEIFSNSFDGSDKGTLFKLFNRAI 647
              Y          +    Q  ++     +D  T   LE+ S       KG+L     R +
Sbjct: 322  LLYIEEHLPDINTNLELPQKQLITDIMQIDSRTSTALELHSTMRKHHKKGSLLSTIRRTV 381

Query: 648  TPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDITLREQLEITFSKLPDLERMLARIH 707
            T  G R++ +WL  P +  N+I++R   V     +    E L     +  D+ R++ R  
Sbjct: 382  TTSGTRLLTQWLSAPSMDINEIKNRQSLVLLFKDNFDYTESLIRYLKETADMSRIIQRFS 441

Query: 708  SRTIKVKDFEKVITAFETIIELQDSLKNN---------DLKGDVSKYISSFPEGLVEAV- 757
                   +  ++  +     E+ + L+ N          L  +++K + +F + +VE V 
Sbjct: 442  FGRGDPLELIQIAKSLRKCKEISEYLQTNVHPSTKKTEKLIKNITKQL-NFEDPIVEKVI 500

Query: 758  ---------KSWTNAFERQ-----KAINEN--------IIVPQRGFDI-EFDKSMD-RIQ 793
                     K W+  +ER       A  EN        I+ P     + E+ KS +  I+
Sbjct: 501  SSLNEESLIKQWSEKYERDDEEKFDASEENQERKSLVMIMKPSASQKLKEYYKSYNILIK 560

Query: 794  ELEDELMEILMTYRKQFKCSNIQYKDSGKEIYTIEIPISATKNVP--------------- 838
            E E  L      + ++FK  N+  K      + I +  S    V                
Sbjct: 561  EKESLLQWYKDWFLERFKLKNVSLKQKNSGEFCIHLSGSIANVVEFDKYIEQQKDSSQAH 620

Query: 839  SNWVQMAANKTYKRYYSDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPT 898
            S +  +  ++  +    D+   L+R +     + K  EE L N+  + F +       P 
Sbjct: 621  SGFHVLQKSRQTRWIIHDKWETLSREIEVVGALIKNEEERLINQFQKDFIS-----LSPM 675

Query: 899  IQAISN----IDCLLAITRTS--EYLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPC 952
            I+++S     +D L +  + +  + L  P               T+LN     K  RH  
Sbjct: 676  IRSLSQTLDYMDVLTSFAKLAIEQRLVLPKV----------TQGTELN----IKGGRHLV 721

Query: 953  F--NLGATTAKDFIPNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPC 1010
               ++   + + F PND ++   +  L ++TG N  GKST LR   I VI+AQ+G +VPC
Sbjct: 722  VEASISQKSLESFTPNDCQINSGE--LWVITGPNMGGKSTFLRQNAIIVILAQIGSFVPC 779

Query: 1011 ESAVLTPIDRIMTRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSS 1070
            ESAV+  +D+I +R+G+ D++    STF VE+ ET  IL  ATNRS+ ++DE+GRG S S
Sbjct: 780  ESAVIGLVDKIFSRVGSADDLYNEMSTFMVEMIETSYILKGATNRSMAILDEIGRGTSRS 839

Query: 1071 DGFAIAESVLHHVATHIQSLGFFATHYGT-LASSFKHHP------QVRPLKMSILVDEAT 1123
            +G AIA + L ++ T+      FATH+GT LAS+            +   K  I+ D + 
Sbjct: 840  EGVAIAYATLKYLTTNNACRALFATHFGTELASTINSTSNEEFINNISFFKTGIIGDNS- 898

Query: 1124 RNVTFLYKMLEGQSEGSFGMHVASMCGISKEIIDNA 1159
             N  + +K+  G    S  + VA + G  +E ++ A
Sbjct: 899  -NFYYDHKLKPGICSKSDAIKVAKLAGFPEEALEIA 933

>Scas_544.2
          Length = 874

 Score =  150 bits (380), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 159/610 (26%), Positives = 264/610 (43%), Gaps = 98/610 (16%)

Query: 620  TLQNLEIFSNSFDGSDKG------TLFKLFNRAITPMGKRMMKKWLMHPLLRKNDIESRL 673
            +LQ L IF  +  G+DK       ++ +L N       K ++K WL+ PL +K +IE+R 
Sbjct: 220  SLQILPIFKKT--GTDKTIGKRDMSILELLNHVSNGYSKNILKSWLLAPLRKKKEIETRY 277

Query: 674  DSVDSLL--QDITLREQLEITFSKLPDLERMLARIHSRTIKVKDFEKVITAFETIIELQD 731
            D VD  L   +    E+++  F   PDL  +L ++      V  +  ++   E  I L D
Sbjct: 278  DVVDIFLGKNNSLFFEEIQEIFKGFPDLFNILKQLQHGNESVTIWTNLVQFLERAIRLTD 337

Query: 732  SLKNNDL----KGDVSKYISSFP----EGLVEAVKSWTNAFERQKAINENIIVPQRGFDI 783
             L   D+    +  + + IS+      + L+  VK  T  FE  K   E  IV   G + 
Sbjct: 338  CLSKLDIVSTSENLIRRIISNVDLTVFKTLLRKVKQ-TIDFETSKYNKE--IVLIEGINE 394

Query: 784  EFDKSMDRIQELEDELMEILMTYRKQF----------------KCSNIQYKDSGKEIYTI 827
              D+      ELE  L EI                        K  N  Y      + T+
Sbjct: 395  RLDQHKLIYNELEVILTEIAKQAENDLFQNLMERNVSPDMTRDKIVNAVYIPQLGYLVTV 454

Query: 828  EIPISATKNVPSN--WVQMAANKTYKRYYSDEVRALAR---------SMAEAKEIHKTLE 876
            +  I    ++ +   W ++    T   Y ++ V  L +         S  E + +H   E
Sbjct: 455  DSVIQELSDITTQLGWNEVFRTNTDLFYKNEAVLQLDQKYGDIYASISDLEVEVLHSLQE 514

Query: 877  EDLKNRLCQKFDAHYNTIWMPTIQAISNIDCLLAITRTSEYLGAPSCRPTIVDEVDSKTN 936
              +K RL            M   Q  + ++ L++    S+  G    RP + ++      
Sbjct: 515  CVIKERL----------KLMEYFQLFAQLEVLVSFAYISQRNGYV--RPELSED------ 556

Query: 937  TQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIEL----------GKE-QPRLGLLTGANA 985
                  L  KS RHP +         +IPND+EL           +E   R+G++TGANA
Sbjct: 557  ---ECVLDIKSGRHPLYE---NIVDTYIPNDLELLGGSFDDTSWSREGNKRIGIITGANA 610

Query: 986  AGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIMQGKSTFFVELAET 1045
            +GKS  L    + V +A +GC+VPC+SA +  +DRI+TR    D +   KS+F ++  + 
Sbjct: 611  SGKSVFLIQTGLIVYLAHIGCFVPCDSARIGLVDRILTRTRTQDTVSLLKSSFELDSLQM 670

Query: 1046 KKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQSLGFFA-THYGTLASS- 1103
             + L   + +SL+++DE G+G    DG ++  +++  +A         A TH+  L ++ 
Sbjct: 671  ARCLSQMSKKSLILIDEFGKGTDIIDGPSLFGAIIQQLAESKDCPRVLACTHFHELFNTD 730

Query: 1104 --FKHHPQVRPLKMSILVDEA---------TRNV--TFLYKMLEGQSEGSFGMHVASMCG 1150
               +  P V      +L+++A          +NV  TFLY++ EG S  SFG++ A +CG
Sbjct: 731  VLDEAFPGVNYYMTQVLLNQAHISSSRDTLCKNVGITFLYRIKEGISRQSFGVYCAKICG 790

Query: 1151 ISKEIIDNAQ 1160
            I + I+  A+
Sbjct: 791  IKESIVKRAE 800

>KLLA0F11022g complement(1016214..1018880) similar to sp|P40965
            Saccharomyces cerevisiae YFL003c MSH4 meiosis-specific
            protein, start by similarity
          Length = 888

 Score =  136 bits (342), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 157/709 (22%), Positives = 301/709 (42%), Gaps = 64/709 (9%)

Query: 468  GAAFIDTATGELQMLEFEDDSECTKLDTLMSQVRPMEVVMERNNLSTLANK---IVKFNS 524
            G   ++ +T E+ + EF D     K    +   +P E+++  ++LS   +K   IVK N 
Sbjct: 130  GICVVNYSTAEMHVSEFIDTQVFIKTLNKIYVCQPTEILIPSHSLSGKVSKLSTIVKCNI 189

Query: 525  APNAIFNEVKAGEEFYDCDKTYAEIISSEYFSTEED---WPEVLKSYYDTGKKVGFSAFG 581
            + N    E  A  + Y+  +    +       T +    + E L      GK+    A  
Sbjct: 190  SDNVKICE--AATKVYNPQEGLEVLEKFALLGTNKSPVPFAEQL-----IGKEFCLMAVS 242

Query: 582  GXXXXXXXXXXXXXXISMKNIKEYDFVKSQHSMVLDGITLQNLEIFSNSFDGSDKGTLFK 641
                           +   N +        ++M++D  T+Q+LE+  N+ + S+  TL K
Sbjct: 243  AASNYMTQIAEADLALKFSNFR-VRIDNGDNTMLIDMKTVQSLELIENTLE-SNGMTLLK 300

Query: 642  LFNRAITPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDITLREQLEITFSKLPDLER 701
            + ++ +T MG R ++  ++ PL   N ++ R+ +V  L  +        +    L DL+ 
Sbjct: 301  VIDKTVTKMGHRALRNDILQPLTDINSLKLRVSAVQELQNNPDFLNSFRMELKVLHDLDA 360

Query: 702  MLARI----HSRTIKVKDFEKVITAFETIIELQDSLKN--------NDLKGDVSKYISSF 749
            + +++    H+  +  +    VI   E+I E   +LK         + L  ++    SS 
Sbjct: 361  LFSKLLSFNHTVILPDQKLNYVILLKESI-ESATTLKRLFEESKFESKLLSEIMAIFSSD 419

Query: 750  P-EGLVEAVKSWTNAFERQKAI-----NENIIVPQRGFDIEFDKSMDRIQELEDELMEIL 803
                + + +  + N   R  +      N+     +RG +   D      + L D++M  +
Sbjct: 420  DISSIFDLINRYLNEDTRWASTPIDLQNQKAYAIKRGSNGLLDVLRQLYKSLTDDIMREV 479

Query: 804  MTYRKQFKCSNIQYKDSGKEIYTI--EIPISATKNVPSNWVQMAANKTYKRYYSDEVRAL 861
             + R +F  +     D  ++ Y    +  I+   ++ S ++     KT   + +  +  +
Sbjct: 480  DSLRDKFGLNFSHGHDVNRQFYLKLKKKDINQLSDLDSCFINRVTKKTAYEFTTLNLMKM 539

Query: 862  ARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNIDCLLAITRTSEYLGAP 921
               ++E       L E   + L     +H  T++M + +AIS +D L ++  T       
Sbjct: 540  NTRLSELTCEMIALSEQTVSELLSNISSHIATLFMIS-EAISVLDLLCSLATTG------ 592

Query: 922  SCRPTIVDEVDSKTNTQLNGF---LKFKSLRHPCFNLGATTAKDFIPNDIELGKEQPRLG 978
                        + N  L  F   L     RHP       T  +F+ ND+E         
Sbjct: 593  -----------LENNWILASFGNHLSLSGARHPILE---NTLTNFVANDVEAIPNLSSFQ 638

Query: 979  LLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIMQGKSTF 1038
            ++TG N +GKS  L+   +  I+AQ+GC VPC SA      ++  R+  ND+I    STF
Sbjct: 639  IVTGCNMSGKSIYLKQVAMLTILAQIGCPVPCTSASFPLYQKLHARV-CNDDIEAYSSTF 697

Query: 1039 FVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQSLGFFATHYG 1098
              E+ +    +D  T+++L+++DELGRG S +DGF+IA ++  ++ +   ++ F +TH+ 
Sbjct: 698  SAEMKDMAYFIDDITDKTLMILDELGRGSSIADGFSIALAISEYLLSKNATV-FLSTHFR 756

Query: 1099 TLASSFKHHPQVRPLKMSILVDEATRNVTFLYKM-LEGQSEGSFGMHVA 1146
             +       P+V  L+M   +D+ + ++   YK   E +    +GM + 
Sbjct: 757  DIPKILAPKPRVLHLEMKTEIDQES-HLKMKYKASTESEEIEGYGMMIC 804

>Sklu_1903.3 YFL003C, Contig c1903 4902-7601
          Length = 899

 Score =  132 bits (331), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 164/724 (22%), Positives = 304/724 (41%), Gaps = 66/724 (9%)

Query: 467  FGAAFIDTATGELQMLEFEDDSECTKLDTLMSQVRPMEVVMERN----NLSTLANKIVKF 522
             G   I+ +TGE+ + +F D     +    +   +P E+++  +    N+S LA  I+KF
Sbjct: 140  IGLCVINYSTGEMIISDFMDSQIFIRTVHKIQIHQPTEILLPSSSFLPNISKLAT-IIKF 198

Query: 523  NSAPNAIFNEVKAGEEFYDCDKTYAEIISSEYFSTEEDWPEVLKSYYDTGKKVGFSAFGG 582
            N + +     ++A  + Y+  +    I     F   E    V K           SA   
Sbjct: 199  NVSGSV--KVIEASLKHYNSQEGLTAIEEYGLFIGNEKNLTVEKFVDKKFALCAVSAAIK 256

Query: 583  XXXXXXXXXXXXXXISMKNIKEYDFVKSQHSMVLDGITLQNLEIFSNSFDGSDKG-TLFK 641
                           S +N++   +  ++++M++D  T + LE+  N+ +   KG +LFK
Sbjct: 257  HTKRISTSRISNESYSFQNLR-IKYEGTENTMLIDPRTSKGLELVENALE--KKGMSLFK 313

Query: 642  LFNRAITPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDITLREQLEITFSKLPDLER 701
              +  +T MGKR ++  ++ PL +++ I  RL  V  L  +  L   L        DL+ 
Sbjct: 314  FLDSTVTKMGKRALRNNILQPLTQEDGIIMRLQCVVELQDNSQLLGDLRAEMRSCQDLDA 373

Query: 702  MLARI----HSRTIKVKDFEKVIT---AFETIIELQDSLKNNDLKGDVSKYISSFPEG-L 753
            + +++    H+     +    VI    + E   +L   L+NN ++  + K +    +   
Sbjct: 374  LYSKLLSADHAAIRPDQKLNYVILLKDSIELASKLGSLLENNKVESRLLKEVKEICQNDA 433

Query: 754  VEAVKSWTNAFERQKAINENIIVPQRGFDIEFDKSMDRIQELEDELMEILMTYRK----- 808
            +E ++   + +     IN++        D++  +S   ++   + L+++     K     
Sbjct: 434  IEDIRELISTY-----INDDCTWASTNLDLQNQRSY-AVKSGANGLLDVSRQIYKGIIDD 487

Query: 809  ---------QFKCSNIQYKDSGKEIYTIEIP---ISATKNVPSNWVQMAANKTYKRYYSD 856
                     Q    N+Q+       + +++    I+    +   ++     K Y  + + 
Sbjct: 488  IINEIESLSQRHSLNLQHSYDSTRGFFVKLKRQGITDISKLAPVFINKVVKKNYVEFTTL 547

Query: 857  EVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNIDCLLAITRTSE 916
            ++  L   + E       + E +   L +      + ++M   +A+S +D L      S 
Sbjct: 548  QITKLNARLDEVMSEIMLISEQIVQELLKAIVKKISVLFMIA-EAVSILDLLSCFAYNSA 606

Query: 917  YLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIELGKEQPR 976
                  C P            + +  + FKS RHP         K FIPND    KE   
Sbjct: 607  --ENNYCIP------------EFSNKMVFKSARHPILE---KFLKKFIPNDTVSIKESSA 649

Query: 977  LGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIMQGKS 1036
            + ++TG NA+GKS  L+   I  IMAQMG  VP + A     +R+  R+  ND I    S
Sbjct: 650  IQIITGCNASGKSVYLKQIAILNIMAQMGSPVPADYACFPIFNRLHARV-CNDTIEVNSS 708

Query: 1037 TFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQSLGFFATH 1096
            TF  E+ E    L    + +L+V+DELGRG S  DGFA++ ++  H+ +  +   F +TH
Sbjct: 709  TFSSEMKEMAYFLHDIDSNTLMVLDELGRGSSIGDGFAVSLAITEHLVS-TKCTAFISTH 767

Query: 1097 YGTLASSFKHHPQVRPLKMSILVDEATRNVTFLYKMLEGQSE-GSFGMHVASMCGISKEI 1155
            +  +       P V  L+M+   +   +++T  YK+    S   ++G+ V       +EI
Sbjct: 768  FRDIPEILTSKPSVVHLQMT--AEVVDKSLTMHYKVSRTTSGIKNYGLRVVQNL-FPREI 824

Query: 1156 IDNA 1159
            +DNA
Sbjct: 825  MDNA 828

>ABR137W [729] [Homologous to ScYHR120W (MSH1) - SH]
            complement(653115..655982) [2868 bp, 955 aa]
          Length = 955

 Score =  131 bits (330), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 113/204 (55%), Gaps = 7/204 (3%)

Query: 962  DFIPNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRI 1021
            +F  ND  L  +   + ++TG N  GKST LR   I VI+AQ+GCYVPC SA +  +D+I
Sbjct: 747  NFTANDCSL--QNGDIWIVTGPNMGGKSTFLRQTAIIVILAQIGCYVPCASAHIGLVDKI 804

Query: 1022 MTRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLH 1081
             +R+G+ D++    STF VE+ E+  +L  AT RSL ++DE+GRG ++ DG  IA + LH
Sbjct: 805  FSRVGSADDLYNDMSTFMVEMLESSFMLKGATKRSLAILDEIGRGTNAEDGVGIAYTTLH 864

Query: 1082 HVATHIQSLGFFATHYGTLASSF--KHHPQVRPLKMSIL---VDEATRNVTFLYKMLEGQ 1136
            H+ T  +    FA+H+G   S    +H P     ++      V E      + +K+  G 
Sbjct: 865  HMLTKNRCRALFASHFGRELSELVEQHLPPGARKRVHFYRTNVREHNGRSFYDHKITPGI 924

Query: 1137 SEGSFGMHVASMCGISKEIIDNAQ 1160
               S  + VA M G  +E +D A+
Sbjct: 925  CLSSDAIRVAQMAGFPQEALDVAR 948

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 98/476 (20%), Positives = 178/476 (37%), Gaps = 71/476 (14%)

Query: 309 NKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELY----EKDALLANALFDLKIAGGGRANM 364
           N   P  +   ++  K  D ++  + G F+ELY    EK A   N     +    G+  +
Sbjct: 71  NSLPPSLQFVRDMMDKYPDYVLLTQMGSFYELYYEHAEKYAPKLNITLTRREYSHGK--V 128

Query: 365 QLAGIP-EMSFEYWAAQFIQMGYKVAKVDQRESMLAKEMREGSKGIVKRELQCILTSGTL 423
             AG P E    +      + GY VA V+Q       ++ +  +    R +  ++T GT 
Sbjct: 129 PFAGFPLEQLSRHLKVLVKEYGYSVAVVEQ---FRKDDIADNERYKFNRRVTRVVTPGTF 185

Query: 424 TDGDMLHSDLATFCLAIREEPGNFYNETQLDSSTIVQKLNTKIFGAAFIDTATGELQMLE 483
            D    +     F L++ E P     E   D S  V        G ++ D +TGEL    
Sbjct: 186 IDEAFENLQENQFLLSV-EFPDRCM-EKLSDPSIKV--------GLSWCDISTGEL---- 231

Query: 484 FEDDSECTKLDTLMSQVRPMEVVMERNNLSTLANKIVKFNSAPNAIFNEVKAGEEFYDCD 543
           F    +   L + +++++P E+++  +    LA +I   N  P      V+  + F    
Sbjct: 232 FVQQVQLKGLISAITKIKPREILLSED---LLAYQIQNGNWYPEL----VEFKKYFIKYY 284

Query: 544 KTYAEIISSEYFSTEEDWPEVLKSYYDTGKKVGFSAFGGXXXXXXXXXXXXXXISMKN-- 601
           KT +   + E FS                      AFG               +S K   
Sbjct: 285 KTPSRHRTMETFS-------------------HLFAFGANNASKRNLDIVLHSLSQKETA 325

Query: 602 ----------------IKEYDFVK---SQHSMVLDGITLQNLEIFSNSFDGSDKGTLFKL 642
                           +    F K   +  SM +D  T   LE+ +   D   +G+L   
Sbjct: 326 ALRANLTYIEQHLPEMLANLAFPKRSLTTDSMQIDSRTSAALELHNTFRDNLKRGSLLSA 385

Query: 643 FNRAITPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDITLREQLEITFSKLPDLERM 702
             R +TP G R++ +WL  P +  ++I+ R + V   +Q+  + + L        D+ R+
Sbjct: 386 IRRTVTPSGTRLLTQWLSAPSMHLDEIKQRQNLVRLFMQNPFVTDNLIAQLKATADMTRI 445

Query: 703 LARIHSRTIKVKDFEKVITAFETIIELQDSLKNNDLKGDVSKYISSFPEGLVEAVK 758
           L +   +        ++  + +    + D+++    +  +SK  SS  + L  A++
Sbjct: 446 LQKFSFKRGDAAHLLQMAQSLQQCSAIGDTIQLIYTRRTISKGFSSCLDKLSSALR 501

>YFL003C (MSH4) [1678] chr6 complement(134516..137152)
            Meiosis-specific protein homologous to E. coli MutS [2637
            bp, 878 aa]
          Length = 878

 Score =  129 bits (325), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 154/687 (22%), Positives = 289/687 (42%), Gaps = 70/687 (10%)

Query: 462  LNTKIFGAAFIDTATGELQMLEFEDDSECTKLDTLMSQVRPMEVVMERNNLSTLANKI-- 519
            ++T+I G   I+  TG++ + +F D     ++   +   +P E+++  ++L+   +K+  
Sbjct: 116  ISTRI-GLCIINCNTGQMYLSDFMDSQIYIRVVHKLQIYQPTEILIPSSSLAPTVSKLAT 174

Query: 520  -VKFNSAPNAIFNEVKAGEEFYDCDKTYAEIISSEYFSTEEDWPEVLKSYYDTGKKVGFS 578
             +KFN A      E     + ++     A I       T++D    LK      K     
Sbjct: 175  MIKFNVAETVKIEE--GSRKCFNSQDGLAAITKYLMDDTKKD----LKIEEIIDKTFALC 228

Query: 579  AFGGXXXXXXXXXXXXXXISMKNIKEY-----DFVKSQHSMVLDGITLQNLEIFSNSFDG 633
            A                  S +N+  +      F  ++++M++D  T++ LE+  N  D 
Sbjct: 229  AASAAISYMEEIISK----SSRNLNAFRKLRIQFEGTENTMLIDSKTVRGLELVENKLD- 283

Query: 634  SDKGTLFKLFNRAITPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDITLREQLEITF 693
             +  +L+K  +   T MG+R ++  ++ PL  +  IE RL++++ L  +  L ++L +  
Sbjct: 284  KNGISLWKFLDTTSTKMGQRSLRNSILQPLTDRGSIEMRLEALEELKANDDLLQKLRLEM 343

Query: 694  SKLPDLERMLARI----HSRTIKVKDFEKVITAFET---IIELQDSLKNNDLKGD-VSKY 745
              LPDL+++ +R+    HS     +    V+   ET   +  L+D+L +  ++   +S+ 
Sbjct: 344  KSLPDLDKLFSRLLCINHSAIKPDQRINYVLLLKETLQSVKSLKDALNDQLIQSRLISET 403

Query: 746  ISSFPEGLVEAVKSWTNAFERQKAINENII--------VPQRGFDIE------FDKSMDR 791
               F    +  ++   N+      INE+ +        + QR + ++       D S   
Sbjct: 404  KKIFNNDAIMEIEKLINS-----CINEDCVWASSAIQLLNQRSYAVKSDSNGLLDVSRQI 458

Query: 792  IQELEDELMEILMTYRKQFKCSNIQYKDSGKEIYTIEIPISATKNV---PSNWVQMAANK 848
             +E+++E    +     + K +     DS +  Y        T +V   P  ++     K
Sbjct: 459  YKEVKEEFFREVEDLTAKNKINLDHNYDSARGFYLRIKRQEFTDDVATLPDVFISRTIKK 518

Query: 849  TYKRYYSDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNIDCL 908
             Y    +  +      + E  E    L E+  + L  K   H + ++M   +A++ +D +
Sbjct: 519  NYIECTTLNIIKKNARLKEVMEEILLLSEETVDELLDKIATHISELFMIA-EAVAILDLV 577

Query: 909  LAITRTSEYLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDI 968
                          C  T   + ++ T       L  +  RHP   L     K+F+PN I
Sbjct: 578  --------------CSFTYNLKENNYTIPIFTNNLLIRDSRHP---LLEKVLKNFVPNTI 620

Query: 969  ELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGAN 1028
               K    L ++TG N +GKS  L+   +  IMAQMG  +P          R+  R+  N
Sbjct: 621  SSTKHSSSLQIITGCNMSGKSVYLKQVALICIMAQMGSGIPALYGSFPVFKRLHARV-CN 679

Query: 1029 DNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQ 1088
            D++    S F  E+ E    LD     +LL++DELGRG S +DGF ++ +V  H+    +
Sbjct: 680  DSMELTSSNFGFEMKEMAYFLDDINTETLLILDELGRGSSIADGFCVSLAVTEHLL-RTE 738

Query: 1089 SLGFFATHYGTLASSFKHHPQVRPLKM 1115
            +  F +TH+  +       P V  L M
Sbjct: 739  ATVFLSTHFQDIPKIMSKKPAVSHLHM 765

>KLLA0C16423g complement(1437001..1439805) similar to sp|Q12175
            Saccharomyces cerevisiae YDL154w MSH5 meiosis-specific
            protein, start by similarity
          Length = 934

 Score =  128 bits (321), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 137/605 (22%), Positives = 270/605 (44%), Gaps = 93/605 (15%)

Query: 638  TLFKLFNRAITPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLL--QDITLREQLEITFSK 695
            ++F L N   + +GKR++K WL  PL  K  IE R   + SL+  ++  L + L  +   
Sbjct: 307  SVFDLLNHTTSELGKRLLKSWLASPLSNKILIEERQKVIRSLIDGKNAILFDDLSNSLKY 366

Query: 696  LPDLERMLARIHSRTIKVKDFEKVITAFETIIE-------LQDSLKN----NDLKGDVSK 744
            +P++  ++  +    +K+  + K I+     +E       L DS  N    N +K D+ K
Sbjct: 367  MPNIFSIVNEMSKGAVKLSVWRKYISFCTKTVEIINLIHILYDSSDNCRLFNTIKNDLDK 426

Query: 745  YISSFPEGLVEAVKSWTNAFERQKAINENIIVPQ----------RGFDIEFDKSMDRI-Q 793
             +      +++ +K   +  + + ++N++ IV +          RG   E +  ++ +  
Sbjct: 427  SM------MLKILKKTESVLDLEGSLNQDAIVIKDKVRIELDEARGTYFELEGVLNLVAN 480

Query: 794  ELEDELMEILMTYR-KQFK-------CSNIQYKDSGKEIYTIEIPISATKNVPS--NWVQ 843
            E  + L+  L +   K FK         N  Y      +  ++  I    + P+   W +
Sbjct: 481  EANNTLISTLQSNEEKLFKKLNGRNALINAIYLPQLGYLLCVDASIEDMFD-PAVLYWTE 539

Query: 844  MAANKTYKRYYSDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTI---- 899
            +   +    Y +D+ + +     +   +H  + +     L +  +A  NT   P I    
Sbjct: 540  IFREQNVIYYKNDDTKVMDEHYGD---LHGIISDLELEILLELQNAVLNT--KPAILLSG 594

Query: 900  QAISNIDCLLAITRTSEYLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATT 959
            +  + ++ L++  +T+  +     +P I ++            ++ ++ RHP +    T 
Sbjct: 595  KCFAELEVLVSFAKTA--ISQNYVQPVIEEK---------ECVIEIENGRHPLYE---TL 640

Query: 960  AKDFIPNDIEL----------GKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVP 1009
               +IPND+ +               R+ ++TGANA+GKS  L    + V +A +GC+VP
Sbjct: 641  VDTYIPNDLRMLGGTFDNDTWNNNFKRISVITGANASGKSVFLTQNGLIVFLAHIGCFVP 700

Query: 1010 CESAVLTPIDRIMTRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSS 1069
             ++A +  +D+I+TR+   +++ + +STF ++  +  K L +AT RSLL++DE G+G   
Sbjct: 701  ADNARIGLVDKILTRVVTRESVAKTQSTFEIDANQMSKCLSLATPRSLLLIDEFGKGTDV 760

Query: 1070 SDGFAIAESVLHHVATHIQSLGFFA-THYGTLASSFKHHPQVRPL---KMSILVDEATRN 1125
             DG ++  +++   +         A THY  + S      ++  +   K  IL+    + 
Sbjct: 761  IDGLSMFGAIIKDFSRSSSCPRVIASTHYNEVFSPNILTSEINGVVFYKTEILLQVMEKE 820

Query: 1126 ---------VTFLYKMLEGQSEGSFGMHVASMCGISKEIIDNAQIAADNLEHTSRLVKER 1176
                     +TFLYK+  G +  SFG+  A  CG+ + I+  AQ      E T+++    
Sbjct: 821  NKGNARDEMITFLYKLSTGIATNSFGIFCAKNCGLRQSIVQRAQ------ELTTQIADGF 874

Query: 1177 DLAAN 1181
            D+A N
Sbjct: 875  DIAKN 879

>YHR120W (MSH1) [2408] chr8 (349576..352455) Protein involved in
            mitochondrial DNA repair, homolog of E. coli MutS [2880
            bp, 959 aa]
          Length = 959

 Score =  128 bits (321), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 112/212 (52%), Gaps = 8/212 (3%)

Query: 955  LGATTAKDFIPNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAV 1014
            L A + + F  N+ EL K+   L ++TG N  GKST LR   I VI+AQ+GC+VPC  A 
Sbjct: 746  LSARSLETFTANNCELAKDN--LWVITGPNMGGKSTFLRQNAIIVILAQIGCFVPCSKAR 803

Query: 1015 LTPIDRIMTRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFA 1074
            +  +D++ +R+G+ D++    STF VE+ ET  IL  AT RSL ++DE+GRG S  +G +
Sbjct: 804  VGIVDKLFSRVGSADDLYNEMSTFMVEMIETSFILQGATERSLAILDEIGRGTSGKEGIS 863

Query: 1075 IAESVLHHVATHIQSLGFFATHYGTLASSF------KHHPQVRPLKMSILVDEATRNVTF 1128
            IA + L ++  + Q    FATH+G            K   +      S + D    N  +
Sbjct: 864  IAYATLKYLLENNQCRTLFATHFGQELKQIIDNKCSKGMSEKVKFYQSGITDLGGNNFCY 923

Query: 1129 LYKMLEGQSEGSFGMHVASMCGISKEIIDNAQ 1160
             +K+  G    S  + VA + G   E +  A+
Sbjct: 924  NHKLKPGICTKSDAIRVAELAGFPMEALKEAR 955

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 96/468 (20%), Positives = 182/468 (38%), Gaps = 61/468 (13%)

Query: 327 DCIVFFKKGKFFELYEKDALLANALFDLKIAGGGRA----NMQLAGIPEMSFEYWAAQFI 382
           D +V  + G F+ELY + A+      +L I+   RA     +  AG P           +
Sbjct: 95  DHVVLTQMGSFYELYFEQAIRYAP--ELNISLTNRAYSHGKVPFAGFPVHQLSRHLKMLV 152

Query: 383 Q-MGYKVAKVDQRESMLAKEMREGSKGIVKRELQCILTSGTLTDGDMLHSDLATFCLAIR 441
              GY V   +Q +    K++ +       R +  I+T GT  D    +    T+ L I 
Sbjct: 153 NNCGYSVTIAEQFKK---KDVADNEANKFYRRVTRIVTPGTFIDEAFENLRENTYLLNI- 208

Query: 442 EEPGNFYNETQLDSSTIVQKLNTKIFGAAFIDTATGELQMLEFEDDSECTKLDTLMSQVR 501
           E P N  ++   D+S  V        G  + D +TGE+    F        L + +++++
Sbjct: 209 EFPENCMSQVA-DTSLKV--------GICWCDVSTGEI----FVQQVYLRDLVSAITRIQ 255

Query: 502 PMEVVMERNNLSTLANKIVKFNSAPNAIFNEVKAGEEFYDCDKTYAEIISSEYFSTEEDW 561
           P E++++         ++++F+      + E+   ++F+         I  +   ++   
Sbjct: 256 PKEILLDE--------RLLEFHIESGTWYPELVELKKFF---------IKYQKMPSQHRT 298

Query: 562 PEVLKSYYDTGKK--------VGFSAFGGXXXXXXXXXXXXXXISMKNIK-EYDFVKSQH 612
            E     ++ G K        + F  F                  + +    +   + Q 
Sbjct: 299 IESFYGLFNLGGKEATERQLKIQFQTFTQKELAALRNTLIYVSNHLPDFSINFQIPQRQL 358

Query: 613 S---MVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAITPMGKRMMKKWLMHPLLRKNDI 669
           +   M +D  T   LE+ S   D + KG+L     R +TP G R++ +WL  P L   +I
Sbjct: 359 ATAIMQIDSRTSTALELHSTVRDNNKKGSLLSSIRRTVTPSGTRLLSQWLSGPSLDLKEI 418

Query: 670 ESRLDSVDSLLQDITLREQLEITFSKLPDLERMLARIHSRTIKVKDFEKVITAFETIIEL 729
           + R   V     +  + E L     K+ DL R+L +      +  +  ++  + E   E+
Sbjct: 419 KKRQKIVAFFKDNRDITETLRTMLKKVNDLSRILQKFSFGRGEALELIQMARSLEVSREI 478

Query: 730 QDSLKNN------DLKGDVSKYISS--FPEGLVEAVKSWTNAFERQKA 769
           +  L NN       LK  +++   S  F + L++ +  + N  E  K+
Sbjct: 479 RKYLLNNTSLMKATLKSQITQLTESLNFEKNLIDDILKFLNEEELAKS 526

>Scas_697.27
          Length = 948

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 116/212 (54%), Gaps = 8/212 (3%)

Query: 954  NLGATTAKDFIPNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESA 1013
            +L   + + F+ ND  L  E  +L ++TG N  GKST LR   I VI+AQ+G +VPC+SA
Sbjct: 734  SLAINSLEKFVGNDCNL--ESGKLWVITGPNMGGKSTFLRQNAIIVILAQIGSFVPCDSA 791

Query: 1014 VLTPIDRIMTRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGF 1073
             +  +D+I +R+G+ D++    STF VE+ ET  IL  AT+RSL ++DE+GRG S  +G 
Sbjct: 792  RIGLVDKIFSRVGSADDLYNEMSTFMVEMVETSCILRGATDRSLAILDEIGRGTSGKEGI 851

Query: 1074 AIAESVLHHVATHIQSLGFFATHYGTLASSFKHHPQVRPLKMSI------LVDEATRNVT 1127
            +IA + L ++    +    FATH+G       +    +  K +I      +++    N  
Sbjct: 852  SIAFATLKYLIKRNRCRSLFATHFGQELQVIVNEKDEQEAKDNIEFYQSGIIELGNENFV 911

Query: 1128 FLYKMLEGQSEGSFGMHVASMCGISKEIIDNA 1159
            + +K+  G  + S  + VA   G  +E +  A
Sbjct: 912  YDHKLKPGICKSSDAIKVARTAGFPEEALLEA 943

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 87/403 (21%), Positives = 153/403 (37%), Gaps = 63/403 (15%)

Query: 329 IVFFKKGKFFELYEKDALLANALFDLKIAGGGRAN--MQLAGIPEMSFEYWAAQFIQ-MG 385
           +V  + G F+ELY + A+    + ++ +     A+  +  AG P           +   G
Sbjct: 91  VVLTQIGSFYELYFEQAVKYAPILNISLTNRTYAHGKVPFAGFPVPQLGRHLKILVNDFG 150

Query: 386 YKVAKVDQRESMLAKEMREGSKGIVKRELQCILTSGTLTDGDMLHSDLATFCLAIREEPG 445
           Y V   +Q +     ++ E  +    R +  I+T GT  D    +    ++ L+I E P 
Sbjct: 151 YNVVIAEQFKK---NDVAENEQYKFIRRVTRIVTPGTFIDEAFENFQENSYLLSI-EFPE 206

Query: 446 NFYNETQLDSSTIVQKLNTKIFGAAFIDTATGELQMLEFEDDSECTKLDTLMSQVRPMEV 505
           N      L    +         G ++ D +TGE+    F        L + ++++RP E+
Sbjct: 207 NCMKRIALGDLKL---------GLSWCDVSTGEV----FVQQMFLKDLISSITRIRPKEI 253

Query: 506 VMERNNLSTLANKIVKFNSAPNAIFNEVKAGEEFYDCDKTYAEIIS-SEYFSTEEDWP-- 562
           ++   N     N IV              +GE        Y E+++  +YF   +  P  
Sbjct: 254 IL---NEDLYKNNIV--------------SGE-------WYPELVALKKYFLNYQRMPSQ 289

Query: 563 -EVLKSYYD---TGK--------KVGFSAFGGXXXXXXXXXXXXXXISMKNIKEYDFVKS 610
              ++S+YD   +G         K+ F  F                  + NI     +  
Sbjct: 290 HRTIESFYDLFTSGNTDSVIRQLKLQFQTFTQKELAALRNILIYISDHLPNISTNLQIPQ 349

Query: 611 QHS----MVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAITPMGKRMMKKWLMHPLLRK 666
           +      M +D  T   LE+ S   + S KGTL     R ITP G R++ +WL  P L  
Sbjct: 350 REITTSIMQIDSRTSSALELHSTVRNNSKKGTLLSSIRRTITPSGTRLLTQWLSGPSLDL 409

Query: 667 NDIESRLDSVDSLLQDITLREQLEITFSKLPDLERMLARIHSR 709
            +I +R   V   +++  + E +        D+ R+L +   R
Sbjct: 410 KEIRNRQKLVSYFMENPDIMEHIIQILKDTCDITRVLQKFSFR 452

>CAGL0I03586g 303943..306546 similar to sp|Q12175 Saccharomyces
            cerevisiae YDL154w MSH5 meiosis-specific protein,
            hypothetical start
          Length = 867

 Score =  123 bits (309), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 128/240 (53%), Gaps = 32/240 (13%)

Query: 949  RHPCFNLGATTAKDFIPNDIEL-----------GKEQPRLGLLTGANAAGKSTILRMACI 997
            RHP   L  T + +FIPNDI L              + R+ ++TGANA+GK+  L    +
Sbjct: 563  RHP---LLETLSDNFIPNDIILDGGMLKDINWFSSGRQRIAVVTGANASGKTIFLEQIAL 619

Query: 998  AVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIMQGKSTFFVELAETKKILDMATNRSL 1057
             V MA +GCYVP ++A +  +D I+T+  + D+I    S+F  +  +  KI+ +AT RS+
Sbjct: 620  IVYMAHIGCYVPADTAEIGLVDMILTKFKSFDSISTSMSSFERDSKQLSKIMSLATKRSI 679

Query: 1058 LVVDELGRGGSSSDGFAIAESVLHHVATHIQSLG----FFATHYGTL---ASSFKHHPQV 1110
            + +DE G+G  +  G ++  +++   +   Q  G      +TH+  +   +S  KH   +
Sbjct: 680  IFIDEYGKGTDTISGPSLLAAIIQRYS---QLPGAPRLLISTHFYEIFQKSSLLKHRGSI 736

Query: 1111 RPLKMSILVDEA------TRN--VTFLYKMLEGQSEGSFGMHVASMCGISKEIIDNAQIA 1162
            + L   I+++        T N  + F Y+++EG  + S G++ A +CGI KEII+ A++ 
Sbjct: 737  KFLTTKIVLNNCEVENLVTENEGIVFFYQIVEGICDSSLGIYCAKICGIKKEIINMAELV 796

>Kwal_33.14738
          Length = 963

 Score =  122 bits (306), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 110/205 (53%), Gaps = 10/205 (4%)

Query: 963  FIPNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIM 1022
            F  ND  L  +   L +++G N  GKST LR   I VIMAQ+G +VPC SA +  +D+I 
Sbjct: 754  FTSNDCSL--QGGTLWVVSGPNMGGKSTFLRQNAIIVIMAQVGSFVPCASARIGLVDKIF 811

Query: 1023 TRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHH 1082
            +R+G+ D++    STF VE+ ET  IL  AT RSL ++DE+GRG S  +G +IA + L H
Sbjct: 812  SRIGSADDLYNEMSTFMVEMIETSYILKGATERSLAILDEIGRGTSGKEGISIAYATLKH 871

Query: 1083 VATHIQSLGFFATHYG-------TLASSFKHHPQVRPLKMSILVDEATRNVTFLYKMLEG 1135
            + +  +    FATH+         L S+      V   K S + D    + T+ +++  G
Sbjct: 872  LVSRNRCRSLFATHFAKELEQLLNLQSNCTFQRNVSYYK-SGVYDIGKGDYTYNHRLTPG 930

Query: 1136 QSEGSFGMHVASMCGISKEIIDNAQ 1160
                S  + VAS  G   E + +AQ
Sbjct: 931  ICTKSDAIRVASKAGFPDEALSDAQ 955

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 89/421 (21%), Positives = 167/421 (39%), Gaps = 67/421 (15%)

Query: 309 NKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDALLANALFDLKIAG----GGRANM 364
           N   P  +   +   K  D +V  + G F+ELY + A +     +L +       G+ + 
Sbjct: 81  NSLPPSLQYVRDTMDKYQDYVVLTQMGSFYELYFEHAEIYAPKLNLTLTSREYVHGKVSF 140

Query: 365 QLAGIPEMSFEYWAAQFIQMGYKVAKVDQ--RESMLAKEMREGSKGIVKRELQCILTSGT 422
               +P++S  +        G+ VA  DQ  ++++++ +     + + +     I+T GT
Sbjct: 141 AGFPVPQIS-RHLKVLVKDYGHSVAIADQFKKDNIISNDTSRFLRRVTR-----IVTPGT 194

Query: 423 LTDGDMLHSDLATFCLAIREEPGNFYNETQLDSSTIVQKLNTKIFGAAFIDTATGELQML 482
             D    +    TF L++ E P N   +        V  ++TK+ G  + D +TGE+   
Sbjct: 195 FIDEAFENLQENTFLLSL-EFPENCMRK--------VADIDTKV-GLCWCDISTGEI--- 241

Query: 483 EFEDDSECTKLDTLMSQVRPMEVVMERNNLSTLANKIVKFNSAPNAIFNEVKAGEEFYDC 542
            F        + + ++++ P E++        L  +I+ F       + E    ++F+  
Sbjct: 242 -FVQQVLLKDVVSAITRIAPCEIL--------LDEEILAFKIESGEWYPEFVELKKFF-- 290

Query: 543 DKTYAEIISSEYFSTEEDWPEVLKSYYDT-------GKKVGFSAFGGXXXXXXXXXXXXX 595
              Y +I SS            ++S++         GK   FS F               
Sbjct: 291 -IKYQKIPSSH---------RAIRSFHRLFSPADMEGK---FSPFDIALHNFSQKETAAL 337

Query: 596 XISMKNIKEY--------DFVKSQHS---MVLDGITLQNLEIFSNSFDGSDKGTLFKLFN 644
             ++  ++E+           K Q +   M +D  T   LE+ S     + KG+L     
Sbjct: 338 RNTLLYLEEHLPDMEVNLQVPKRQITSSIMQIDSRTCSALELSSTMRTNTRKGSLLSAIR 397

Query: 645 RAITPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDITLREQLEITFSKLPDLERMLA 704
           R +TP G R++ +WL  P +   +I+ R + V     + TL E L  T  K  D+ R+L 
Sbjct: 398 RTVTPSGSRLLSQWLSAPSMDIKEIKQRQELVTLFRNNPTLTESLVRTLKKTYDMPRILQ 457

Query: 705 R 705
           +
Sbjct: 458 K 458

>CAGL0L13002g 1388045..1390894 similar to sp|P25846 Saccharomyces
            cerevisiae YHR120w MSH1, hypothetical start
          Length = 949

 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 109/206 (52%), Gaps = 8/206 (3%)

Query: 963  FIPNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIM 1022
            F  N+ +L      + +++G N  GKST LR   I  I+AQ+GC+VPC  A +  +D+I 
Sbjct: 736  FTANNCDLSSND--IWVISGPNMGGKSTFLRQNAIIAILAQIGCFVPCRKAHIGLVDKIY 793

Query: 1023 TRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHH 1082
            +R+G+ D++    STF VE+ ET  IL+ AT+RSL ++DE+GRG S  +G A+A   L H
Sbjct: 794  SRVGSADDLYNDMSTFMVEMVETSLILNGATDRSLAILDEIGRGTSGKEGVAVAYGTLKH 853

Query: 1083 VATHIQSLGFFATHYGTLASSFKHHP------QVRPLKMSILVDEATRNVTFLYKMLEGQ 1136
            +  + +    FATHY                 ++   + SI          + +KM  G 
Sbjct: 854  LLQNNKCRSLFATHYAQELKQVADQDLSEDTHRIHYFQTSIRETNDPNKFYYDHKMRPGI 913

Query: 1137 SEGSFGMHVASMCGISKEIIDNAQIA 1162
            S+ S  + VA + G  ++ +++A  A
Sbjct: 914  SQKSDALKVARIAGFPQDALNDASTA 939

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 113/497 (22%), Positives = 191/497 (38%), Gaps = 88/497 (17%)

Query: 323 SKMWDCIVFFKKGKFFELYEKDALLANALFDLKIAGGG--RANMQLAGIPEMSFEYWAAQ 380
           S+  D +V  + G FFELY   A     L ++ +         +  AG P          
Sbjct: 73  SQYPDHVVLTQMGSFFELYFDHASTYAPLLNIALTQRTYTHGKVPFAGFPVPQLSRHLKA 132

Query: 381 FIQ-MGYKVAKVDQ--RESMLAKEMREGSKGIVKRELQCILTSGTLTDGDMLHSDLATFC 437
            +Q  GY V   +Q  ++     E     + + +     I+T GT  D  + +    TF 
Sbjct: 133 LVQDYGYSVVVAEQFKKDGYATNENNRFYRRVTR-----IVTPGTFIDEALDNYSENTFL 187

Query: 438 LAIREEPGNFYNETQLDSSTIVQKLNTKIFGAAFIDTATGELQMLEFEDDSECTKLDTLM 497
           L I E P NF N    D+  I         G ++ D +TGE+ + E         L   +
Sbjct: 188 LTI-EFPENFTNYVAEDNLRI---------GISWCDISTGEIYIQELP----LKDLMNAI 233

Query: 498 SQVRPMEVVMERNNLSTLANKIVKFNSAPNAIFNEVKAGEEFYDCDKTYAEIISSEYF-- 555
           ++++P E+++   N   L++ I+  N  P                    AE+    YF  
Sbjct: 234 TRIKPKEILL---NARELSDDIISGNWYPQ------------------LAEL--KRYFIN 270

Query: 556 -STEEDWPEVLKSYYDTGKKVGFSAFGGXXXXXXXXXXXXXXISMKNIKEY--------- 605
             T       L +Y+D       S                   +++N+  Y         
Sbjct: 271 YYTTTTRYRTLDTYFDMFAATRASGMRQRLRMELNEYSIKETAALRNLLSYVAEHLPECA 330

Query: 606 ---DFVKSQHS---MVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAITPMGKRMMKKWL 659
               F K Q +   + +D  T + LE+ S   D S +GTL     R +TPMG R++ +WL
Sbjct: 331 INFQFPKRQITTDILQIDSRTTKALELHSTIRDNSKRGTLLNTMRRTVTPMGTRLLSQWL 390

Query: 660 MHPLLRKNDIESRLDSVDSLLQDITLREQLEITFSKLPDLERMLARIHSRTIKVKDFEKV 719
             P +   +I+ R   V   L D    +++     K+ D+ ++L + +       +  ++
Sbjct: 391 SGPSMNIKEIKLRQSIVSLFLADKRSHDKIISELKKIQDIVKLLQKFNFGRGTPLEMLEL 450

Query: 720 ITAFETIIELQDSLKNNDL--------KGDVSKYIS--SFPEGLVEAVKSWTNAFERQKA 769
           + + +T   LQ  L  NDL        K  +S+ I   +FPE  +E + +         A
Sbjct: 451 VKSLKTAQVLQSLL--NDLLKESNGKSKNGISEIIERLTFPELFLEEISN---------A 499

Query: 770 INENIIVPQ--RGFDIE 784
           +NE  I+ Q  R F+ E
Sbjct: 500 LNEEHIIYQGERTFNTE 516

>Scas_707.28
          Length = 881

 Score =  121 bits (303), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 133/531 (25%), Positives = 232/531 (43%), Gaps = 52/531 (9%)

Query: 610  SQHSMVLDGITLQNLEIFSNSFDGSDKGTLF-KLFNRAITPMGKRMMKKWLMHPLLRKND 668
            ++++M++D  T+  LE+  N  D   +G  F K  N   T MG+R ++  ++ PL  +  
Sbjct: 263  TENTMLIDPKTINGLELVENIID--KRGMSFWKFLNTTCTKMGERSLRNNILQPLTDEKS 320

Query: 669  IESRLDSVDSLLQDITLREQLEITFSKLPDLERMLARIHSRTIKVKDFEKVITAFETIIE 728
            I  R ++V  L  D  L EQL        DL+R+  ++ S        E+ I     +I 
Sbjct: 321  IIMRQEAVKELQGDEKLLEQLRKHMKVYQDLDRIFVKLLSVNHNAIKAEQKINY---VIL 377

Query: 729  LQDSLKNNDLKGDVSKYISSFPEGLVEAVKSW-----TNAFER--QKAINENIIVPQRGF 781
            L+DSL        + + I  F   L++ VK           E+   K INE+ I      
Sbjct: 378  LKDSLITTQRLKAILEPIE-FESRLLQEVKKIFFNESITEIEQCINKYINEDCIWASSNL 436

Query: 782  DIE--------------FDKSMDRIQELEDELMEILMTYRKQFKCSNIQYKDSGKEIYTI 827
            +++               + S    + L +++ME +    K+F    + Y       + +
Sbjct: 437  ELKNQQTYAVNDSANSLLEISRQLYKNLMNDIMEEIEGLSKEFDLP-LDYSFDSNRGFFL 495

Query: 828  EIP---ISATKNVPSNWVQMAANKTYKRYYSDEVRALARSMAEAKEIHKTLEEDLKNRLC 884
            +I    I+   ++P+ ++   + K +    +  +  +   + E      ++ E +   L 
Sbjct: 496  KIKKGEINDLNSLPNEFINKISKKNFIECCTLNIMKMNVRLKEIILEISSISEQVVLELL 555

Query: 885  QKFDAHYNTIWMPTIQAISNIDCLLAITRTSEYLGAPSCRPTIVDEVDSKTNTQLNGFLK 944
             +   + + ++M + +A+S +D L +    S       C P        K +T L  FL+
Sbjct: 556  NEVVKYLSILFMIS-EAVSILDLLCSFAFKS--FKENYCFP--------KFSTNL--FLR 602

Query: 945  FKSLRHPCFNLGATTAKDFIPNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQM 1004
                RHP      T  K F+PNDI   K    + ++TG N +GKS  L+   +  IM+Q+
Sbjct: 603  --QSRHPIL---ETLIKGFVPNDIVSTKTSSAVQIITGCNRSGKSVYLKQLPLLCIMSQI 657

Query: 1005 GCYVPCESAVLTPIDRIMTRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELG 1064
            G  VP ESA++    ++  R+  ND +    STF  E+ E    LD     +LL++DELG
Sbjct: 658  GSPVPAESAIVPIYKKVHARV-CNDTMEMNSSTFSFEMKEMAYFLDDTDQDTLLIIDELG 716

Query: 1065 RGGSSSDGFAIAESVLHHVATHIQSLGFFATHYGTLASSFKHHPQVRPLKM 1115
            RG S  DGF+I+ ++  H+    +     +TH+  + S     P V  L M
Sbjct: 717  RGSSIGDGFSISLAITEHL-IGTKGTVLLSTHFEAIPSILVTRPNVLHLHM 766

>CAGL0F02167g complement(216080..218767) similar to sp|P40965
            Saccharomyces cerevisiae YFL003c MSH4 meiosis-specific
            protein, start by similarity
          Length = 895

 Score =  115 bits (288), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 92/155 (59%), Gaps = 2/155 (1%)

Query: 961  KDFIPNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDR 1020
            K++I NDI       RL ++TGAN  GK+  LR   +  IMAQMG  +P E+A+L   + 
Sbjct: 625  KNYIRNDISSTLYSSRLQIITGANMTGKTAFLRQIPLLCIMAQMGSPIPAENAILPVYEN 684

Query: 1021 IMTRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVL 1080
            I TRL  ND++    S F  E+ E   IL+     SL+++DELGRG S  DGFAI+ ++L
Sbjct: 685  IHTRL-CNDSMEMTSSNFSFEMKEMAYILECCNAESLIIIDELGRGTSIGDGFAISLAIL 743

Query: 1081 HHVATHIQSLGFFATHYGTLASSFKHHPQVRPLKM 1115
            ++++  ++S  F +TH+  +    K+ P +R L M
Sbjct: 744  NYLS-KLESTTFISTHFDVIPMILKNKPSIRHLHM 777

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 54/96 (56%), Gaps = 2/96 (2%)

Query: 611 QHSMVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAITPMGKRMMKKWLMHPLLRKNDIE 670
           ++++++D  T+ NLE+   + +G +K +LF   N   T MG R ++  ++ PL   N I 
Sbjct: 276 ENTLLIDSKTVTNLELI-RTLEGDEKLSLFGTLNTTCTKMGYRNLRGAILQPLTDLNGIT 334

Query: 671 SRLDSVDSLLQDITLREQLEITFSKLPDLERMLARI 706
           +RL SV+  L +      + +   +LPDL+ + +++
Sbjct: 335 NRLKSVEE-LTECEFLNGIRLVLRQLPDLDIVFSKL 369

>YDL154W (MSH5) [716] chr4 (178335..181040) Meiosis-specific protein
            involved in reciprocal recombination, not involved in
            mismatch repair [2706 bp, 901 aa]
          Length = 901

 Score =  110 bits (275), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 123/224 (54%), Gaps = 25/224 (11%)

Query: 972  KEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNI 1031
            + + R+ ++TGANA+GKS  L    + V +AQ+GC+VP E A +   D+I+TR+   + +
Sbjct: 633  QNKGRIIVVTGANASGKSVYLTQNGLIVYLAQIGCFVPAERARIGIADKILTRIRTQETV 692

Query: 1032 MQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQSLG 1091
             + +S+F ++  +  K L +AT +SL+++DE G+G    DG ++  S++ +++   +   
Sbjct: 693  YKTQSSFLLDSQQMAKSLSLATEKSLILIDEYGKGTDILDGPSLFGSIMLNMSKSEKCPR 752

Query: 1092 FFA-THYGTLASSFKHHPQVRPLK---MSILV--------------DEATRNVTFLYKML 1133
              A TH+  L +       ++ +K     IL+              D  +  +TFL+K+ 
Sbjct: 753  IIACTHFHELFNENVLTENIKGIKHYCTDILISQKYNLLETAHVGEDHESEGITFLFKVK 812

Query: 1134 EGQSEGSFGMHVASMCGISKEIIDNAQIAADNLEHTSRLVKERD 1177
            EG S+ SFG++ A +CG+S++I++ A       E  SR++   D
Sbjct: 813  EGISKQSFGIYCAKVCGLSRDIVERA-------EELSRMINRGD 849

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 69/140 (49%), Gaps = 12/140 (8%)

Query: 607 FVKSQHSMVLDGITLQNLEIFSNSFD-GSDKG------TLFKLFNRAITPMGKRMMKKWL 659
           ++  +  MVLD  T+  L IF  +   G DK       ++F+LFN+  +   +R++K WL
Sbjct: 240 YIDIRDRMVLDENTISALHIFPTAHKLGHDKMMRNGFFSVFELFNQVSSDYARRILKSWL 299

Query: 660 MHPLLRKNDIESRLDSVDSLL--QDITLREQLEITFSKLPDLERMLARIHSRTIKVKDFE 717
           ++PL  K  IE+R   + +LL  Q+  +   L  +  + PD    + ++ S    +  + 
Sbjct: 300 INPLTNKKRIETRYSIIRTLLDKQNAIIFSDLSQSIKRCPDAFGFINQLRSGKSTLGTWS 359

Query: 718 KVITAFE---TIIELQDSLK 734
           KV +  E    I +L  SLK
Sbjct: 360 KVASFLEKGIAIFQLVSSLK 379

>CAGL0K00869g complement(88607..88945) weakly similar to sp|P42939
           Saccharomyces cerevisiae YGR206w, hypothetical start
          Length = 112

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 45/92 (48%), Gaps = 5/92 (5%)

Query: 670 ESRLDSVDSLLQDITLREQLEITF--SKLPDLERMLARIHSRTIKVKDFEKVITAFETII 727
           +++L ++D +L +I LR +    +   +L  +E  L +I +     K FE      + II
Sbjct: 3   DNQLKNIDDILNNIPLRNKFGDNYPRERLSKVEVPLYKIENIADSKKMFEPWYKECDEII 62

Query: 728 ---ELQDSLKNNDLKGDVSKYISSFPEGLVEA 756
              E+ D L  N  +    KYIS+ P G+V+ 
Sbjct: 63  AACEVHDQLGRNFEQWYNEKYISTKPPGMVQG 94

>ACL004W [1045] [Homologous to ScYOL004W (SIN3) - SH]
           complement(347727..351860) [4134 bp, 1377 aa]
          Length = 1377

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 56/116 (48%), Gaps = 16/116 (13%)

Query: 684 TLREQLEITFSKLP-------DLERMLARIHSRTI--KVKDF---EKVITAFETIIEL-- 729
           T+R ++++  S +P        LE  L  +   T   K K F   +++ T F  I+ L  
Sbjct: 470 TVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYS 529

Query: 730 QDSLKNNDLKGDVSKYISSFPEGLVEAVKSWTNAFERQKAINENIIVPQRGFDIEF 785
           QD L+   L  DVS Y+S  PE L +  KS+    ER K I EN+I  +   D++ 
Sbjct: 530 QDLLEKEKLVEDVSHYLSGSPE-LFDWFKSFVGYQERPKHI-ENVIHEKHRLDLDL 583

>YER034W (YER034W) [1459] chr5 (221845..222402) Protein of unknown
           function [558 bp, 185 aa]
          Length = 185

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 23/47 (48%)

Query: 843 QMAANKTYKRYYSDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDA 889
           Q A      RYY D V     S     E++K L++ LKNRL Q  DA
Sbjct: 54  QPALKSNEDRYYEDPVLEDPHSAVANAELNKVLKDVLKNRLQQNDDA 100

>ACR244C [1291] [Homologous to ScYKR062W (TFA2) - SH]
           (789953..790855) [903 bp, 300 aa]
          Length = 300

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 47/114 (41%), Gaps = 20/114 (17%)

Query: 886 KFDAHYNTIWMPTIQAISNIDCLLAITRTSEYLGAPSCRP---------TIVDEVDSKTN 936
           KFD   NT+   +I  + + + LL +TRT       SC+           ++DE++ K  
Sbjct: 141 KFDPKKNTLQYVSIYDVHSAEELLKLTRTQVTFKGISCKELKDGWPQCFEVIDELEKKNR 200

Query: 937 TQLNGFLKFKSLRHPCFNLGATTA---KDFI--------PNDIELGKEQPRLGL 979
             ++   K  S R   +N G       +DF+        P   EL ++   LGL
Sbjct: 201 ILVSRTKKDNSPRFVWYNFGGPLGEIDEDFVKMWENCKLPQRSELPRKLQDLGL 254

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.130    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 38,323,100
Number of extensions: 1679622
Number of successful extensions: 8353
Number of sequences better than 10.0: 129
Number of HSP's gapped: 8538
Number of HSP's successfully gapped: 174
Length of query: 1220
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1107
Effective length of database: 12,684,275
Effective search space: 14041492425
Effective search space used: 14041492425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)